CLUSTAL format seed alignment for MF_00082

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

ARGB_BACSK            ------------------------------------------------------------
D5DZZ3_BACMQ          ------------------------------------------------------------
ARGB_BACC0            ------------------------------------------------------------
ARGB_LEUCK            ------------------------------------------------------------
A0A175C0J4_LEUGE      ------------------------------------------------------------
ARGB_LACPL            ------------------------------------------------------------
J9W7G6_LACBU          ------------------------------------------------------------
ARGB_LISMO            ------------------------------------------------------------
ARGB_STRGC            ------------------------------------------------------------
ARGB_STRMU            ------------------------------------------------------------
ARGB_STAEQ            ------------------------------------------------------------
ARGB_STAA8            ------------------------------------------------------------
ARGB_STAS1            ------------------------------------------------------------
F2F8U5_SOLSS          --------------------------------------------------------MTTF
ARGB_CHLSY            ------------------------------------------------------------
A9AWL6_HERA2          ------------------------------------------------------------
ARGB_METKA            ------------------------------------------------------------
ARGB_ANADF            ------------------------------------------------------------
ARGB_SORC5            -----------------------------------------------------MSQSSAE
D0MH54_RHOM4          ------------------------------------------------------------
G8TL83_NIAKG          ------------------------------------------------------------
H8KSK8_SOLCM          ------------------------------------------------------------
I3Z7J5_BELBD          ------------------------------------------------------------
A0M371_GRAFK          ------------------------------------------------------------
G2PLE7_MURRD          ------------------------------------------------------------
ARGB_AZOPC            ------------------------------------------------------------
ARGB_DEHMC            -----------------------------------------------------------M
ARGB_PELTS            --------------------------------------------MSTPWEKAAVLVEALP
ARGB_DESRM            --------------------------------------------MISPLEKAGILVEALP
ARGB_MOOTA            -------------------------------------------MTLSPLEKTGILIEALP
ARGB_METBF            -----------------------MWRLAITRVFNDKFKNRFSDSYIMELKRENVLIEALP
ARGB_METMA            ----------------------------------------------MELKRENVLIEALP
ARGB_METB6            -----------------------------------------------MMKREDVLMEALP
ARGB_METPE            ------------------------------------------------MKREDVLMEALP
ARGB_METHJ            ------------------------------------------------MKREDVLMEALP
ARGB_METLZ            -----------------------------------------------MNNRQSVLMEALP
ARGB_ARCFU            ------------------------------------------------MENVELLIEALP
ARGB_PSEPK            ----------------------------------------MTLDRDAASHVAEVLSEALP
ARGB_PSEFS            ----------------------------------------MTLEREAAANTAKVLSEALP
ARGB_AZOVD            ----------------------------------------MTLSRDAAIQVAQVLSEALP
ARGB_AROAE            ------------------------------------MPQLPAPTDVTPARKAEILAEALP
ARGB_DECAR            ----------------------------------------MSIEDLSPGTKAAVLAEALP
ARGB_NITEC            -----------------------------------------MQSSLAVNEKVEILAEALP
ARGB_POLSJ            ------------------------------MTQPTVTADDPDLSHVGPRDKAEILAQALP
ARGB_RHOFT            ---------------------------------------MTDVSNIAPRDKAEILAQALP
ARGB_NEIMB            ---------------------------------------MESENIISAADKARILAEALP
K0N9K4_DESTT          ----------------------------------------------MNNNVADILIEALP
ARGB_CAUSK            ---------------------------------------MTDVAEEAGWATAKTLAEALP
ARGB_CAUVC            ---------------------------------------MTDVAEEAGWATAKTLAEALP
ARGB_OLICO            ---------------------------------------MSDISPQD---QARILSEALP
ARGB_LAWIP            ------------------------------------------MDMEKARLRSHMLIESLP
ARGB_NITSB            --------------------------------------------MKKKIQIVQTLLDALP
ARGB_WOLSU            --------------------------------------------MQKRSKIVSILLDSLP
ARGB_AQUAE            --------------------------------------------MNELIEKAKVLQEALP
ARGB_THEMA            ----------------------------------------------MRIDTVNVLLEALP
ARGB_SYNY3            -----------------------------------MSSTQDYIGEEAAT-RVKILSEALP
ARGB_SYNE7            -------------------------------------MSSEFIEAGAAD-RVRILSEALP
ARGB_CYAM1            ---------------------------------MQQQINPEIIQEISDDLRVQVLTEALP
ARGB_BRAHW            ------------------------------------------MENISNRDKALILNQALP
ARGB_ACTP2            ------------------------------------------MLQNEVENFANLLEQATV
B2TQ27_CLOBB          ---------------------------------------------MNHSEQAEILVNALP
ARGB_LACLA            --------------------------------------------MRDSQNTAQTLTESLK
ARGB_CHLCH            ---------------------------------------MSSERKAPHAAIGQVLIEALP
ARGB_CHLL2            -------------------------------MNPLCSEFTSSSRKAPEAAIGQVLIEALP
ARGB_CHLTE            -----------------------------------------------------MLVEALP
ARGB_OPITP            ------------------------------------------MNVAEITAKAEVLLEALP
ARGB_ARTS2            ----------------------------------MNTQTRETTSMSDAQDKAGTLIEALP
ARGB_RENSM            --------------------------------------MSPLTSATSAPNKAEILIEALP
ARGB_MYCTU            ---------------------------------------MSRIEALPTHIKAQVLAEALP
ARGB_CUTAK            --------------------------------MTLALDIPLNDTQFSAQRKSEVLVEALP
K7S5D7_ACIA4          --------------------------------MSTTLDVPLSASQTTAQRKSEVLVEALP
D5WRY9_KYRT2          ---------------------------------------------MSEEEKAAVLIEALP
K0RZL1_THAOC          MAGQQIQDGDNNDDETYCYFRGIGCDGSVIAGMQPVSSRRQLPSLAASEGFAGSTITIAS
ARGB_THET8            ------------------------------------------------------------
M9X6X8_MEIRD          ------------------------------------------------------------
E4U5I9_OCEP5          ------------------------------------------------------------
ARGB_DEIRA            ------------------------------------------------------------
ARGB_RUBXD            ------------------------------------------------------------
ARGB_ACIC5            ------------------------------------------------------------
ARGB_SOLUE            ------------------------------------------------------------
ARGB_CITK8            ------------------------------------------------------------
ARGB_SALAR            ------------------------------------------------------------
ARGB_ECOLI            ------------------------------------------------------------
ARGB_PECAS            ------------------------------------------------------------
ARGB_PHOLL            ------------------------------------------------------------
ARGB_BUCAI            ------------------------------------------------------------
ARGB_VIBVU            ------------------------------------------------------------
ARGB_VIBPA            ------------------------------------------------------------
ARGB_ALIF1            ------------------------------------------------------------
ARGB_PSYIN            ------------------------------------------------------------
ARGB_MORAB            -----------------------------------------------------------M
ARGB_SHEON            ------------------------------------------------------------
ARGB_SHEPA            -------------------------------------------------------MTQTD
ARGB_ALTMD            ------------------------------------------------------------
Q15X81_PSEA6          ------------------------------------------------------------
ARGB_COLP3            ------------------------------------------------------------
                                                                                  

ARGB_BACSK            ---MAT---VVIKIGGSTLEALE----EGFYEGVVKRASLGDKIMIVHGGGPAINNLLQA
D5DZZ3_BACMQ          ---MSSEKIVVVKCGGSIVNQLT----SAFFESIQQLKASGYQIIVVHGGGPDIQDTLTK
ARGB_BACC0            ---MND--YIVVKCGGSMLEQLN----DVFFDCIKKLQQQ-YKVVIVHGGGPEIDAKLKD
ARGB_LEUCK            -----MTKKIIIKIGGSAAEQLT----PAFFDTIKYWQTQDTQIAIVHGGGDRISQLMSQ
A0A175C0J4_LEUGE      -----MTKKIVIKIGGTAAAQLT----PAFFETIKNWQKQHAKIVIVHGGGNHISSLMAQ
ARGB_LACPL            -----MTKLIVIKIGGQAISQLS----TTFFDQIAQWYQQHYQILIVHGGGPMINRLTTQ
J9W7G6_LACBU          -----MSQIIVVKVGGHATDQLT----EEFFEQLRSWRQMGKQILIVHGGGPQISEWSAQ
ARGB_LISMO            -----MENTIVIKLGGVASDNLT----EGFFRQITEWQAANKKIVLVHGGGHYITKMMEA
ARGB_STRGC            -----MKDVIVIKIGGVAAKKLS----DKFIKQMQEWIAAGKKIVVVHGGGLVINQLMKE
ARGB_STRMU            -----MKDIIVIKIGGVASQQLS----GDFLSQIKNWQDAGKQLVIVHGGGFAINKLMEE
ARGB_STAEQ            -----MKNIIVIKLGGIAIENLN----DAFIQQINAWHLENKKIIIVHGGGQVISNLLTK
ARGB_STAA8            ------MKFIVIKIGGSTLSDMH----PSIINNIKHLRSNNIYPIIVHGGGPFINEALSN
ARGB_STAS1            ------MNYIVIKIGGSTLTELH----ETTIDDIAQLKQQDLHPIIIHGGGPFINQALEQ
F2F8U5_SOLSS          KSTHHTARKMVIKLGGSTLEGLN----EAFFRNFKALQEQGIQLIITHGGGPAINRELAA
ARGB_CHLSY            -----MTTISVIKVSGHELDDPTF--LGGLTAALRGF---QQPLVLVHGGGKEISAAVER
A9AWL6_HERA2          --------MRILKLGGNEIDDPTW--LARLVAVIQTMVNVNDVPILVHGGGKEIGQLQVA
ARGB_METKA            --------MEVIKVGGEVLDRVED--LARVI----------DDSILVHGGGPEVSDVMER
ARGB_ANADF            ------MKTIVLKLGGELVHAPEL--DVIARDLRVLVDGF-NRVAIVHGGGPQASALQKT
ARGB_SORC5            APVTTATGPLVIKLGGEVVGGPAL--AILSSDLAALTRAG-ARAIVVHGGGAQATRLQER
D0MH54_RHOM4          ----MSIRPIVVKIGGALLEAPEA--LDAFWKGVADLRRE-APVVVVHGGGPQATALARR
G8TL83_NIAKG          -----MSTLYVVKIGGNIIDDEKK--LSAFVKDFAAVKG---QKVLIHGGGKLATKLAEQ
H8KSK8_SOLCM          -----MDTLYVIKVGGNIIDNEEK--LASFLNDFAQLKG---LKVLIHGGGKIATEISKG
I3Z7J5_BELBD          ------MNISIIKIGGNVIDYPEK--LDEFLYLFSRFPG---KKILVHGGGVLASKFGES
A0M371_GRAFK          ---MGNKILKVVKIGGKLIENPVF--LNSFLEDFVEMRG---PKILVHGGGNKATAVAGK
G2PLE7_MURRD          ----MKQKLSVVKIGGNLIEDAEG--FKHVLELFSKMNE---NKILVHGGGKKASELANQ
ARGB_AZOPC            -----MERLTIVKVGGEIIRIPEV--RDSFLKDFSIIAG---YKILVHGGGSMLTELARN
ARGB_DEHMC            EMTQSSNHIVVIKLGGSVLDSKD-----TSLKDIATLKQLGLKPVLIHGGASTVSAWSAK
ARGB_PELTS            YIKKFYGKTIVIKYGGHAMLDDS--LKEAVLTDAVLMKYVGMHPVIVHGGGPEITEMLKR
ARGB_DESRM            YIKKFSGKTIVIKYGGHAMLNAD--LKKAVMTDLVLMKFVGINPVVVHGGGPEITGMLHR
ARGB_MOOTA            YIRQFYGKTVVIKYGGHAMVNCE--LKKAVMQDAVLMHLVGMRPVIVHGGGPEITSMLGR
ARGB_METBF            YMQEFYDSIMVIKVGGNAMVSAQ--IMEDIIKDIVLLRYVGIKPVIVHGGGPEITEKMGR
ARGB_METMA            YMQEFYDSIMVIKVGGNAMVSAQ--IMEDIIKDIVLLRYVGIKPVIVHGGGPEITEKMER
ARGB_METB6            YIQQFHGKTIVIKLGGHAMVDPE--VLENAIKDAVLLHYVGIRVVLVHGGGPEITEKMKA
ARGB_METPE            YIQQFHGQIFVIKLGGHAMVDQL--VLEAAIRDVVLLSYIGISVVLVHGGGPEITDKMKA
ARGB_METHJ            YIQKFHGRSMVIKLGGHAMVDTC--IMDTVIRDVVLLQLVGIKCVIVHGGGPEITEKMKA
ARGB_METLZ            YIRKFHKKTIVIKLGGHAMVDSA--IMNSVVQDAVLLHYVGMRVVLVHGGGPEITLKMKA
ARGB_ARCFU            YIKDFHSTTMVIKIGGHAMVNDR--ILEDTIKDIVLLYFVGIKPVVVHGGGPEISEKMEK
ARGB_PSEPK            YIRRFVGKTLVIKYGGNAMESEE--LKTGFARDIVLMKAVGINPVVVHGGGPQIGDLLKR
ARGB_PSEFS            YIRRYVGKTLVIKYGGNAMESDE--LKTGFARDIVLMKAVGINPVVVHGGGPQIGDLLKR
ARGB_AZOVD            YIRRFVGKTLVIKYGGNAMESDE--LKTGFARDIVLMKAVGIHPVVVHGGGPQIGDLLKR
ARGB_AROAE            YIKRFFDKTVVIKYGGNAMTDPH--LKDCFARDVVLLKLVGLNPVVVHGGGPQIETLLAR
ARGB_DECAR            YIKRFHGKTIVVKYGGNAMTDEH--LKSCFARDVVLLELVGFNIVVVHGGGPQIESLLAR
ARGB_NITEC            YIRRFHNKTIVIKYGGNAMTEEI--LKQSFAKDVVLLKLVGMNPVIVHGGGPQIDSMLKR
ARGB_POLSJ            YIRKFHGKTMVIKYGGNAMTDPA--LQADFAEDVVLLKLVGMNPVVVHGGGPQIEAALNR
ARGB_RHOFT            YIRKFHGKTMVIKYGGNAMTDPA--LQADFAEDVVLLKLVGINPVVVHGGGPQIEAALKR
ARGB_NEIMB            YIRRFSGSVAVIKYGGNAMTEPA--LKEGFARDVVLLKLVGIHPVIVHGGGPQINAMLEK
K0N9K4_DESTT          YIKRFSGKTIVVKYGGHAMKDEN--LKKDFANDITLLKYIGVNPVVVHGGGPQINKVLDS
ARGB_CAUSK            YIQIYDRETVVIKYGGHAMGQEQ--VAKLFAADAVLLKLLGVHPVVVHGGGPQISRMLDK
ARGB_CAUVC            YIQIYDRETVVIKYGGHAMGQED--VAKVFAADAVLLKLLGVHPVVVHGGGPQISRMLDK
ARGB_OLICO            HMQQYDEETIVIKYGGHAMGEEH--LAREFARDIVLLEQTAINPVVVHGGGPQIATMLGR
ARGB_LAWIP            YLQKFQGKVIVIKYGGHAMKDTL--LKQSFAQSIALLNLVGIHPIVVHGGGPQIGNMLSR
ARGB_NITSB            FIKKFRDEIFVIKYGGSAQTDQK--LKEKFAQDILLLYTVGIKPVIVHGGGKRITEILNR
ARGB_WOLSU            HIKLFSGSTMVIKYGGAAQINPT--LKEQFAIDIVLLYMLGIKPVIVHGGGKKITDLLGK
ARGB_AQUAE            YIREFHGKVFVIKYGGSAMHDEE--LRESFARDVVLLKYVGINPVIVHGGGPQISKTLEK
ARGB_THEMA            YIKEFYGKTFVIKFGGSAMKQEN--AKKAFIQDIILLKYTGIKPIIVHGGGPAISQMMKD
ARGB_SYNY3            YIQHFAGRTVVVKYGGAAMKDSN--LKDKVIRDIVFMASVGIRPVVVHGGGPEINTWLDK
ARGB_SYNE7            YLQQFAGRTVVVKYGGAAMKQEE--LKEAVMRDIVFLACVGMRPVVVHGGGPEINAWLGR
ARGB_CYAM1            YIQKWRNEIMVIKYGGAVVKQD-----ADIIKDILFLTCCGFQIVVVHGGGPLINEWLKQ
ARGB_BRAHW            YIQKYTGKTVVIKYGGSAMENPE--LKKKVMSDVALLSTVGINVIVVHGGGKDITAMLNK
ARGB_ACTP2            YLAPYQEKIIVVKYGGNAMINED--RKKLVMQDILLLNQLGVKVVLVHGGGPEISQGVKL
B2TQ27_CLOBB          YIQKYYGKTIVVKYGGNSMTSDE--LKETVINDIILMKCVGIDPVIVHGGGPDISDFLDK
ARGB_LACLA            YFLKYRDQTVVIKYGGNAMIDEK--VKESILKDILLLKTVGIKVVLVHGGGPAIGELLEK
ARGB_CHLCH            YIRQFEGKTFVIKYGGAAMKDD--TLKNMFAQNVTLLRKVGIRIVLVHGGGDAITRTAEK
ARGB_CHLL2            YIRKFEGKTFVIKYGGSAMKDE--LLKNSFAQNVTLLRKVGINVVLVHGGGDAITRTAEK
ARGB_CHLTE            YIRKFEGKTFVIKYGGAAMKDE--VLKNIFAENVTLLRKVGIKVVIVHGGGDAITKTSAK
ARGB_OPITP            YVQDFRGSIFVVKYGGSFMDDPDPAGRTRVARDLAFLAAVGINVVVVHGGGKAITRAMES
ARGB_ARTS2            WIQRFAGTTMVIKYGGNAMVNDE--LRRAFAEDVVFLHHVGIHPVVVHGGGPQINAMLSR
ARGB_RENSM            WIQQFAGTVVVVKYGGNAMVSDE--LRQAFTEDMVFLHHVGIKPVVVHGGGPQINSMLGK
ARGB_MYCTU            WLKQLHGKVVVVKYGGNAMTDDT--LRRAFAADMAFLRNCGIHPVVVHGGGPQITAMLRR
ARGB_CUTAK            WIRRFQGRTVVVKYGGNAMVDPG--LQQAFADDIVFMASVGIRPIVVHGGGPQINAMLAE
K7S5D7_ACIA4          WIRRFQGCTVVVKYGGNAMVDPV--LQQAFADDIVFMASVGIRPIVVHGGGPQINAMLAN
D5WRY9_KYRT2          YIQRFAGKIFVIKYGGSAMGERF--TDVIL--DIIWLKQVGIRPVVVHGGGKEITAMLER
K0RZL1_THAOC          SLCSLRGKNIVVKYGGNAMTSPE--LATLFCQDIATLQKLGLRIVVVHGGGPMINSMLEK
ARGB_THET8            -----MSEALLVKVGG----SLRG--AEALLEELAAYPG---PLVLVHGGGPEIGEWLKR
M9X6X8_MEIRD          -----MEQALLVKIGG----SLKE--AGELLDELSAYPG---PLVLVHGGGPRIAEWLNR
E4U5I9_OCEP5          --------MLVVKIGG----SLDG--AEPLVRDLAHHEG---ELIVVHGGGPRIGAELEA
ARGB_DEIRA            ---------MIVKYGGNAMKSLDL--RRAVARELGTLRGA-MPLVVVHGGGPVIERELAA
ARGB_RUBXD            ------MRTVVVKVGG----ASVA--GGALEDLPGVVSGG-ARVAVVHGGGRQLTRMLDS
ARGB_ACIC5            -------MKYVVKLGGAALENPEI--FMACARAVADLVKDGHQVALVHGGGVQLTRTLKQ
ARGB_SOLUE            -------MKLLVKLGGTLLDSAAS--RDSLCLQIAAARAAGHEVTVVHGGGKQMTRYLTD
ARGB_CITK8            -----MMNPLIIKLGGVLLDSEE-ALERLFTALVNYRESHQRPLIIVHGGGCVVDELMKQ
ARGB_SALAR            -----MMNPLIIKLGGVLLDNEE-ALERLFTALVNYRESHQRPLVIVHGGGCVVDELMKG
ARGB_ECOLI            -----MMNPLIIKLGGVLLDSEE-ALERLFSALVNYRESHQRPLVIVHGGGCVVDELMKG
ARGB_PECAS            ------MNPLIIKLGGVLLDSEE-ALERLFTALVAYRQEHQRPLVIVHGGGCLVDELMKK
ARGB_PHOLL            ------MEPLVIKLGGVLLDNEE-ALERVFTALQEYRQTHERQLVVVHGGGYLVDELMEK
ARGB_BUCAI            ------MNPLVIKLGGVLLESDD-AMKRLFEALVDYQKFYKRHVSVIHGGGRLIDNLMNK
ARGB_VIBVU            -MTQPSLNPLVIKLGGAALSCSQ-TLSQLFGAIASYQQKEQRQIVIVHGGGYLVDELMEK
ARGB_VIBPA            -MTQTNQAPLVIKLGGAALSCTQ-TLSQLFGAIAAYQKSAQRQIAIVHGGGYLVDELMAK
ARGB_ALIF1            ----MNQRPLVIKLGGAVLSSID-TLTLLFKTISNYQQQAKRSLIIVHGGGYLVDELMAK
ARGB_PSYIN            --MTQALKPLLIKLGGAVLENEQ-ALENLFSALTVYLQTEQRPLLIVHGGGVIVEDVLKK
ARGB_MORAB            TMKATMTTPLVLKLGGALLQNET-ALEQLFTALSEYKST-CTSLILVHGGGCFVDDLLAK
ARGB_SHEON            --MSTNNSVLVLKVGGALLQCEM-GMARLMDTAAAMIAN-GQQVLMVHGGGCLVDEQLAA
ARGB_SHEPA            LNNTEQKPVMVLKVGGALLQCDM-GMSRLMQAAAKIIAS-GQPIIMVHGGGCLVDEQLKA
ARGB_ALTMD            ----MSVSPIVIKVGGALLDDAA-AMTRLFLSVKDVQAT--RPVVVVHGGGPLVETLMAS
Q15X81_PSEA6          ------MNPLVIKVGGAFMQATA-EALQLLTVIKQLQQS--RPVVLVHGGGPMVEQLLQA
ARGB_COLP3            -MNNPVLKPLVIKIGGAILEKES-ALNALLNVISQLKNK---QVVLVHGGGCVVDEMLAQ
                                ::* .*                             : ***.         

ARGB_BACSK            MAVESQFVNGLRKTTAEVLTAAETALSGQINKQLVRSLYQAGGKA----IGLSGSDGHLL
D5DZZ3_BACMQ          LHIETEFVDGLRKTSKEALEVVTMVLAGKVNKQLVKELQKANLKA----VGLSGIDGLLL
ARGB_BACC0            CNINVEKRDGLRVTPKEVMDVVQMVLCGSTNKKFVMNLQKHNLLA----VGCSGCDGKLL
ARGB_LEUCK            LHEPIEKINGIRLTTQTGINITKMALLGQVQPALIEACRQQGIAT----IGLNAGSNQLL
A0A175C0J4_LEUGE      LNEPIQKINGIRFTTQNGINITKMALLGQVQPALIEAFRQNAVSA----IGLNAGSNQLL
ARGB_LACPL            LALPVHKVNGLRVTDAATLVLTKLALLGDAQPALLAKLTQHHLPV----LGLNAADNQLL
J9W7G6_LACBU          LNLPVAKINGVRVTSPQTLKVTQAVLLGLVQPTLCRQLSAHGLPV----VGLNAGGQPVL
ARGB_LISMO            LAIPVETKNGLRVTNKATLEVTKMVLIGQVQPAITTAFQKRNISV----IGLNASDTGLL
ARGB_STRGC            RQLPTRKVKGLRVTAKSDLPIIQQALLGQVGRTLTQELNYSDIES----LQLVSHLGKTV
ARGB_STRMU            NQVPVKKINGLRVTSKDDMVLVSHALLDLVGKNLQEKLRQAGVSC----QQLKSDIKHVV
ARGB_STAEQ            NNHSTIKIDGMRVTAKNDLPIIYDALINIVGHQLLERLKESNLEF----FQFKEKIKELV
ARGB_STAA8            QQIEPHFVNGLRVTDKATMTITKHTLIADVNTALVAQFNQHQCSA----IGLCGLDAQLF
ARGB_STAS1            QGVDSLFEDGLRVTTDEVMSITSQILIGKVNPQLVSKMNDENIQS----IGLNGIDAKLF
F2F8U5_SOLSS          VGIESHTVNGLRVTSKEMIGIVQSTLIGKVNPSLVHELHSANISA----IGLNGFDDGLL
ARGB_CHLSY            AGLQIEFVDGLRVTSPAVMDIMQMVVCGTINKRIVTALVNAGVKA----IGLSGLDLGLL
A9AWL6_HERA2          LGGEPQFVAGLRVTDQTALKAATMVLCGMVSTRLVAALNAVGVEA----LGLSGVDRNLV
ARGB_METKA            MGLEPRFVRGLRVTDRETLQVVMMVLAGLVNKRLVAELRSEGINA----LGLSGVDGGLL
ARGB_ANADF            LGLETRMVAGRRYTDAQTLEVMKYVVAGQLNVDLCGRLLANGVMG----VGLHGASGHVV
ARGB_SORC5            LGIPVRQVAGQRVTDADTLDVMKMVVAGKLNVDLCAALVAAGARP----VGLHGASGPAL
D0MH54_RHOM4          LGHQPRIVQGRRVTTELDLQILQWALRGELNLRLVAAALQHGLPA----VGLAAADGGTL
G8TL83_NIAKG          MNVPQQMIDGRRITDAETLKIVTMVYAGYINKNVVAQLQANNCNA----IGLTGADGNVI
H8KSK8_SOLCM          LGIEAKMVDGRRITDTETLKIVTMVYAGLINKNLVAKLQAKGCNA----IGLTGADANII
I3Z7J5_BELBD          MGVMPEMIDGRRITDKDTLDIVTMVYAGLINKQIVANLQKLKQNA----LGMTGADGNLI
A0M371_GRAFK          LGFETKMIDGRRITDKDSMEVITMVYGGLINKSIVAKLQSKKQNA----IGLCGADGNVL
G2PLE7_MURRD          LGVESKMVNGRRITNAETLDIALMVYGGLVSKKIVAKLQALGTDA----IGMSGADANAI
ARGB_AZOPC            LDIETQMIDGRRVTTEKILKLAVMVYAGLINKEIVVGLQALGVDA----LGFTGADSNII
ARGB_DEHMC            LGLETRLVNGERVTDDATLDVVAAILAGLVNKEIVAALLDMGIKA----AGISGVDSATI
ARGB_PELTS            VGKDSRFVGGLRVTDGETMEIVEMVLVGKINKGIVSRINRIGGLA----VGLSGKDAGLF
ARGB_DESRM            LGIESQFVSGLRVTDAPTMEVVEMVL-GKLNKEIVALINGLGGRS----VGLSGKDANLI
ARGB_MOOTA            LGKQSQFIQGQRVTDAETMEIVEMVLVGKINKEIVANIHRYGGKA----IGLCGKDGHLI
ARGB_METBF            MGKKAEFFQGLRITDDETMEIAKMVLVGNINTKIVSLIGVCGGKG----IGLTGYDGRMI
ARGB_METMA            MGKKAEFFQGLRITDDETMEIARMVLVGNINTKIVSLIGLFGGKG----VGFTGYDGRMI
ARGB_METB6            LGKESVFVGGLRVTDQETLEIAQMVLVGKINKGIISLIAKCGAKG----VGLSGSDGNII
ARGB_METPE            MGKEPKFVGGLRITDQETLEIAQMVLVGKINDGIVSLIAKCGARG----VGISGNDGSLL
ARGB_METHJ            MGKQPRFVSGLRITDDDTLEVAQMVLVGKINSKIVSLVSRAGGRA----VGISGNDANLI
ARGB_METLZ            LGKEARFVGGLRVTDEETLEIAQMVLAGKIGNMIVSMIAKNGAKG----VGISGNDGGLV
ARGB_ARCFU            FGLKPKFVEGLRVTDKETMEVVEMVLDGKVNSKIVTTFIRNGGKA----VGLSGKDGLLI
ARGB_PSEPK            LSIESHFIDGMRVTDSATMDVVEMVLGGQVNKDIVNLINRHGGSA----IGLTGKDAELI
ARGB_PSEFS            LSIESHFIDGMRVTDAQTMDVVEMVLGGQVNKDIVNLINRHGGSA----IGLTGKDAELI
ARGB_AZOVD            LSIESRFVDGMRVTDAQTMDVVEMVLGGQVNKDIVNLINRHGGSA----IGLTGKDAGLI
ARGB_AROAE            VGKKGEFIQGMRVTDAETMEVVEMVLGGQVNKEIVSLINQHGGKA----VGLTGKDASFI
ARGB_DECAR            VGKKGEFIQGMRVTDAETMEVVEMVLGGQVNKDIVNLINQHGGKA----VGLTGKDGNFI
ARGB_NITEC            VGKEGVFIQGMRVTDAETMDIVEMILGGLINKEIVNLINRHGGQA----VGLTGKDGMFI
ARGB_POLSJ            LGKKGHFIQGMRVTDEETMEVVEWVLAGQVQQDIVGLINQAGGKA----VGLTGRDGGLI
ARGB_RHOFT            LGKKGEFIQGMRVTDAETMEIVEWVLGGEVQQDIVGLINQAGGKA----VGLTGRDGGMI
ARGB_NEIMB            VGKKGEFVQGMRVTDKEAMDIVEMVLGGHVNKEIVSMINTYGGHA----VGVSGRDDHFI
K0N9K4_DESTT          MGITSRFIRGMRYTDDETMDVVEMVLGGKVNKDIVARINRQGGKA----VGLTGKDGMLI
ARGB_CAUSK            AGVKSTFVDGLRVTDEATMEVAEMVLSGAINKEIANWITLAGAEADVRGVGLSGKDARMI
ARGB_CAUVC            AGVKSTFVDGLRVTDEATMEVAEMVLSGAINKEIANWITLAGAEADVRGVGLSGKDARLI
ARGB_OLICO            LGIKSEFAAGLRITDASAIEIVEMVLAGSINKQIVSHINAAGGKA----VGLSGKDGNMV
ARGB_LAWIP            LNIQSEFREGLRVTDKATMDVVEMVLAGSVNKEIVNQVNQAGAKA----VGLSGKDGAFI
ARGB_NITSB            LKIDTTFIDGQRVTTADVMEIVEMVLSGDINKEIVSLLNNHGAK----AIGVSGKDAHFI
ARGB_WOLSU            LGIESKFVEGHRITCIDSMKIVEMVLSGDINKEITSFLNHHGVK----AVGISGKDSSLL
ARGB_AQUAE            FGIKPKFVGGMRKTDEETMHVVEMVLSGDINKDIVALINRYSGEK-IYAVGLSGRDGRLL
ARGB_THEMA            LGIEPVFKNGHRVTDEKTMEIVEMVLVGKINKEIVMNLNLHGGR----AVGICGKDSKLI
ARGB_SYNY3            VGIEPQFKDGLRVTDAATMDIVEMVLVGRVNKELVNLINQAGGKA----VGLCGKDGQLM
ARGB_SYNE7            VGIEPQFHNGLRVTDADTMEVVEMVLVGRVNKDIVSRINTTGGRA----VGFCGTDGRLV
ARGB_CYAM1            LNKSPQYWEGIRVTDKVTMEIVEMVLAGKVNKQLVGSINANGGKA----IGLCGKDANLI
ARGB_BRAHW            IGKESKFINGLRYTDSETAEVVKMVLAGKVNKDLVASLENCGGKC----LGICGIDGKMF
ARGB_ACTP2            LGKEPQFINGLRVTDQDTINVVLQMLAGKVNKSLVALLK---GKG----VGLCGIDANML
B2TQ27_CLOBB          LDKQSKFINGLRYTDEDTMEIVQMVLGGKVNKNLVSLIETFGGKA----LGLCGMDGSLI
ARGB_LACLA            YEQKSQFVQGLRVTDKKTAQLALTALAGKVNKSLVQDIIRLGGNA----IGVSGIDGKLI
ARGB_CHLCH            LGLQSRFVQGRRVTDKEMISVIQMTLAGKVNQDIVQLISEHGGKA----VGVSG-----L
ARGB_CHLL2            LGLVSQFVHGKRVTDNDMITVVQMTLAGKVNQDIVRLLSEHGGKA----VGVTG-----L
ARGB_CHLTE            LGLETTFVHGKRVTDRQTVDVIQMTLAGKVNQDIVQLINKDGGNA----VGVSG-----L
ARGB_OPITP            SGLKANFVNGMRQTDEATIAVVKKTLDEVVNRDVCDAIGGAGGKP----KGMPGD--SVL
ARGB_ARTS2            LGIESEFKGGLRVTTPEAMDVVRMVLTGQVGRELVGLINSHGPYA----VGMSGEDGGLL
ARGB_RENSM            LGIESEFKGGLRVTTPEAMEVVRMVLAGQVGRELVGLINAHGPYA----VGLSGEDGALL
ARGB_MYCTU            LGIEGDFKGGFRVTTPEVLDVARMVLFGQVGRELVNLINAHGPYA----VGITGEDAQLF
ARGB_CUTAK            SATPVEFRNGLRVTSPEVMEVVRMVLVGQVGRQLVNRINAYAPLA----AGMSGEDSGLL
K7S5D7_ACIA4          SGTAVEFRNGLRITSPEVMEVVRMVLVGQVGRQLVGRINTFAPLA----AGMSGEDSGLL
D5WRY9_KYRT2          LGHRAQFVEGLRVTDEAVMEVVEMVLSGAVNPRLVAAFNQHDGGA----VGLSGADGMLL
K0RZL1_THAOC          LGVESSWEGGMRVSTEEVVDVAAMVLCGTVNKNISGGISLAGGRA----LGLSGRDDGLL
ARGB_THET8            LGYESRFVGGLRVTPPEQLEVVEMALY-LTGKRLAWGLSRRGRKA----LALSGRDALCL
M9X6X8_MEIRD          MGFETHFHRGLRITPPEQMEVVEMVLT-TLGKYLAEGLSRRGRPS----IALTGRDAGLL
E4U5I9_OCEP5          RGFETRFESGLRVTPPEQMAVVEQVLT-QLGKELADRLSQLGRLS----VGLSGRDARLL
ARGB_DEIRA            RGVASEFIGGLRVTTPEAMDVVEMALC-QLNKQLSQDIGQ----A----VGLMGRDDELL
ARGB_RUBXD            LGVPTSFREGLRVTDERTLEVAEMVFAGSVNKQLARGLLALGVPA----AGVSGTDGPVL
ARGB_ACIC5            LGKQSEFIAGLRVTDAETRDAALMVLSGRVNKSLVAALGSLGQAA----MGLSGGDGLIF
ARGB_SOLUE            RGIESRFVGGLRVTSPDTIDAVLKVFAGSVNHELVANLNRAGALA----VGLSGIDSFLV
ARGB_CITK8            LNLPVKKKNGLRVTPADQIDIITGALAGTANKTLLAWAKKHHIAS----VGLYLGDGDSV
ARGB_SALAR            LNLPVKKKNGLRVTPADQIGIIAGALAGTANKTLLAWAKKHHIAS----VGLFLGDGDSV
ARGB_ECOLI            LNLPVKKKNGLRVTPADQIDIITGALAGTANKTLLAWAKKHQIAA----VGLFLGDGDSV
ARGB_PECAS            LSLPVVKKNGLRVTPADQIDIITGALAGSANKTLLSWAKKHDINA----VGLCLGDGDST
ARGB_PHOLL            LQLPIVKEQGLRVTPADQIGIITGALAGIANKTLLSWATKYQLAS----VGLYLGDGNVV
ARGB_BUCAI            LSLPVKKKNGLRITPSEHINIITGALAGTANKTLLAWALKYNINA----IGLCLADGGSV
ARGB_VIBVU            LQLPTVKKNGLRVTPYDQIPLIAGALAGTANKLLQGQAMADGLNA----IGLSLADGGLC
ARGB_VIBPA            LQLKTVKKHGLRVTPYDQIPVIAGALAGTANKLLQGQAIADGLNA----VGLSLADGGLC
ARGB_ALIF1            LQLETIKKEGLRVTPKDQIGYITGALAGTANKMLQGQAMKNNVKA----IGLSLADGGLC
ARGB_PSYIN            MNIVSYKKEGLRITPFEQIPYVAGALAGTSNKLLMAKALKAGLSA----VGLSLADGFSC
ARGB_MORAB            MNIESEKKNGLRITPASDIGYITGAYVGTANKVLMAQGIKLGFNV----VGLTLADGGIS
ARGB_SHEON            NGMETVKLEGLRVTPPEQMPIIAGALAGTSNKILQGAATKAGIVS----VGMCLADGNTV
ARGB_SHEPA            NGMITEKLDGLRVTPEAQIPVIVGALAGTSNKTLQAAAIKAGVTC----LGMSLADAGMM
ARGB_ALTMD            LGLKSTKIDGLRVTPDEHMPYICGALAGSANKQLCAAALASGLTP----VGLSLLDGNMV
Q15X81_PSEA6          LQFTSTKVNGLRVTPPEHMPYITGALAGTANKQLCAFAIRANTTP----VGLCLADGAMT
ARGB_COLP3            AGFTTEKKHGLRVTPKEQVGLISGALAGTVNKAIVGTANSMDLAA----VGLSLNDGDMI
                               * * :                   .                          

ARGB_BACSK            KTIPIDT-------------DKLGFVGAVE--SVNVDVLFNVA--KAGYIPVIAPIGMDA
D5DZZ3_BACMQ          KAEAIDV-------------ERLGYVGEVK--GVNDTLLKQLT--DSQYIPVISSIGADE
ARGB_BACC0            QVQPV-S-------------EEIGYVGEVS--YVETALLKGLI--NMNYIPVIAPIGIHD
ARGB_LEUCK            TGHLLDS-------------DTYGYVGAIH--QVNTQLIHQLW--QQKLIPIIAPLAITN
A0A175C0J4_LEUGE      TGHVLDQ-------------DVYGYVGAIH--QVNTQLIHNMW--QQHLVPIIAPLAISN
ARGB_LACPL            TGELIDY-------------RQLGYVGRLT--AVNQVQLMQLL--AHH-IGILAPLALTE
J9W7G6_LACBU          VGDYLDQ-------------AVYGEVGQVI--GINREYINHAL--ADG-IGVCAPLAMTK
ARGB_LISMO            EADRLSD-------------TDLGLVGKIT--KVKTNLIEQLL--SENIITVIAPLGINS
ARGB_STRGC            SADFIDK-------------DVYGYVGQVK--AIQTAYLEQLL--AADIVPVLASLGENA
ARGB_STRMU            AADYLDK-------------DTYGYVGDVT--HINKRVIEEFL--ENRQIPILASLGYSK
ARGB_STAEQ            SAEFLNK-------------NIYGYVGKVK--EINTMLLEKML--SRDIIPIITSLGVNE
ARGB_STAA8            EITSFD--------------QQYGYVGVPT--ALNKDALQYLC--TKFVPIINSIGFNNH
ARGB_STAS1            DVEPLN--------------EKYGYVGEPI--NINTAVIDHLT--EEYIPVIASIGRHKT
F2F8U5_SOLSS          ESEFLNY-------------ETYAYVGEVK--HVNINMLNTLT--EAGIVPVVACIGATK
ARGB_CHLSY            RCEPYRP-------AGR----DLGRVGEVT--AVDGAALLHLL--ALGWMPVIAPVALGA
A9AWL6_HERA2          YATRLEH-------AAG----DLGAVGKPA--RIRATVLYEAL--AADVVPVLAPLCADG
ARGB_METKA            IAEKRSE-------VVDGEEVDLGYVGDVK--RVNAELLESLL--DAGYVPVVAPLGAG-
ARGB_ANADF            QARRRPPRVM---KGAGPEPVDLGLVGDVL--GFNLPLLGDLF--ERRYVPVIACLGCD-
ARGB_SORC5            SAVKRPPQVY---AGAGPEPVDLGLVGDIT--GVDRGLLELLG--SGGYLPVLACLGAG-
D0MH54_RHOM4          RVRRRPPWTI---EG---ETVDFGFVGDVA--RVEPALLRHLL--EGGYVPVVAPLGID-
G8TL83_NIAKG          LAHKRN----------HPT-IDYGFAGDVD--AINTTLLKSIL--DQQIAVVMAPITHD-
H8KSK8_SOLCM          PANKRP----------VKE-IDYGFVGDVDNAKMNGTTLSLLL--KTGLVPILAPLTHD-
I3Z7J5_BELBD          QSKKRP----------VKT-IDYGFVGDIK--EINTDLLSTLL--CEDIIPVVCAITHD-
A0M371_GRAFK          ISKRRE----------VKE-IDYGFVGDIE--KVNSGFIESIL--NQNMIPVFSAISCT-
G2PLE7_MURRD          QAHKRP----------KKN-VDFGFVGDVD--TVNTYGIFKLL--QAGFTPVFCALTHD-
ARGB_AZOPC            CSEKRP----------IRDSIDYGLVGDIQ--EINVQLLNEFL--NKGHTPIFAPITHN-
ARGB_DEHMC            TGQIRAT--------------ETGYLGDVV--QVNTELITALL--DANITPVISPVSFHQ
ARGB_PELTS            QAVKKYRKVR--TPEGREETADIGFVGEIS--RVNPQIVSTVI--AEGYIPVIAPVAVGP
ARGB_DESRM            MANKKYSN----------DCQDIGFVGEVT--GVNPQLLQTVI--QEGYIPVVSPVGIST
ARGB_MOOTA            EARKQVAHIQ--K-DGEEMDLDLGYVGQVE--RVNPGIIETVI--AEGYIPVVAPIGVGP
ARGB_METBF            LGHKQAAKKV--LINGIETEVDIGWVGECE--VINPDILHIVL--ENGYIPVISPIAVDA
ARGB_METMA            LGHKQAAKHV--LIDGVETEVDIGWVGESE--VINPEILHIML--EKGYIPVISPIAVDA
ARGB_METB6            LAKKMDLQKV--NVQGVEQEVDLGHVGEIE--WIDPSLLTTLL--DRDYIPVISPIAIDR
ARGB_METPE            IAKRKELQVV--TIEDRTERVDLGHVGEIV--EVDPAILQMLL--SNEYIPVVAPIAIDR
ARGB_METHJ            IARKMDRQKV--RVENREEEVDLGHVGEIE--EIRPALLHTLL--DNQFIPVISPLAIDR
ARGB_METLZ            IAEKTPIRKM--MVGDEEVEVDLGFVGDVK--EINSNLLETLL--DAGYIPVISPLALDR
ARGB_ARCFU            VARKKE-MRM--KKGEEEVIIDLGFVGETE--FVNPEIIRILL--DNGFIPVVSPVATDL
ARGB_PSEPK            RARKLTVSRQ-TPEMTTPEIIDIGHVGEVV--SVNTDLLNMLV--KGDFIPVIAPIGVGA
ARGB_PSEFS            RAKKLTVTRQ-TPEMTQPEIIDIGQVGEVI--GINTDLLNLLV--KGDFIPVIAPIGVGA
ARGB_AZOVD            RAKKLKVTRQ-TPEMTQPEIIDIGQVGEVE--SVNTELLNMLV--QGDFIPVIAPIGVGA
ARGB_AROAE            RAKKLLMQ---KEDAAPGDVVDVGQVGEIT--KIDPSLIAFLD--QGDFIPVIAPIGVGE
ARGB_DECAR            RAKKLMLE---DKDN-PGDLIDVGQVGEIV--SIDPTLIDHLD--KGAFIPVIAPIGVGK
ARGB_NITEC            RAKRMLIK---DKED-AEKWINIGQVGEIE--YIDPSLIKLLD--ARDFIPVIAPIGVGE
ARGB_POLSJ            RAQKLKMV---DKDD-PAKEHDIGFVGDIV--SIDPSVVKALQ--DDAFIPVISPIGFGE
ARGB_RHOFT            RAQKLKMR---DNTD-ASKEYDVGQVGDIV--SIDPSVVKALQ--DDAFIPVISPIGFGE
ARGB_NEIMB            KAKKLLID---TPEQ---NGVDIGQVGTVE--SIDTGLVKGLI--ERGCIPVVAPVGVGE
K0N9K4_DESTT          TAKKMTIYHQ-EDENKPPEIIDPGMVGDVS--GINPDIIHTLT--DKGFIPVIAPVGVGK
ARGB_CAUSK            TAEKVTRTRK-DPGSNIEQVVDLGFVGEPT--KIDPHIIQALLTSETDYIPVIAPIGVST
ARGB_CAUVC            TAEKVTRTKK-DPDSNIEQAVDLGFVGEPT--KVDPQLIEALLTSEHDYIPVVAPIGVSP
ARGB_OLICO            TAVKATRTMI-DPDSNIEKVIDLGFVGEPD--KVDLALLNQLI--GHELIPVLAPLAVST
ARGB_LAWIP            LAEKNDLILT-K-ENQPPEIINLGNVGRVV--HIETSLLYTLI--EKGFIPIIAPVGTDN
ARGB_NITSB            TARPKDFEK-------------FGYTGVID--HIDPSVIHNLL--QEQFVPVIAPIAASN
ARGB_WOLSU            RAEPKDGGR-------------FGYTGEVK--EVKAEIIYNLL--EKGFVPVIAPVAEGE
ARGB_AQUAE            KAKKLDKERYFSELGLPVPEEDIGFVGEIV--DVNEELIFTLL--SHNFIPVIAPVGVGE
ARGB_THEMA            VAEKETKHG------------DIGYVGKVK--KVNPEILHALI--ENDYIPVIAPVGIGE
ARGB_SYNY3            TARTMTNK-------------DVGFVGEVS--SVDARVVETLV--KSGYIPVISSVAADE
ARGB_SYNE7            LARPHDQE-------------GIGFVGEVN--SVNSEVIEPLL--ERGYIPVISSVAADE
ARGB_CYAM1            VAKASSKK-------------ELGLVGEIE--QIHPQVIDMLL--EKHYIPVIASVAASH
ARGB_BRAHW            KVSKYKGD------------DDLGFVGDVD--HVDTDLLNTII--TNKYIPIVATIGCD-
ARGB_ACTP2            QCEKLQAE------------VDYGFVGEIV--KVNTQLLELAL--SANLIPVISTVGVD-
B2TQ27_CLOBB          RAKKLEKD------------MDLGYVGEIT--KVDTNILKTAL--NAGYIPVVGSVALGE
ARGB_LACLA            EAKPISED--------------LDYVGEIT--AIHPEIIERIN--QTDAVPVIASAGIGL
ARGB_CHLCH            DADTIKAHPH-------PNAEQLGLVGEVE--QINTDYIDLLS--QAGLIPVIAPVGFDC
ARGB_CHLL2            DADTIKAVPG-------PNAEKLGLVGDVE--SINTDYIDLLC--RAGLIPVIAPVGYDH
ARGB_CHLTE            DADTILAKPS-------PNASTLGLVGEVA--EINTRYIDLLC--DAGLIPVIAPIGYDM
ARGB_OPITP            VCQKLTTDDN-------GNPVDLGYVGDVT--EVKVKLIKKEI--ADGFIPVISPVAEGY
ARGB_ARTS2            RAVRTGTVVDG-------EEVDLGLVGEVV--GVNPEGIVDIL--AAGRIPVISTVAPEI
ARGB_RENSM            QAVRTGTVVDG-------VEVDLGQVGEVI--GVNPGSILDLL--DAGRIPVISTIAPEV
ARGB_MYCTU            TAVRRSVTVDG-------VATDIGLVGDVD--QVNTAAMLDLV--AAGRIPVVSTLAPDA
ARGB_CUTAK            SARKSRVIVDG-------EQIDMGLVGDIV--DVNIDLVISML--DRGQIPVIAPVSPEV
K7S5D7_ACIA4          SARRTHVEVDG-------EPVDMGLVGEIV--DVNVGLINDML--DRGQIPVIAPVSPEI
D5WRY9_KYRT2          EVAKKHHPAG-----------DIGYVGEVV--HVNTALIEGLL--DRHLIPVIAPVGVDR
K0RZL1_THAOC          QCTKLYGGDD--------GEIDLGNVGQVA--AVNTDLINQLL--DAGITPVIAPIGKGC
ARGB_THET8            RG--RAL-------------PELGRVGEVVG--VEVGLLLDLL--EKGYTPLLAPIALDE
M9X6X8_MEIRD          EA--QPLD------------PLLGRVGEVTA--VHTQVIHKLL--QAGLTPLIAPIGLDA
E4U5I9_OCEP5          RA--EPLD------------ERLGRVGRITA--VNTSLLFALM--SRHLTPVISPIASAE
ARGB_DEIRA            RA--EVLD------------PQLGRVGRVTG--VNAGLLRTLL--GAGLTPVVGCVAVGE
ARGB_RUBXD            RV--EPV-------------PGLGRVGRVVA--VETRLLETLW--GGGFVPVVAPLGLGP
ARGB_ACIC5            RARKKRTV------------PDLGFVGEIVA--SDPRWLEAIW--KMNAVPVISSIALGF
ARGB_SOLUE            EA--EQMD------------PELGAVGRVTG--SNPALLHLLT--ANGYVPVVACVAGDR
ARGB_CITK8            KVTQLDEE--------------LGHVGLAQ--PGSPKLINTLL--EGGFLPVVSSIGVTE
ARGB_SALAR            KVIQLDEA--------------LGHVGLAQ--PGSPKLINTLL--ENDFLPVVSSIGVTE
ARGB_ECOLI            KVTQLDEE--------------LGHVGLAQ--PGSPKLINSLL--ENGYLPVVSSIGVTD
ARGB_PECAS            TVTQLDES--------------LGFVGKAE--AGSPALLNTLL--SAGYLPVVSSIGITA
ARGB_PHOLL            TVSQLSEE--------------LGHVGKAM--PGDAKLLKTLL--DAGYMPIISSIGVTD
ARGB_BUCAI            DVERLDEN--------------LGHVGKAI--PGSPLFLKKLF--KEGTIPIISSIGITK
ARGB_VIBVU            QVEELDPE--------------LGAVGKAT--PGDSSLLQTIL--NAGALPIISSIGLTA
ARGB_VIBPA            HVEELDPE--------------LGAVGKAT--PGDSSLLQAIL--NTGALPIISSIGLTA
ARGB_ALIF1            QITQLNPE--------------LGNVGLAT--AGDAKVLEAIL--ATQVTPIISSIGITN
ARGB_PSYIN            KVTQLDPD--------------LGAVGICS--PNNPALLNTLL--KEGYLPVISSIAIGD
ARGB_MORAB            TVTLSTAG--------------LGAVGECE--AGDPTLLTALL--SGGFLPIISSIGIDA
ARGB_SHEON            SAKIKDER--------------LGLVGEVY--PKDATYLKFIL--SQGWMPICSSIAMMD
ARGB_SHEPA            NAKIKDPL--------------LGLVGEVE--PKDASYLEFVL--AKGWMPIVSSIAISE
ARGB_ALTMD            VCEPLADQ--------------YGAVGVPS--TADAAFLKSVL--AQSTLPIISSIGSSP
Q15X81_PSEA6          SCSVLDPA--------------LGAVGVAK--ANSPTMLNLLL--EANILPIISSIGADE
ARGB_COLP3            SCTLSTQD--------------LGQVGVPQ--TNNSKLLDCLL--KAKFLPVISSIGALD
                                                *           :            :        

ARGB_BACSK            NY------QPYNINADTAAAAVAKASKAEE---LVFVTDVDGVQKDGK----VIKEMDEV
D5DZZ3_BACMQ          EG------NSYNINADVAAGAVAQAVNAEK---LMFVTDVKGVLKDGA----LLPELTKS
ARGB_BACC0            N-------EIYNINADTAAAGIAAALSAKE---LILITDVDGILHEGK----LVKKTDES
ARGB_LEUCK            DG------QWLNVNADHAATAIAKYLKADE---LYLLTDVSGVAVSGN----ILQELTPG
A0A175C0J4_LEUGE      DG------QWLNVNADHAATAIAKYLQADE---LYLLTDVSGVKVSGN----ILQELTPE
ARGB_LACPL            TG------QWLNVNADMAATVLAQQLHAEK---LVLLTDVPGIIHHGN----VMTSLSPQ
J9W7G6_LACBU          SG------KNLNVNGDVAAAAVARLLGAEK---LYLVTDVPGVMVNSH----VIDQLSLQ
ARGB_LISMO            EH------DWLNVNADTAACEVASALHAEA---LYLLTDVPGVKNGSE----IIGEIATA
ARGB_STRGC            AG------ELLNINADYLAAAVASSLQAEK---LILMTDIEGVLEDKK----VLPQILTS
ARGB_STRMU            EG------DMLNINADYLATAVAVALAADK---LILMTNVKGVLENGA----VLEKITSH
ARGB_STAEQ            QG------EYLNVNADHLATAIAKKLKVEK---LVYMTDVPGVIEKDK----TLATLTIN
ARGB_STAA8            DG------EFYNINADTLAYFIASSLKAP----IYVLSNIAGVLINDV----VIPQLPLV
ARGB_STAS1            SR------HLYNINADTLAYKIAQTLNAP----IYLLSDIPGVMIDNK----VKATLNSE
F2F8U5_SOLSS          DG------QALNINGDTVASEIALAVGADC---LLLVTDVAGIRIKDE----YQTEVTPR
ARGB_CHLSY            -----TDGLSYNVNADMVAEAVAGALAGA---ELVFVSNVPGVLVDG----RVVPALTPA
A9AWL6_HERA2          -----VGG-TLNVNADVFAGAIAAAVGAD---EAVFISNVPGVLVDG----VVAPRLNTD
ARGB_METKA            -----EDGTVYNVNADTAAGAIAGAVRAD---RLVLLTDVPGVLEDLDDPETLIERVRPE
ARGB_ANADF            -----AQGQALNINGDTVASQLAGALEAD---ALVLVTSTPGVLRDVNDPSSRIPHITHA
ARGB_SORC5            -----ADGQAYNINADTVANRVAIELGAA---GLFLVSDVPGVLRDVADPASRIPSLTVA
D0MH54_RHOM4          -----DEGQLYNVNADTVACALAEALQAR---AFLLVTETGGVHRNPDDPSSLLPHCDRA
G8TL83_NIAKG          -----QKGQLLNTNADTIAQEVATSLGALYDVQLIYSFEKSGVLLDANDDSTVINSINPG
H8KSK8_SOLCM          -----QQGNMLNTNADTIASSIAVALSANFDVNLIYCFEKEGVL---DGEEKVIPSITHS
I3Z7J5_BELBD          -----KKGQLLNTNADSISSEIAVALSGRHKVNLYYCFNKAGVLIDEKNDDSIVPLINED
A0M371_GRAFK          -----EDGVLLNTNGDSVASEIAIAMSKSFETQLYYCSEKKGVLTDMENDRSVISELNST
G2PLE7_MURRD          -----GKGQMLNTNADTIAAELAIAMSDQFETTLYYCFDKKGVLQDVEDENSVIQHIDSK
ARGB_AZOPC            -----GGGQLLNTNADSIAGELAKVLVYDYNVRLVYCFDKKGVLYDEGDENSFISVLSYT
ARGB_DEHMC            INRPSGSRRLLNINGDPVAGEIASALQAE---RLVFLTDVPAVKGKNG---EALGEISAD
ARGB_PELTS            EG------ESYNINADYAAGRLAAALGAD---KLIILTDVEGIMADRSDPGSLISVLRAS
ARGB_DESRM            EG------ETYNINADTVASAIATALKAD---KLIILTDVEGILEDRQDKGTLISTVKME
ARGB_MOOTA            EG------ESYNINADLVAGELAVALQAD---KLVLLTDVEGILADRDDPASLISSLEVG
ARGB_METBF            KG------NALNINADIVAGDIAAALHAK---KLILMTDVSGLLRDMNDPNSHISRVTLE
ARGB_METMA            KG------NALNINADTVAGDIAAALHAK---KLILMTDVSGLLRNIKDPGSRISRVKLD
ARGB_METB6            YG------GSLNINADTAAGDIAIALKAY---KLINMTDVDGVMDAKR--THVFRKLSIT
ARGB_METPE            ES------NSLNINADTAAAKIAVALHAA---KLINLTDVDGVMDAER--THVYRRLKVD
ARGB_METHJ            NG------NDLNINADTAAGELAIALGAH---KLISMTDVDGIMNRER--TEVYRRMTPQ
ARGB_METLZ            KG------NDLNINADTMAGEIAVALKAF---KLISLTDVDGVMNKER--TEIFHRLTLK
ARGB_ARCFU            AG------NTYNLNADVVAGDIAAALKAK---KLIMLTDVPGILENPDDKSTLISRIRLS
ARGB_PSEPK            NG------ESYNINADLVAGKVAEALKAE---KLMLLTNIAGLMDKQG---QVLTGLTTE
ARGB_PSEFS            NG------ESYNINADLVAGKVAEALKAE---KLMLLTNIAGLMDKEG---KVLTGLTTQ
ARGB_AZOVD            DG------ESYNINADLVAGKVAEALKAE---KLMLLTNIAGLMDKEG---RVLTGLSTE
ARGB_AROAE            AG------ETYNINADVVAGKLAEILKAE---KLVLLTNTPGVLDKAG---KLLTGLTPH
ARGB_DECAR            DG------ETYNINADVVAGKIAEVLKAE---KLVLLTNTPGVLDKNG---DLITGITPK
ARGB_NITEC            EG------ESYNINADLVAGRLAETLKAE---KLILMTNTPGVLDKNG---NLLTGLTAS
ARGB_POLSJ            SN------ESYNINADVVAGKLATVLKAE---KLVLLTNTPGVLNKAG---ELLTDLTAR
ARGB_RHOFT            NN------ESYNINADVVAAKLATVLKAE---KLMMLTNISGVLDKAG---NLLTNLSAR
ARGB_NEIMB            KG------EAFNINADLVAGKLAEELNAE---KLLMMTNIAGVMDKTG---NLLTKLTPK
K0N9K4_DESTT          NG------ETYNINADVVASKIASALKAE---RLILLTDVDGVLDKDK---KLVSSVDAA
ARGB_CAUSK            EG------QTFNINADTVAGALAGALKAK---RMLMLTDIAGVLDADG---NLIRAMTVA
ARGB_CAUVC            DG------DTFNINADTVAGALAGALKAK---RMLMLTDIKGVLDGNG---ELIREMTIE
ARGB_OLICO            DG------QTYNVNADTFAGAVAGALRAK---RLLLLTDVAGVLDKSK---KLIPELSIK
ARGB_LAWIP            K-------QTYNINADEVAGAIAGALKAT---RLLLLTDVEGILDLNK---KLIQSIYLE
ARGB_NITSB            QLGH----PGYNINADLCASKVAGALKAK---KIIFLTDTPGVLDKEG---KLISTLTEE
ARGB_WOLSU            EAGH----PGYNINADTAASEIAKAIKAR---KVIFLTDTQGVLDGEG---SLMESLTLS
ARGB_AQUAE            E--G----EAYNVNADLAASEIAGEIKAE---KLIYLTDTKGVLDEKG---ELISSLSKD
ARGB_THEMA            D--G----HSYNINADTAAAEIAKSLMAE---KLILLTDVDGVLK-DG---KLISTLTPD
ARGB_SYNY3            FG------QAHNINADTCAGELAAALGAE---KLILLTDTRGILRDYKDPSTLIHKLDIQ
ARGB_SYNE7            NG------QSFNINADTVAGEIAAALNAE---KLILLTDTRGILEDPKRPESLIPRLNIP
ARGB_CYAM1            DG------TTYNLNADVVAGELAIKLKAK---KLIFLTDTKGILADINNENSVISTLNLK
ARGB_BRAHW            DEG-----NVYNINADTAAARIAESLKAE---TLIYMTDTPGLLKDKDDENTLISQINIK
ARGB_ACTP2            DQG-----VAYNINADTVASEIAMALGAA---KLVSMTDIAGLLRDRFDESTLIPEVEVS
B2TQ27_CLOBB          DDN-----KAYNINADICASKISSALNAK---KLILLTDVPGVLVDPKDSTSLLNVLRLH
ARGB_LACLA            DG------EIYNVNADTAASRIAGALSAE---QFILLSDVRGLYGNFPDEESFIDEINLT
ARGB_CHLCH            DG------NLYNINADDAASSISIALKAE---KLIYVSDVAGIQVG----DKILKTISKA
ARGB_CHLL2            NG------NIYNINADDAASSIAIALKAE---KLIYVSDVEGIQVG----ERILKTICKA
ARGB_CHLTE            EG------NIYNINADDAAAAIAVALKAE---KLIYVSDVEGVRVG----NRILKTICKA
ARGB_OPITP            DG------KPYNVNADLVAGRVASALRAR---RLVYMSDVPGLLANPADPESLISTVKVG
ARGB_ARTS2            ADDGSTTGQVLNVNADTAAAAVASALGAS---KLVILTDVEGLYANWPDKSSLISSLTAS
ARGB_RENSM            G----KASSVLNVNADTAAAALAVALQAS---RLVILTDVEGLYRNWPDKDSLISALSVK
ARGB_MYCTU            D------GVVHNINADTAAAAVAEALGAE---KLLMLTDIDGLYTRWPDRDSLVSEIDTG
ARGB_CUTAK            DAAGRPTGQVLNVNADTAATAIAQALRAE---KLVMLTNVAGIYGTWPDPHTLISEVSAS
K7S5D7_ACIA4          DEHGSTTGQVLNVNADAAATAIAQALRAE---KLVMLTNVAGIYRTWPDPRTLIPDISVS
D5WRY9_KYRT2          E------GRRYNVNADEAAGAVAGALGAE---KLFLITDVPGILRRGPKGSEVVSKITAE
K0RZL1_THAOC          EGQD-DEAVVYNINADVAAGRIAGELKAE---RLLFLTDIAGVLDKEM---KLMETLTCD
ARGB_THET8            EG-------PLNVNADTAAGAVAGALGWP----AVFLTDVEGVYRNPKDPKTRFPRLTPK
M9X6X8_MEIRD          QG-------PLNINADTAAGAIAGALHLP----AIFLTDVVGVLREAKDPSSRFPQLNPA
E4U5I9_OCEP5          GG-------PLNVNADEVAAAVAGCLGEP----LVYLTDVPGVLADPADPESRIPVLDGA
ARGB_DEIRA            DGE------ALNVNADTVAGAVAGALGEG----AVFLTDVDGVYRAYPDPDSRAAQLTRA
ARGB_RUBXD            RG-------AYNVNADDAAAALAVALGAGE---LLLLTDVDGLLRD----DEPVPALTPA
ARGB_ACIC5            DGE------YYNVNADEMAAACAAACRADA---LVFLTDVPGVRGA---DGTIMRWLTVD
ARGB_SOLUE            LGQ------IYNVNADQMAVACASAFGACR---LIFLTDVDGVMDN---SNRVRPVLTAA
ARGB_CITK8            EG------QLMNVNADQAATALAATLGAD----LILLSDVSGILDGKG---QRIAEMTAA
ARGB_SALAR            DG------QLMNVNADQAATALAATLGAD----LILLSDVSGILDGKG---QRIAEMTAA
ARGB_ECOLI            EG------QLMNVNADQAATALAATLGAD----LILLSDVSGILDGKG---QRIAEMTAA
ARGB_PECAS            QG------DLMNVNADQAATALAQTLGAD----LILLSDVSGILDGKG---QRIAEMTAE
ARGB_PHOLL            KG------ELMNVNADQAATAIAQTLGAD----LVLLSDVSGILDGKG---QKIPDINVE
ARGB_BUCAI            DG------LLMNVNADLAATALATTLQAN----LILLSDISSILDGKG---QRITEIDSI
ARGB_VIBVU            QG------QLMNVNADQAAVAVAGALDAQ----LVLLSDVSGVLDGKG---HLIKSLNQQ
ARGB_VIBPA            EG------QMMNVNADQAAVAVAGALDAE----LVLLSDVSGVLDGKG---HLLKSLSKK
ARGB_ALIF1            DG------ELMNVNADQAAVAVATALDAD----LVLLSDVPGVLDAEK---QLIKSLDSA
ARGB_PSYIN            DG------RLYNVNADQAAITICELVGAE----LLFLSDVDGVWDAHK---QVIPELNTQ
ARGB_MORAB            QG------LLLNVNADQAATAICETLDAD----LVMLSDVAGILDADM---QLIAEMNSH
ARGB_SHEON            DG------QMLNVNADQAATVLAKLVGGK----LVLLSDVSGVLDGKG---QLIPSLNGQ
ARGB_SHEPA            QG------EMLNVNADQAATALAKLVSGS----LVLLSDVSGVLDGKG---QLINSLNRE
ARGB_ALTMD            QG------RLLNVNADQAATVIAELLNAE----LLLLSNVDGVLDGNK---ALISALNAN
Q15X81_PSEA6          KG------NLLNVNADQAATVIAQLLNAD----LLLLSNVPGVLDHNK---NLINQLTAK
ARGB_COLP3            NG------DLVNVNADDAAVAICQLLNAE----LLLLTDVNGVKDADG---EYLSSLNAE
                                 * *.*  :   .               .  .:                 

ARGB_BACSK            LAKHYIEEGVIYGGMVPKVNACLDSLSGALTKARIVNGKKAYHPSAGTAIVKQSNVLTSG
D5DZZ3_BACMQ          EIDALIEEKVIYGGMIPKVTSAVNALSPLLEEVHIISGTDGFLDKEGKLIGTAIKYSGKG
ARGB_BACC0            EIATLIEKGVITGGMIPKVQAALASLKMGVQKISIVNGTKDFTEDTGECIGTTVTRGVSI
ARGB_LEUCK            KAKQLQDDHIITGGMIPKINSALHAVKRGVHNVHITDTVTHPGTIVTL------------
A0A175C0J4_LEUGE      KALELQTSNIITGGMIPKINSALDAVQRGVHNVHITNTVTHPGTIVTL------------
ARGB_LACPL            QAQQLIRTAVITAGMQPKVQAAIAAIQTGVKQAIITNAIDQPGTAI-IQEVAV-------
J9W7G6_LACBU          KANQLFEAEIIKSGMQPKIKAAFDALKHGVKEVKITNQLQHSGTSLSVKQLAI-------
ARGB_LISMO            EIEKLQSTGVIKGGMIPKLASAAFAAENGVGQVIITDSLNNSGTKIKNKVAIG-------
ARGB_STRGC            QVSKKIQTGVIKGGMIPKIESAVQTVLSGVGQVLIGDNL-LTGTLIAEG-----------
ARGB_STRMU            QVQEKIDTAVITAGMIPKIESAAKTVAAGVGQVLIGDNL-LTGTLITAD-----------
ARGB_STAEQ            EAKTKIENKIITGGMIPKIESAIQTLESGVESILIANNL-QKGTIIRGD-----------
ARGB_STAA8            DIHQYIEHGDIYGGMIPKVLDAKNAIENGCPKVIIASGNKPNIIESIYNNDFVGTTILNS
ARGB_STAS1            HIKNYIEQEQIYGGMIPKVQDAISAIEYGCQKVVIAAGNEAHVVERIRTGKGIGTTIVL-
F2F8U5_SOLSS          LIEQWIDDGHIYGGMIPKVQGALNCLKAGIPSVQIV--NETLTGTTILSEELVK------
ARGB_CHLSY            AVEELIANGVISGGMIPKVRAALAALQRGASSVRIVNLAGLHDGGTRFTHGELSE-----
A9AWL6_HERA2          DIQALIANGTISGGMIPKVESALSGLQAGVKIVRITNIDQL-DAGTIIEAA---------
ARGB_METKA            DVEELEEKGIVTGGMVPKLEAAKMAVEAGCREAVITNLEGLLEGRGTIVR----------
ARGB_ANADF            EFERMVADGTISGGMIPKLEESFAVLDSGAKSVVIVGKLGEGDLAHAVLNPGSAGTVLVG
ARGB_SORC5            EGRALIASGAVTRGMIPKLEESFAALAEGVRRIHILGRLKPGDLAREASEPGSIGTVLVP
D0MH54_RHOM4          TFEAGLRDGWIGGGMRVKLEVAFQALDRGIPEVHI--------LAPDDLLARRRATSVVP
G8TL83_NIAKG          YYQQLKSEQKIFAGMIPKLDNAFAALNRGVKKVIIGKAEQLTDLITGKAGTSIVHE----
H8KSK8_SOLCM          YFNELKNNGVVVAGMIPKLDNAFAAIGKGVSSVYIMHADALPALINDKKAVGTKIS----
I3Z7J5_BELBD          IYAELKKEDVIHSGMIPKLDNAFAALNKGVNHVWIGKAENLLLAAKGKVSGTNIEKHRYD
A0M371_GRAFK          YYKELVETKVIKDGMLPKLHNCFEAINKGVATVFLGDSELLKK-NAIHTKIVK-------
G2PLE7_MURRD          GYDELLAYGIIADGMLPKMHNCFYALRNHVAKVCVGNTNMLEADNSDYTTLTL-------
ARGB_AZOPC            DFQRYKENGIIGGGMLPKLDSAFNALSAGVKEVIITCASNIKHTGSGTHLKL--------
ARGB_DEHMC            HAAELLASGTASGGMIPKLRSCLKATLAGSSACIIDGRKPHMLIRELTEGNCGTTVTGQH
ARGB_PELTS            EVPSLIERGVIDGGMIPKVECCLDALAGGVRTTHILDGRVPHSILLEIFTDKGIGTMVEK
ARGB_DESRM            DIPRLIERGVIQGGMIPKVECCMQAIQTGVATTHILDGRVPHSILLEVFTDKGIGTMVVS
ARGB_MOOTA            RVPELIQQGVIAGGMIPKVNCCIRALEGGVKKTHIIDGRIPHSILLEVFTDTGVGTMVVP
ARGB_METBF            DIDHLIAEGVIQGGMIPKLKGAAVAVKNGVEKAHIINGSVSHSMLLELFTDRGIGTMVYK
ARGB_METMA            DIDLLIEEGVISGGMIPKIKGAAVAVKSGVERAHIINGSVSHSMLLELFTDGGVGTMIY-
ARGB_METB6            EANALLASGAIGEGMIPKVSSVIKAVENGVKYSHIINGNVEHNLILELFTHEGVGTMISL
ARGB_METPE            ETNEMINSGVISEGMIPKVEGMVYALDRGVGSAHIINGNTEHNLLLELFTRDGVGTMIHP
ARGB_METHJ            DAEELIASGVVSEGMIPKVLAVLRALHGGVPYAHIINGNLAHNLIMELFTAEGVGTMITD
ARGB_METLZ            NVDALMSDGTISGGMIPKLEASVNAVRHGVEGAHILNGNSEHNLLLELFTNDGVGTMITA
ARGB_ARCFU            ELENMRSKGVIRGGMIPKVDAVIKALKSGVERAHIIDGSRPHSILIELFTKEGIGTMVEP
ARGB_PSEPK            QVNELIADGTIYGGMLPKIKCALDAVQGGVNSSHIIDGRVPNAVLLEIFTDSGVGTLITN
ARGB_PSEFS            QVDELIADGTIYGGMLPKIRCALEAVQGGVGSSLILDGRVPNAILLEIFTDTGVGTLISN
ARGB_AZOVD            QVDALIADGTIYGGMLPKIRCALDAVQGGVTSAHIIDGRVPNAVLLEIFTDTGVGTLITN
ARGB_AROAE            QIDDLVADGTLSGGMLPKISSALDAARNGVKSVHIIDGRVEHCLLLEILTDHGVGTMIKS
ARGB_DECAR            QIDEMVDDGTLSGGMLPKIGSALDAARNGVKGVHIIDGRVEHALLLEILTDHGVGTMIKS
ARGB_NITEC            RVDELFADGTISGGMLPKIKSALDAVKNGVKSCHIIDGRVQHALLLEILTDEGVGTLIKS
ARGB_POLSJ            EIDDLFADGTISGGMLPKIEGALDAAKSGVNSVHIIDGRVPHAMLLEILTDQAYGTMIRS
ARGB_RHOFT            QIDDLFLDGTISGGMLPKISGALDAAKSGVNSVHIIDGRVPHVLLLEILTDQAFGTMIRS
ARGB_NEIMB            RIDELIADGTLYGGMLPKIASAVEAAVNGVKATHIIDGRLPNALLLEIFTDAGIGSMILG
K0N9K4_DESTT          NIKEMIETDGIKGGMIPKVECALDALRNSVKKAHIINGKLPHAVLLELFTDSGIGTQVFL
ARGB_CAUSK            EARALIESGVASGGMIPKLENAIHAVENGVEAVVILDGRRPHAMLVELFSEHGAGTLISK
ARGB_CAUVC            QARALIDTGVATGGMIPKLENAIHAIESGVEAVVILDGRRPHAMLVELFSEYGAGTLIKR
ARGB_OLICO            DARRLIADGTISGGMIPKVETCIYALEAGVEGVVILDGKTPHAVLLELFTNQGTGTLIYK
ARGB_LAWIP            DTPKLFSDGIVFGGMIPKLQCCIEAIEQGVEKVVILDGRLEHSILLELFTDQGVGTEIVK
ARGB_NITSB            KIELLKKDGTISGGMIPKVDACLEAIDEGVEKAHIIDGRVEHSLLLEIFTSEGIGTQVLG
ARGB_WOLSU            EVEENKRSGVINGGMIPKVDACVECVKGGVEKAHIIDGRVEHSLLLELFTSEGIGTEILR
ARGB_AQUAE            KAEELIKKGVIREGMIPKVRSALRALEKGVKKVHIIDGRVKHSILLEVFTKEGVGTEITL
ARGB_THEMA            EAEELIRDGTVTGGMIPKVECAVSAVRGGVGAVHIINGGLEHAILLEIFSRKGIGTMIKE
ARGB_SYNY3            QARELIGSGIVAGGMIPKVTCCVRSLAQGVRAAHILDGRLPHALLLEVFTDLGIGSMIVA
ARGB_SYNE7            QSRELIAQGIVGGGMIPKVDCCIRSLAQGVRAAHIIDGRIPHALLLEIFTDAGIGTMIVG
ARGB_CYAM1            EAKNL--ANTISGGMIPKVNACICAVENGVEAAHIIGGKEKHQLLLELLTEKGRGSMIVV
ARGB_BRAHW            DIDNLIKDGTISGGMIPKVKHCIDAVENGVSKVFIIDGRLCHSLLIEMFTDEGIGTMFHK
ARGB_ACTP2            EVQGLIDQGIIAGGMIPKIACCTDFINAGGIEANIIDGRVPHAILVSLFGGKN-GTLFYK
B2TQ27_CLOBB          QIPKLCLDGVIQGGMIPKINCCVEAIRMGVERTHIIDGRVPHSLILELFSNEGIGTMIY-
ARGB_LACLA            NLEKLVKEKKITDRMIPKIEAIKYAMFEGLGQAVLLDGRVPHALLLELFTDKGQGTMINH
ARGB_CHLCH            EAADLIERGIISGGMIPKVVSAFNTMDGGVGKVHLIDGKSTHSLLLEIFTHEGVGTQFIN
ARGB_CHLL2            EAADFIEQGIISGGMIPKVLSAFKTLDGGVRKIHLIDGKFTHSLLLEIFTHEGIGTQFIA
ARGB_CHLTE            DAAELIEKGIITGGMIPKVVSAYQTLDGGVGKVHLIDGQITHSLLLEVFTNEGVGTQFVN
ARGB_OPITP            QIDDLKKKGIIDKGMRPKVQSAMRALQEGVQRVHFIDGRLAHSLLLEIFTDKGIGTEFVQ
ARGB_ARTS2            ELREMLP--RLESGMIPKMAACLQAVDDGVERAHIVDGRLPHSMLLETFTTAGIGTQVVP
ARGB_RENSM            ELRELLP--SLASGMIPKMTACLKAVDGGVRRASVVDGRSPHSMLLEIFTTAGNGTQVFP
ARGB_MYCTU            TLAQLLP--TLESGMVPKVEACLRAVIGGVPSAHIIDGRVTHCVLVELFTDAGTGTKVVR
ARGB_CUTAK            DLRAMIP--RLGEGMRPKAQALLDAIDGGVSSAAIVDGRIEHALLLEIFTTRGVGTMARS
K7S5D7_ACIA4          DLRRMIP--RLGEGMRPKAQALLEAIDGGVTSSAIVDGRIEHALLLEIFTTKGVGTMARP
D5WRY9_KYRT2          EIRQLVEGGEIYGGMIPKVKACLTALEAGAKHVHIINGEDPHALLLEVFTDRGIGTMVLP
K0RZL1_THAOC          DIDNLIDDETITGGMIPKVTYATDAVKLGVKGAFITDGRVPHALLNEILAGGEEGKGSGG
ARGB_THET8            EVEALKEEGVIQGGMIPKVEAALAALRAGAPWAAVAKG-ERGVLRRLLSGEGGTLFSPS-
M9X6X8_MEIRD          QVQALIQEGTISGGMIPKVEAALNALHKGAPWAAIAKG-TQGILQQVLEGSAGTRVVGG-
E4U5I9_OCEP5          EVEARIQDGTIAGGMIPKVRAALTALEFGAPWVMIAPG-EPGSLPRLLSGKLGTRIVPEK
ARGB_DEIRA            EVEDGLAAGWIAGGMIPKVRAALDALGRGAPFAIIASGMTAGVLAQAARGEAGTRIVP--
ARGB_RUBXD            ECERYVSSGVASGGMAPKLRAAAEAARGGVPARIINGGRRGALAGALAGGQVGTLVRQEG
ARGB_ACIC5            QIPVLSQTEVISGGMLPKLGACREALLNGVKRVRILPAEAAHVLPDLCSARVTDGTEVMA
ARGB_SOLUE            ESRQLIDEGIATGGMQAKLNAALSALADGVQQVRIAPGAAPGALQRILAGEEIGTKMVTA
ARGB_CITK8            KAEQLIDQGIITDGMIVKVNAALDAARTLGRPVDIASWRHA-EQLPALFNGTPIGTRILA
ARGB_SALAR            KAEQLIDQGIITDGMIVKVNAALDAARALGRPVDIASWRHA-DQLPALFNGTPIGTRILA
ARGB_ECOLI            KAEQLIEQGIITDGMIVKVNAALDAARTLGRPVDIASWRHA-EQLPALFNGMPMGTRILA
ARGB_PECAS            KAEQLIAQGIITDGMIVKVNAALDAARALGRPVDIASWRHA-EQLPALFSGVAIGTRILA
ARGB_PHOLL            KAEQLIAHGIITDGMIVKVNAALDAARTLDRPVDIASWRHA-DQLTDLFNGVPVGTRILA
ARGB_BUCAI            QAEKLIMQGIITNGMIVKVRAALEAARVLRRPVDIASWQNT-EKLKLLFNGVNIGTRVYV
ARGB_VIBVU            EADALIAGKVITDGMIVKVQAALEAANDLGRAIEVATWRYP-ENLEKLFAGESIGTQFLP
ARGB_VIBPA            EANALIEGQVITDGMIVKVKAALEAANDLGRPIEVATWRYP-EKLTQLFAGESIGTQFLP
ARGB_ALIF1            QAEMLIHQAVITDGMIVKVRAALDAAQELGRAIEVASWRSP-EKLAELFIGNSIGTQFQP
ARGB_PSYIN            LADRLIAEKVIQDGMAVKVKAALQAAEQLGY-VMLASWKNP-ENLVSLLAGQAVGTKVVK
ARGB_MORAB            YADELIMAGVIHGGMEVKVKAALKAAASLNRDIKLASWKVP-ERLVALLNGEAEGSKVSS
ARGB_SHEON            QIADLVKQGVIEKGMKVKVEAALEVAQWMGQAVQVASWRDA-SQLVALAKGEAVGTQIQP
ARGB_SHEPA            QVNELTKIGVIEKGMKVKVEAALDVAESMGQAVQIASWRHA-HQLIALCQGEAVGTQIQP
ARGB_ALTMD            SIAQYASEGVITDGMKVKVDAALASAESLSRPVYIASWAADITDILNKTTGTQIVPTTLA
Q15X81_PSEA6          GIAELVESGVIIDGMQVKVDAALDAATSLQRPITIASWQTP-EQLLGLLAGEPVGTTIIP
ARGB_COLP3            QAQKLIEQGVIAGGMTAKVNAALHAAQQLRRSIAVASWQSP-EQITQLLDGHGVGTQIQP
                                    *  *                .                         

ARGB_BACSK            A--------------
D5DZZ3_BACMQ          GEDSDEFIVSNISTV
ARGB_BACC0            V--------------
ARGB_LEUCK            ---------------
A0A175C0J4_LEUGE      ---------------
ARGB_LACPL            ---------------
J9W7G6_LACBU          ---------------
ARGB_LISMO            ---------------
ARGB_STRGC            ---------------
ARGB_STRMU            ---------------
ARGB_STAEQ            ---------------
ARGB_STAA8            ---------------
ARGB_STAS1            ---------------
F2F8U5_SOLSS          ---------------
ARGB_CHLSY            ---------------
A9AWL6_HERA2          ---------------
ARGB_METKA            ---------------
ARGB_ANADF            ---------------
ARGB_SORC5            ---------------
D0MH54_RHOM4          ---------------
G8TL83_NIAKG          ---------------
H8KSK8_SOLCM          ---------------
I3Z7J5_BELBD          LY-------------
A0M371_GRAFK          ---------------
G2PLE7_MURRD          ---------------
ARGB_AZOPC            ---------------
ARGB_DEHMC            LRRS-----------
ARGB_PELTS            ---------------
ARGB_DESRM            D--------------
ARGB_MOOTA            G--------------
ARGB_METBF            FEKPKN---------
ARGB_METMA            ---------------
ARGB_METB6            Q--------------
ARGB_METPE            ---------------
ARGB_METHJ            RIDEV----------
ARGB_METLZ            SMISL----------
ARGB_ARCFU            ---------------
ARGB_PSEPK            RKPR-----------
ARGB_PSEFS            RKRP-----------
ARGB_AZOVD            RQG------------
ARGB_AROAE            K--------------
ARGB_DECAR            H--------------
ARGB_NITEC            EG-------------
ARGB_POLSJ            H--------------
ARGB_RHOFT            H--------------
ARGB_NEIMB            GGEDA----------
K0N9K4_DESTT          N--------------
ARGB_CAUSK            ---------------
ARGB_CAUVC            ---------------
ARGB_OLICO            ---------------
ARGB_LAWIP            KPV------------
ARGB_NITSB            G--------------
ARGB_WOLSU            D--------------
ARGB_AQUAE            E--------------
ARGB_THEMA            LEG------------
ARGB_SYNY3            SGYDL----------
ARGB_SYNE7            SGYHEAHQPWQ----
ARGB_CYAM1            ---------------
ARGB_BRAHW            D--------------
ARGB_ACTP2            K--------------
B2TQ27_CLOBB          ---------------
ARGB_LACLA            ---------------
ARGB_CHLCH            ---------------
ARGB_CHLL2            EQDNDQQENR-----
ARGB_CHLTE            ELEQEPTAEEGAS--
ARGB_OPITP            ---------------
ARGB_ARTS2            DEETNA---------
ARGB_RENSM            EAGPQGEKA------
ARGB_MYCTU            G--------------
ARGB_CUTAK            DDYV-----------
K7S5D7_ACIA4          DDYDSGVTDD-----
D5WRY9_KYRT2          AEEGSE---------
K0RZL1_THAOC          GGTVVTL--------
ARGB_THET8            ---------------
M9X6X8_MEIRD          ---------------
E4U5I9_OCEP5          ISREV----------
ARGB_DEIRA            ---------------
ARGB_RUBXD            AFA------------
ARGB_ACIC5            S--------------
ARGB_SOLUE            ---------------
ARGB_CITK8            ---------------
ARGB_SALAR            ---------------
ARGB_ECOLI            ---------------
ARGB_PECAS            ---------------
ARGB_PHOLL            ---------------
ARGB_BUCAI            ---------------
ARGB_VIBVU            A--------------
ARGB_VIBPA            Q--------------
ARGB_ALIF1            Q--------------
ARGB_PSYIN            ---------------
ARGB_MORAB            ---------------
ARGB_SHEON            ---------------
ARGB_SHEPA            ---------------
ARGB_ALTMD            AENGNAGEI------
Q15X81_PSEA6          NI-------------
ARGB_COLP3            N--------------