CLUSTAL format seed alignment for MF_00081

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

HRCA_CHLMU      ------MENRTEMSQLRASKKDSKISHVLLMAIKLYLESGQPVGSKLLKETYCSDLSSAT
HRCA_CHLTR      ------MENRIEMSQLRASKKDSKISYVLLMATKLYLEGGQPVGSKLLKETYCSDLSSAT
HRCA_CHLPN      MLSVTIVLVGLEMARSKVSKRDSKILDILFATTELYLKTGQPVGSKTLKESFCSDLSTAT
HRCA_AGRFC      --MGFSAPLS----KDQASLLDERSREIFRRIVEGYLDTGEPLGSRSLSRLLPMSLSPAS
HRCA_BRADU      --MAHHDPIHLIAPRAGLAQLNERSRDIFRQIVESYLATGEPVGSRNISRLIAMPLSPAS
HRCA_CAUVN      MTQLFPGPIV---RTPGLAELDARARDIFRRVVESYLETGEPVGSRTISKG-GVALSPAS
HRCA_XYLFA      ------------MCASFSPTLDSRSRQLLRTLISCYIQNGEPVGSKTLAQQAGLDISPAT
HRCA_STRAL      -------------------MLSERRLEVLRAIVQDYVGTEEPVGSKALTERHRLGVSPAT
HRCA_STRCO      -------------------MLSERRLKVLRAIVQDYVGTEEPVGSKALTERHNLGVSPAT
HRCA_MYCTU      -----------------MGSADERRFEVLRAIVADFVATQEPIGSKSLVERHNLGVSSAT
HRCA_MYCGE      -----MKN------------LTPRQAQILKAIINEYIAYAIPVGSKLLTKKYFKNLSGGT
HRCA_MYCPN      -----MKN------------LTTRQAQILKAIINEYIAYPVPVGSKLLTKKYFKNLSGGT
HRCA_UREPA      -----MKNTKTSQEQVIELKLSDRQKKVLKSIVDEYTISATPVSSKLLVQKEFKDQSSAT
HRCA_GEOSE      -------------------MLTERQLLILQVIIDDFIRSGQPVGSRTLSKKHEIALSSAT
HRCA_BACSU      -------------------MLTNRQLLILQVIINDFIKSAQPVGSRTLSKKDEITFSSAT
HRCA_LYSSH      -------------------MLTNRQLQILQVIIDDFILSAQPVGSRQISKKQGITFSPAT
HRCA_LISMO      -------------------MLTERQLLIFRAIIDHFTWTIQPVGSKNLLKEKGLPYSSAT
HRCA_LACSK      -------------------MLTERQLMILKEIIRLFTESGQPVGSKKLMSELPMHVSSAT
HRCA_STRMU      -------------------MITQRQKDILNLIVELFTKTHEPIGSK--TLQNSIASSSAT
HRCA_STRPN      -------------------MVTERQQDILNLIIDIFTKTHEPVGSK--ALQESINSSSAT
HRCA_LACLM      -------------------MITERQRQILNLIVSLYAKDHTPIGSK--SLLDSIQASSAT
HRCA_HELPY      -----------MLRRIKVGSNLNKKESLLDAFVKTYLQILEPISSKRLKELADLKISCAT
HRCA_HELPJ      -----------MLKRIKVGSDLNKKESLLDAFVKTYLQTLEPISSKRLKELANLKVSCAT
HRCA_CLOAB      ------------------MEMEERKLKILQAIINDYINNGEPVGSRTIAKKYNLGISSAT
HRCA_LEPIN      ------------------MDLTERHKRILKALVDEFIQENRPVGSKTLFDKHDIGLSPAS
HRCA_STAAM      -------------------MITDRQLSILNAIVEDYVDFGQPVGSKTLIERHNLNVSPAT
HRCA_MYCCT      -------------------MLTKRQVKILQTIVEEFIKTNQPVGSKRILELLDIKISSAT
HRCA_SYNY3      --------------MVKPLRLNDRHQQILRATVQHYIATAEPVGSHTLAQEYQFAVSSAT
HRCA_THEMA      ------MRRLNRKNNEALKKLNDRQRKVLYCIVREYIENKKPVSSQRVLEVSNIEFSSAT
HRCA_CAMJE      -----------------MMKSRDKKDLILESIIQTYLLDNAPIGSN--ELNSNLCIPAST
                                       :   ::      :     *:.*.          . .:

HRCA_CHLMU      IRNYFAQLETDGFLRKNHISGGRIPTDLAFRYYADHCSPVLEQEEISIIQQKLKELPEY-
HRCA_CHLTR      IRNYFAQLETDGFLRKNHISGGRIPTDLAFRYYADHNAPFLEQEEILAIQQKLTELPEY-
HRCA_CHLPN      IRNYFAELEAEGFLKKNHTSGGRIPTDLALRHYVDHQEECPEAEISAPIFDKISQLPSE-
HRCA_AGRFC      VRNVMSDLEELGLIYSPHISAGRLPTQTGLRFFVDAFMQV-GDLPADERANIDRQIGPVA
HRCA_BRADU      VRNVMADLEQLGLIYAPHTSAGRLPTELGLRFFVDALMQV-GDLNDAERQSIQSQLTSV-
HRCA_CAUVN      IRNTMQDLAQLGLLDAPHTSAGRMPTHAGLRMFVDGFLEV-GDVAEQEKRAIEARLAVK-
HRCA_XYLFA      IRNILADLEELGLLNSPHTSAGRVPTAHGYRMFVDSLVQM-QPPSEDDIRRLRVEMAGG-
HRCA_STRAL      VRNDMAALEDEGYIAQPHTSAGPIPTDKGYRLFVDRLADV-KPMTAPERRAIHHFLDQA-
HRCA_STRCO      VRNDMAALEDEGFIAQPHTSAGRIPTDKGYRLFVDKLAGV-KPMTAPERRAIQNFLEGA-
HRCA_MYCTU      VRNDMAVLEAEGYITQPHTSSGRVPTEKGYREFVDRLEDV-KPLSSAERRAIQSFLESG-
HRCA_MYCGE      LRNEMAALEKKGFLKKNHISSGRVPSQIGYQYYVKVLNV--SNTTNDLKTRLRSVILQQ-
HRCA_MYCPN      LRNEMAVLEKEGYLKKNHISSGRIPSQLGYQYYVKLLTK--NDDKSNLKTRLRAIILQK-
HRCA_UREPA      IRNEMMFLEKNGLIEKQHISGGRVPSLKGYDFYNKNLINKNNNVSDNFKMRLHKILSKR-
HRCA_GEOSE      IRNEMADLEELGYIEKTHVSSGRVPSEKGYRYYVDHLLSP-QRLTKDDIQKIKSIFAER-
HRCA_BACSU      IRNEMADLEELGFIEKTHSSSGRVPSEKGYRYYVDHLLSP-VKLTKSDLDQIHSIFKEK-
HRCA_LYSSH      IRNEMADLEELGYLEKTHTSSGRVPSEKGYRFYVDHLLSP-QGINSRDIQQIQSIFNDR-
HRCA_LISMO      IRNEMGVLEEYGFIEKTHSSSGRVPSEKGYRFYVDYLLQP-KKLDKSDRQMIRSFFSEN-
HRCA_LACSK      IRNDMADLENVGLIEKTHSSSGRVPSMKGYRYYLDHLIQP-AVLNPMDVATVQQSFGRH-
HRCA_STRMU      IRNDMAALEKLGLLEKAHTSSGRLPSQEGFRYFVEHSLNP-DSLDEQDVYQVIKAFDFE-
HRCA_STRPN      IRNDMAELEKQGLLEKAHTSSGRMPSVAGFQYYVKHSLDF-DRLAENEVYEIVKAFDQE-
HRCA_LACLM      IRNDMKALERLGLIQKEHTSSGRIPSVSGYKYFVENVIQL-EEFSQNDLFKVMKAFDGD-
HRCA_HELPY      IRNYFQILSKEGMLYQAHSSGARLPTFKAFENYWQKSLRF--------------------
HRCA_HELPJ      IRNYFQILSKEGMLHQAHSSGARLPTFKAFENYWHKSLRF--------------------
HRCA_CLOAB      IRNEMADLEEMGYIEQLHTSSGRKPSDKGYRLYVDRLMEIPSMSVEEEMLIKAKIIDSA-
HRCA_LEPIN      IRTVLKDLEDFGYLASKHTSGGRIPTERGYRFYVDSLVILYELTLKEKQRIQQEYLKMQ-
HRCA_STAAM      IRNEMKQLEDLNYIEKTHSSSGRSPSQLGFRYYVNRLLEQTSHQKTNKLRRLNQLLVEN-
HRCA_MYCCT      IRNESAILEHEGYLEKQHTSSGRTPSTKGYRYYVDNIMKLDSADYTRLKIYLNQLLDLR-
HRCA_SYNY3      IRNALGQLEKAGLLYQPHVSAGRVPSDSGYRIYVDNLLTWSDRQSRTVKQRLENEINGD-
HRCA_THEMA      IRNDMKKLEYLGYIYQPHTSAGRIPTDKGLRFYYEEMLKISKETSEADLAVETFKSMPL-
HRCA_CAMJE      IRVYLKRLSDEGLITQLHISSGRIPTILTMQNYWQNFWEK--------EQDKNIHIKNE-
                :*     *   . :   * *..  *:      : .                         

HRCA_CHLMU      --SKNIVKDLQKASEILSEILQLPVCFS-SPRFESDSVTNIQLVSIDDLRVVFVLSTEFG
HRCA_CHLTR      --SKNIVKDLQKASEVLSDILQLPVCFS-SPRFESDSVINIQLVAIDDQRVVFVLSTEFG
HRCA_CHLPN      --SRNIIKDLQKATELLGEILDLPTFFS-SPRFENDSVTNIQITQVDKQRAVTILSTEFG
HRCA_AGRFC      GHEQSLEGLLTEASRMLSGMSRGAGLVL-TAKND-VILKHVEFIRLEPTKALAVLVGDHN
HRCA_BRADU      GQAQSVEAALDQALTRLSGLTRAAAVVL-TPKSN-ARLKHIEFVRLEPEKALVILVGEDG
HRCA_CAUVN      --GRSFEEALAEASSILSGLAGGAGIVV-TPVRE-GGVKHVEFVPLGGGQVLAVMVFEDG
HRCA_XYLFA      ----GTQALLGNASEILSAMTHFVGVVS-APRREQFVFRHIDFVPLDARQIMAILIFADN
HRCA_STRAL      ---VDLDDVVARTVRLLAHVTRQVAVVQ-YPSLTRSTVRHVELLSMAPARLMLVLITDTG
HRCA_STRCO      ---VDLDDVVARTVRLLAQLTRQVAVVQ-YPSLTRSTVRHVELLSLAPARLMLVLITDTG
HRCA_MYCTU      ---VDLDDVLRRAVRLLAQLTRQVAVVQ-YPTLSTSTVRHLEVIALTPARLLMVVITDSG
HRCA_MYCGE      --HKTIDEVIELGVKFINEIINLPVVLT-NFS-SDEVLKKIDLIILDKSFALFLLVSASG
HRCA_MYCPN      --HKTIDEIIELGVKFINEMVNLPVVLT-HFS-SDEVLKKIDLIMLDQSCALLLLVSASG
HRCA_UREPA      --YSNIDEILNAAVSIINETTQLPAVVT-KTS-SDELLKRIDLVKINDNSALVLIVTSSE
HRCA_GEOSE      --IYELEKVVQKSAQILSDLTNYTSIAL-GPAVKENKLKRIQIIPLNQQTAVAIIVTDTG
HRCA_BACSU      --IFELEKTVQKSAQILSDLTNYTSIVL-GPKLSENYLKQIQIIPIQPDMAVAILVTNTG
HRCA_LYSSH      --LVEVEHIIRKSANILSELTSYTSILL-GPDVQRHRVKRFSIVPLSSDTAVAIIVTNNG
HRCA_LISMO      --YYEMEGLIQNSALMLSDLTNYTSILL-GPEATKNHLSGFRFVPINNFQAMLILITDQG
HRCA_LACSK      --YHKIDEIVSQSANILSNLTSYTAITL-GPEMAEIRLTGFRLVPLGNHQVMAIIVTSAG
HRCA_STRMU      --AFRLGDLLQRASDVLANLTGYTALIL-DVEPKKQRLTTFDIVKLSNHDALAVLTLDEA
HRCA_STRPN      --FFKLEDILQEAANLLTDLSGCTVVAL-DVEPSRQRLTAFDIVVLGQHTALAVFTLDES
HRCA_LACLM      --FYRLSDLFKTAAKSLSELTGLTSFVL-NAPQRDQQLVSFEMVMLDNHSVLSVITLGTG
HRCA_HELPY      ----ETLKVNEKRLKSASENFGLFTLLK-KPS-----LERLERVIECEKRFLILDFLAFS
HRCA_HELPJ      ----EVLKVNEKRLKSASENFGLFTLLK-KPS-----LERLERVIECEKRFLILDFLAFS
HRCA_CLOAB      --LYEIDKLVKQAMSLVSEMTKLTCVVK-SLSARKSYIKSISLINIEPNMILCVFITDSG
HRCA_LEPIN      ---FKLDQILKATASVLSSLSNAAGIVI-GPAKNLDTLKHIELIHVRGDEILMILVMRSG
HRCA_STAAM      --QYDVSSALTYFADELSNISQYTTLVV-HPNHKQDIINNVHLIRANPNLVIMVIVFSSG
HRCA_MYCCT      --KYDIDKTINYASEIISELTKMTAVVIKKQNIKNIKLKKIELILLSEFLASVLFIFSDG
HRCA_SYNY3      --NWHFEALIQRMGQILAGLSGYIALIT-FPQTETVQLRHLQLMLLPSHQILIILVTDSY
HRCA_THEMA      ---ADPEKVLFLAGNLLARLTEGYVLIE-RPNTRDLKILRVMLIPVSEDYLIFSILTEFG
HRCA_CAMJE      ----SFLKELSKEFEIYCLVYGGRSLVL---KEVLDLNTKFIVLDFEDEELVLKYEKEAW
                                                        .                   

HRCA_CHLMU      QLFTDVLWLPEQLPENS-------LKRIESFLQNYLRKHPSSVPLSQKEEDLGMTL----
HRCA_CHLTR      QVFTDVLWLPEQLPENS-------LKRIEGFLQNYLRKQPSDSLLSQKEKDLGMVL----
HRCA_CHLPN      QIFTDTLWLPEACDTLS-------IKRIEKFLQNYIRKLPTNEELSKKEEHLSMSL----
HRCA_AGRFC      QVENRIIELPAGISSSQ-------LTEAANFINAHLSGQTLQELRGQFQTQRTELQSELG
HRCA_BRADU      QVENRVLTLPPGVPSSA-------ITEAGNFLNSRIRGRTLAEARLELETALGEARAELD
HRCA_CAUVN      QVENRLMRQAPGVTPSA-------LQEASNFLNARLRGRTLTEARTEMGGELDAARRQLN
HRCA_XYLFA      EVQNRVIEPRRVYEPGE-------LERVSNYLNAHFIGRTLADIRTTVLCELRKAKDEME
HRCA_STRAL      RVEQRMIDCPAPFGESS-------VADLRARLNSQVAGRRFADVPQLVQDLPESFESEDR
HRCA_STRCO      RVEQRMVDCPAPFGEAS-------LADLRARLNSRVAGRRFADVPALVEDLAEPFEAEDR
HRCA_MYCTU      RVDQRIVELGDVIDDHQ-------LAQLREILGQALEGKKLSAASVAVADLASQLGGAGG
HRCA_MYCGE      KVFKKTISYANQRQFED-------IVICVRIFNDRIIDTRFSEINNQLEVLKEIIRTKVH
HRCA_MYCPN      NVFKKTISYANQRQFED-------IMVCVRIFNDRIIDTRFCDIAQHLDVLKEIIRSKVH
HRCA_UREPA      NILTHSIKLDKNTKFND-------LQTCFSVLDERLVDTKLSLISSKLDLIVDIVRNKLE
HRCA_GEOSE      HVENHVITVPASVNPSD-------LEKMVNIFNERLIGVPLVDLKDKIYKKVADVLRKHI
HRCA_BACSU      HVENKTINFPTKMDLSD-------IEKLVNILNDRLSGVPMDELNERIFKEVVMYLRQHI
HRCA_LYSSH      HVENRLFNLPPDFTASD-------LEKMVNILNDRLIGVSLEELHKSLEAEVLAVLQQHV
HRCA_LISMO      HVDNHLVTIPEGTTLSD-------IERMVNILNERLVGLSLDDLKVQIPMEVKELLGKHV
HRCA_LACSK      TVDNQVFTIPNAISGDE-------LEKAIRVVNDHLIGLPLTVVSQKLKTEVPALLMQYM
HRCA_STRMU      SPVTVQFAIPKNFLDSD-------LMTVAKIARERFLNQTVLDIHYRLRTELPQIIQKYF
HRCA_STRPN      RTVTSQFLIPRNFLQED-------LLKLKSIIQERFLGHTVLDIHYKIRTEIPQIIQRYF
HRCA_LACLM      EVRTNQFILPKSMTEAD-------LAVFSNLVKERLVGKKVIDIHYTLRTEIPQIVQRYF
HRCA_HELPY      CALGYSVKMEKFLLE--------------------LVGRSVKEVRSIAASFNALSLARQL
HRCA_HELPJ      CAVGYSVKMEKFLLE--------------------LVGRSVKEVRLIAASVNALSLARQL
HRCA_CLOAB      MIKNSIIRVKSNIENSS-------LERIANILNSKLKGLTIEQINLEVINNIKKDLREYG
HRCA_LEPIN      TVLHRNIFVDQNYSQEA-------LYQVSKYLNDNLKGYDIYEIQNVIIPKLMIRKDGPE
HRCA_STAAM      HVEHVHLASDIPFSNDK-------LNTISNFVTNKLTEFNQNLQDDIVSFVQSEQEEIFI
HRCA_MYCCT      DVQNKMFNL-KDISLSD-------LKIAIKLFSDFLVDVKLDEIDQYLNDLKHQLSLSIK
HRCA_SYNY3      HTHSATLDLPAAMEAKEEGELEQELAIFSNFLNAQLRGKNLSELSHLNWQELDQKFSIYA
HRCA_THEMA      VSKVTPIKTQERLNWEE----------IERQLNFLLRGRTVGEVLMGKIESLKGSG----
HRCA_CAMJE      NFLQSLIGLDLSSIEKI------------------ALRVHFIDLVEKIASLRQNLICYRS
                      .                                                     

HRCA_CHLMU      ----YNEVVVRYLTRYCHFSEED-----LYQTGLSRLLKYEVFKDPETLAQGLSFFENRK
HRCA_CHLTR      ----YNEVVVRYLTRYCHFSEED-----LYQTGLSRLLKYETFKDPETLAQGLAFFENRK
HRCA_CHLPN      ----YNEVVVRYLTRYCNFSEED-----LYQTGMSKLLKYEAFKDPEVLALGLSLFENRR
HRCA_AGRFC      --MLAQDLVERGLAIWAGDNEEGKLGRLIVRGRSNLLEGLAGEEDIDRVRMLFDDLERKE
HRCA_BRADU      --QLTQKVISAGIASWSGGENED--RQLIVRGHANLLEDLHALEDLERVRLLFDDLETKR
HRCA_CAUVN      --ETAARLVEDGLAAWSGGEGDA--RSLIVRGQANLLADARAREDIDRVRQLFDDLEQKG
HRCA_XYLFA      --QLLAHSLDLASQMLVPNDSED-----IVVTGQTRLMALQDLSDMDRLRELFEIFASKR
HRCA_STRAL      --PTVSTVLSTLLETLVEETEER----LMIGGTANLTRFGHDFP--LTIRPVLEALEEQV
HRCA_STRCO      --GTVSTVLSTLLETLVEENEER----LMIGGTANLTRFGHDFP--LVIRPVLEALEEQV
HRCA_MYCTU      LGDAVGRAATVLLESLVEHTEER----LLLGGTANLTRNAADFG--GSLRSILEALEEQV
HRCA_MYCGE      E--YQYVIDEILFKLFDLDQIE----ANKKIYGIQYLAKQPEFANQEKLTKILNLLEDTS
HRCA_MYCPN      E--YQYVIDEILFKLFNFEEFQQ---ARKQVYGIHYLAQQPEFANQERLTRILNLLEDTS
HRCA_UREPA      E--VEYYFSKIVHRVFDFYAYKPN--IDSKTYGVKYLTKHSEFEDQQKLNDLLNLLEDST
HRCA_GEOSE      R--NYDSMLQTIVETLDIPQE-----EKMFFAGKTNMLNQPEFNDIQKIRPLMKMIEQEK
HRCA_BACSU      K--NYDNILDALRSTFHSTNHV----EKLFFGGKINMLNQPEFHDITRVRSLLSLIEKEQ
HRCA_LYSSH      Q--SADDFYPRTRNSDNAIIQK----AKIFYGGKTNMFNQPEFHDLNKVRMILDLMETTS
HRCA_LISMO      R--NYESFMHVFSDSFAQASQ-----QKVYFGGKTNILNQPEFHDINKVREMLHLMEEEQ
HRCA_LACSK      G--SPGGFLNIFDDVLKQASQ-----ERLYVGGQSNLLNFSELTDVSQLKSIYNIINQSD
HRCA_STRMU      P--RTDNVLDLFDHIFNPIFQ-----EEVFISGKIKTLEFAG---LNTYQFLENLQSVAL
HRCA_STRPN      T--TTDNVIDLFEHIFKEMFN-----ENIVMAGKVHLLNFAN---LAAYQFFDQPQKVAL
HRCA_LACLM      K--VTSEVLQLFESIFDDLFK-----EHLTVAGHKNIFDYATDNLAELYKLFSDDERMLH
HRCA_HELPY      E-------------------------RLEYSNTQITRFNLMGLKTLLNSPLFFDILGGK-
HRCA_HELPJ      E-------------------------RLEYSSAQITRFNLMGLKTLLNSPLFFDILEGK-
HRCA_CLOAB      H--IFDCIMPNLYDILREADSTE-----VYKEGTMNIFNYPEFKDIEKAKEFLSVIDDRR
HRCA_LEPIN      D---FIRIADLISSAMTPDNSE----VTLYIDGFKNLYANFR-DEEQQLSQVLSLLDDQG
HRCA_STAAM      N-----KLINTMNNHISNQSNS------IYMGGKVKLIDALNESNVSSIQPILQYIESNR
HRCA_MYCCT      Q---YDYVLNTFINTILESKNEQ-----KETHGMRYMLENPEFNDTNKLKNAVKLVEQLS
HRCA_SYNY3      D--FLKGLQQQIKPLLQRRMAGP-----LVVHGVSKVIQQPEFSQLEQVQMLLSLLEQEQ
HRCA_THEMA      -------FLRLIESLIGETVER-------YLDAGLENLLKDETLTLEDIRNLLEEVKDQK
HRCA_CAMJE      N-----------------------------EERAYQIYQNDEFVKLLDCQIHRHFKESLE
                                                                            

HRCA_CHLMU      ---------------------HMCQLLNSHLHKKAPTTFIGRELSDIVGNADPSCAVITV
HRCA_CHLTR      ---------------------HMCQLLNTYLHKETPTAFIGRELTDIVGNTDPSCAVITI
HRCA_CHLPN      ---------------------QMCELLNIGMHKGRATAFIGKELSDILGTSNPGCSVITI
HRCA_AGRFC      ---------------------NLIEILNLAE---SGSGVRIFIGSENKLFSLSGSSLIVA
HRCA_BRADU      ---------------------GVIDLLGRAE---TAEGVRIFIGSENKLFSLSGSSTIIS
HRCA_CAUVN      ---------------------QLIGLLDDVR---DAEGVRIYIGAETRLFSLSGSSVIAA
HRCA_XYLFA      ---------------------EILQLLERTI---NAPGVRIFIGEETGMVSMEDISLVTA
HRCA_STRAL      ---------------------VLLKLLGEAK---DSA-MTVRIGHENAHEGLSSTSVVSV
HRCA_STRCO      ---------------------VLLKLLGEAK---DPG-VTVRIGHENAHEGLNSTSVVSV
HRCA_MYCTU      ---------------------VVLRLLAAQQ---EAGKVTVRIGHETASEQMVGTSMVST
HRCA_MYCGE      ---------------------VWQQMAFINQT----NQKTNIVFGDQLGFK--EISVAST
HRCA_MYCPN      ---------------------VWQQMAFMNQN----NQTTNITFGDKLGLEGEEVSVAST
HRCA_UREPA      ---------------------IWQQIALNKKT----DGLAKIMLGNEIGHE--HLAIATT
HRCA_GEOSE      ---------------------DFYRLLRKHNR----KGIQVTIGRENQLSEMENCSLITA
HRCA_BACSU      ---------------------DVLKLVQSPH-----TGISIKIGKENDYEEMENCSLITA
HRCA_LYSSH      ---------------------QVQSLFHPNE-----SGIHIRIGSENKQLEMENCSVITT
HRCA_LISMO      ---------------------DVYELFRDIP-----DGLQVKIGRENNNSLMEDCSIITA
HRCA_LACSK      ---------------------DLAKLLELSPGE-ANSQVQVRLGDEMTNDLLKNYSLMTV
HRCA_STRMU      ---------------------EIRQSLPEDE-------LHRVQVADSKEKSLADLTVISQ
HRCA_STRPN      ---------------------EIREGLREDQ-------MQNVRVADGQESCLADLAVISS
HRCA_LACLM      ---------------------EIREITNNDE-------MRAVKFDN-DEKFMKNLTIISQ
HRCA_HELPY      ---------------------------------------VLERLSKGLHFIEPDCMLVTR
HRCA_HELPJ      ---------------------------------------VLERFKKGLHFIEPDCMLVTR
HRCA_CLOAB      ---------------------ILDTLFNASG------GVTVNIGNENSIKEARDFSVVSS
HRCA_LEPIN      ---------------------FLKAFFSEYID----QDGVFTIIGKDGDRSMSGVSIITS
HRCA_STAAM      ---------------------IAELLQDISSP------NINVKIGNEIDDSLSDISIVTS
HRCA_MYCCT      ---------------------PFDWFNIAYESN-KNMNKIAIKIGNEIDQINDDISMIAT
HRCA_SYNY3      DKLFSLLFDPDNYGDNLANLGQEMNLLTGETMPKTRPVVTIRIGAENPLESMHPCTLVSA
HRCA_THEMA      ---------------------FLESLVGEGI--------TVRIGREIGRKKLEKFAVFSG
HRCA_CAMJE      ------------------------------------------------FEPLFKEGFMGL
                                                                            

HRCA_CHLMU      PYYMDRT-PLGAFGVLGPMNLPYQQVFGTLSLFTERLKTILTQSFYKFKLSFRRPCPTDP
HRCA_CHLTR      PYYMDRT-PLGAFGVLGPMNLPYQQVFGTLSLFTERLKVILTQSFYKFKLSFRRPCPTDP
HRCA_CHLPN      PYYMNRS-PLGALGILGPINLPYKEALPLLKLFANKINETLTQSFYKFKLSFRRPLTSNC
HRCA_AGRFC      PYRDEENRVVGAVGVIGPTRLNYARIVPMVDYTAQIMARLSRKQR---------------
HRCA_BRADU      PYRDAAGHIVGVLGVIGPTRLNYARVIPTVDYAARIVSRLLGG-----------------
HRCA_CAUVN      PYMTGRQKVLGAIGVIGPARLNYARVIPLVDYTARVLGRMMDG-----------------
HRCA_XYLFA      PY-AAHGQVLGVLGVIGPKRMAYDRVIPLVQVVAQVLGTALEPPTMP-------------
HRCA_STRAL      GYGSGRE-AVAKLGVVGPTRMDYPGTMGAVRAVARYVGQILAES----------------
HRCA_STRCO      GYGSGGE-AVAKLGVVGPTRMDYPGTMGAVRAVARYVGQILAES----------------
HRCA_MYCTU      AYGTAHT-VYGGMGVVGPTRMDYPGTIASVAAVALYIGDVLGAR----------------
HRCA_MYCGE      LINTTSE-AKHQLAIVGPTRMDYQKIKALLTTLKEEIEKYDKKIHNQT------------
HRCA_MYCPN      LINTTNE-SKHQLAIVGPTRMDYQKVKALLLTLKEEIEEYDKQLHGGKTTSST-------
HRCA_UREPA      QINLAN--TNHQITVVGPTRMDYAKIKALLDFLKIEIEKILGSTNEH-------------
HRCA_GEOSE      TYSIGDE-QLGTIAILGPTRMEYSRVITILNRVASDLSIALTKWYQNG------------
HRCA_BACSU      SYSVDQK-QIGSIAIIGPTRMNYSRVVSLLQHVTSDLSKALTSLYDE-------------
HRCA_LYSSH      TYSIGDD-QQGAIAIIGPTRMDYKRVVALLDVIRLDLTQAFTKNRSE-------------
HRCA_LISMO      TYNIAGE-RVGGIVLLGPTRMEYSRMMGLVDVMSRDLTDVLTKLYRDNQN----------
HRCA_LACSK      NYDVGEH-GQGLIALLGPTSMPHSRMIGLLDLFREELAKKLIDYYADFDDNQS-------
HRCA_STRMU      KFLIPYR-GFGILTVIGPVDLDYQRTISLINVISRVLAVKLGDFYRYLNSNHYEVH----
HRCA_STRPN      KFLIPYR-GVGILAIIGPVNLDYQQLINQVNVVNRVLTMKLTDFYRYLSSNHYEVH----
HRCA_LACLM      KFVIPYR-GFGTLTVVGPVEMDYQRTLSVLDLVAKVLTMKLSDYYRYLDGNHYEISK---
HRCA_HELPY      PVEFQNK--RMQLLCVGKLECDYEGFFQTISEEE--------------------------
HRCA_HELPJ      PIEFQNE--RMQLLCVGKLECDYEGFFQTISKEE--------------------------
HRCA_CLOAB      VYKYNGR-PLGTIGIIGPTRIPYSKVIKVIMEVVDQINNNLDKMNNS-------------
HRCA_LEPIN      NYKMGEK-KIGALGIIGPQRMDYNRALPLVDFTSKLVSEMVTRISK--------------
HRCA_STAAM      QYHFDET-LKGQIAVIGPTAMHYQNVIQLLNRIW--------------------------
HRCA_MYCCT      ELKIGNS--STVLTLVGPKRVDYNQVNQLMNLIIEIINAKEN------------------
HRCA_SYNY3      IYRQQEI-PMGSVSILGPTRMVYQQTIPLVEQAAECLSEALSKN----------------
HRCA_THEMA      KYFKGES-PIGSVYLFTSKVTKYDRNHRVFEYILNRLSEYFTSTSRR-------------
HRCA_CAMJE      KVDAQFLGEDVNIILAGSVYTDYKKILQYIKEAA--------------------------
                            .         :      .                              

HRCA_CHLMU      RCSQKPAELTRRSSIKLLPAKELT
HRCA_CHLTR      RCSQRPAELTRSSSIKLLPAKELS
HRCA_CHLPN      KLSNEPILRTEYSSIKLLPSKETL
HRCA_AGRFC      ------------------------
HRCA_BRADU      ------------------------
HRCA_CAUVN      ------------------------
HRCA_XYLFA      ------------------------
HRCA_STRAL      ------------------------
HRCA_STRCO      ------------------------
HRCA_MYCTU      ------------------------
HRCA_MYCGE      ------------------------
HRCA_MYCPN      ------------------------
HRCA_UREPA      ------------------------
HRCA_GEOSE      ------------------------
HRCA_BACSU      ------------------------
HRCA_LYSSH      ------------------------
HRCA_LISMO      ------------------------
HRCA_LACSK      ------------------------
HRCA_STRMU      ------------------------
HRCA_STRPN      ------------------------
HRCA_LACLM      ------------------------
HRCA_HELPY      ------------------------
HRCA_HELPJ      ------------------------
HRCA_CLOAB      ------------------------
HRCA_LEPIN      ------------------------
HRCA_STAAM      ------------------------
HRCA_MYCCT      ------------------------
HRCA_SYNY3      ------------------------
HRCA_THEMA      ------------------------
HRCA_CAMJE      ------------------------