CLUSTAL format seed alignment for MF_00083

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

PTH_MYCPU       -----------------------MKLIVGLGNPGDEYDKTRHNLGFMVIDKIAEKLNVKL
PTH_UREPA       ---------------------MEKYLIVGLGNPGSNYAKTRHNVGFMVINEICNKLNLSL
PTH_AYWBP       -----------------------MKLIVGLGNPGKKFLNTRHNIGFVVVDSFLSQNKYQT
PTH_BACHD       -----------------------MKLIVGLGNPGAKYDGTRHNVGFDVVDAVARRLNIEI
PTH_BACSU       -----------------------MLVIAGLGNPGKNYENTRHNVGFMVIDQLAKEWNIEL
PTH_LISIN       -----------------------MKLIAGLGNPGKKYERTRHNVGFMVVDELSFRHQTPW
PTH_LISMO       -----------------------MKLIAGLGNPGKKYERTRHNVGFMVVDELSFRHQTPW
PTH_STAAM       -----------------------MKCIVGLGNIGKRFELTRHNIGFEVVDYILEKNNFSL
PTH_STRPN       ----------------------MTKLLVGLGNPGDKYFETKHNVGFMLIDQLAKKQNVTF
PTH_STRP1       ----------------------MVKMIVGLGNPGSKYEKTKHNIGFMAIDNIVKNLDVTF
PTH_LACLA       ----------------------MTKMIVGLGNPGDKYEKTKHNMGFMALDLLAKELNVDF
PTH_LACSK       -----------------------MKMIVGLGNPGSKYAKTKHNIGFMVIDQLCEKYNVTL
PTH_CLOAB       -----------------------MFLIVGLGNPGLKYEHTRHNMGFDAIENIAAKHNISI
PTH_CLOPE       -----------------------MILIVGLGNPGKQYEQTRHNIGFDVIDYMANKYNIDV
PTH_MYCGE       --------------------MPTYKLIVGLGNLGKKYEKTRHNAGFMVLDRLASLFHLNF
PTH_MYCPN       --------------------MDKLRLVVGLGNLGKQYAETRHNAGFKVIDRLLSLYHVQL
PTH_RUBXD       ---------------------------MGLGNPGRRYALTRHNAGHMVLDELFRRHGGRW
PTH2_CORGL      MTSVSFLSKIQALFAPKPELPAAKWLVVGLGNPGAKYESTRHNVGYMCQDMLIDAHQQQP
PTH_MYCLE       ------------MAEPTLASGWYPRLVVGLGNPGKNYGRTRHNVGFMVANLLAVRLGSKF
PTH_MYCTU       ------------MAEPLL--------VVGLGNPGANYARTRHNLGFVVADLLAARLGAKF
PTH_DEIRA       -----------------------MKLIVGLGNPGEKYAQTRHNVGWLVVDELARRAGGSW
PTH_NOSS1       ---------------------MIPQLIVGLGNPEPKYDQTRHNIGFAAVDALARAWNISL
PTH_SYNY3       ---------------------MIPKLIVGLGNPEPKYDQTRHNIGFAVVDALAITWQCSW
PTH_THEMA       ------------------------MVVVGLGNPGPRYAFTRHNVGFLFLDFLK---NKDW
PTH_AQUAE       ---------------------MDIKLVVGLGNPGKEYEKTRHNVGFMVIDELVKALRAKG
PTH_RHIME       -----------------------MLIIAGLGNPGPKYAGNRHNIGFMAVDAIQRR-QGFS
PTH_RHILO       -----------------------MLVFAGLGNPGAKYADNRHNVGFMAADAIARR-HSFS
PTH_BRUME       -----------------------MLLIAGLGNPGPQYAHNRHNIGFMAADEIFRR-HRFS
PTH_RICCN       -----------------------MLLVIGLGNPGKEYQYTRHNVGFIAIEKIVNQ-YNSS
PTH_RICPR       -----------------------MILVIGLGNPGTEYQYTRHNIGFIAIERIASK-YHLS
PTH_ANAMM       -----------------------MLLLVGLGNPGKQYEFTRHNVGFVVADTVARD-FNFP
PTH_HELPY       -----------------------MTLLVGLGNPTLRYAHTRHNAGFDILDSLVSE-LDLS
PTH_HELPJ       -----------------------MTLLVGLGNPTLRYDHTRHNAGFDILDSLVSE-LDLS
PTH_CAMJE       -----------------------MILVVGLGNIGVEYENTRHNVGFMLIDLLLKE-SNFT
PTH_CHLMU       ----------------------MVKLVVGIGNPGRQYVWTRHNIGFLFLDMLASRFSGA-
PTH_CHLTR       ----------------------MVKLVVGIGNPGRQYVWTRHNIGFLLLDSLASRFLGA-
PTH_CHLPN       ----------------------MAKLIVAIGNPRHGYANTRHNAGFLLADRLVEELQGPP
PTH_TREPA       ---------------------MGIQLIVFLGNPGAEYEETRHNAAWLLLTYLFPSIVLPW
PTH_BORBU       ----------------------MGLLILGLGNPGLEFSLTRHNVGFSLLDKIVSKNGLFL
PTH_ECOLI       ---------------------MTIKLIVGLANPGAEYAATRHNAGAWFVDLLAERLRAPL
PTH_SALTY       ---------------------MAIKLIVGLANPGAEYAATRHNAGAWYVDLLAERLRAPL
PTH_YERPE       --------------------MSSIKLIVGLANPGAEYAQTRHNAGAWYVDLLAERHNQSL
PTH_VIBCH       -------------------MSQPIKLLVGLANPGPEYAKTRHNAGAWVVEELARIHNVTL
PTH_HAEIN       --------------------MSEIKLIVGLGNPGDKYTDTRHNAGEWLIERLARRFNVSL
PTH_PASMU       --------------------MSEIKLIVGLGNPGDKYADTRHNAGEWLINRLARQFHFSL
PTH_PSEAE       --------------------MTAVQLIVGLGNPGPEYDQTRHNAGALFVERLAHAQGVSL
PTH_NEIMA       -------------------MSNTIKMVVGLGNPGKEYEQTRHNAGFWFLDELAWKWKASF
PTH_NEIMB       -------------------MSNTIKMVVGLGNPGKEYEQTRHNAGFWFLDELAWKWKASF
PTH_RALSO       ----------------------MIKLIVGLGNPGAEYAATRHNAGFWLVDQLARMGHVTL
PTH_XYLFA       --------------------MLGLRLIVGLGNPGSEHTKTRHNAGFRFVDGLVQREGQRW
PTH_BUCAP       -------------------------MIVGLSNPKKKYHKTRHNVGSWYIYSLAKNYLSIL
PTH_BUCAI       -------------------------MIVGLSNPKKEYHSTRHNVGSWYLYSLAESYLRNF
PTH_WIGBR       ---------------------MKLKLIVGLSNPINLYYNTRHNIGSWYIKFLAKKYKKNL
                                             :.*    .  .:** .      .        

PTH_MYCPU       D-KEK-FNGIF----YKGENYIISKPLTYMNNSGNFVYDIKNFFDIEIDNIIIIYDEIDL
PTH_UREPA       D-SSK-FNGIFTKTIYNNSIVFFCQPTTYMNLSGEFVIKMLNFYNIPIKNLIVIYDDVDT
PTH_AYWBP       L-KED-TNAHIYQINFNNHQTLLIKPQTYMNLSGEVVKKIINKYRIKIENILVIVDDIYL
PTH_BACHD       K-QSK-ANGLYGEGRIDGEKIFLLKPQTFMNRSGESVRPFLEYYNMEVEDLLVIYDDLDL
PTH_BACSU       N-QNK-FNGLYGTGFVSGKKVLLVKPLTYMNLSGECLRPLMDYYDVDNEDLTVIYDDLDL
PTH_LISIN       K-KSK-FNGMVSEINVGGEKMILVKPLTFMNASGECIRPLMDYYNIQIEDVLIVYDDLDL
PTH_LISMO       K-KSK-FNGMTSEIIVGGEKMILVKPLTFMNASGECIRPLMDYYNIPIEDVVIVYDDLDL
PTH_STAAM       D-KQK-FKGAYTIERMNGDKVLFIEPMTMMNLSGEAVAPIMDYYNVNPEDLIVLYDDLDL
PTH_STRPN       T-HDKIFQADLASFFLNGEKIYLVKPTTFMNESGKAVHALLTYYGLDIDDLLIIYDDLDM
PTH_STRP1       T-DDKNFKAQIGSTFINHEKVYFVKPTTFMNNSGIAVKALLTYYNIDITDLIVIYDDLDM
PTH_LACLA       K-EEKPFMSLVASTFVNGEKLFLVKPLTFMNESGRSVAPLLKYYNIDEADLTVMHDDLDS
PTH_LACSK       N-KHD-FEAEYGSFKYEGETVLLVKPLTFMNDSGRSVGPLMSYYQVGIDELLVIQDDMDL
PTH_CLOAB       D-KKG-FKGLYGKGIIDGEKVILLKPYTYMNLSGESVVEAANYYKINKENIVVIYDDISL
PTH_CLOPE       N-REK-FKGICGEGFIENKKVILLKPLTYMNLSGESIRELANFYKLEDDEIIVVYDDISL
PTH_MYCGE       D-KTN---KLGDYLFIKEKAAILAKPATFMNNSGLFVKWLQDHFQIPLANIMIVHDEIAF
PTH_MYCPN       E-ERN---NLGEFILLRKHKVVLAKPNTYMNHSGKFVKWACQNWNIKPDKVMVVYDELAF
PTH_RUBXD       RRARRAEAAEVSVE---GREAVLLKPATFMNESGE------ALSGYRAEDLIVVHDDLDL
PTH2_CORGL      LTPATGYKALTTQL---APGVLAVRSTTFMNHSGQGVAPIAAALGIPAERIIVIHDELDL
PTH_MYCLE       EVHKRSGADVVNGRLA-GCSMLVAKPRNYMNESGQQVGLLAKLYSVTPADIIIVHDDLDL
PTH_MYCTU       KAHKRSGAEVATGRSA-GRSLVLAKPRCYMNESGRQIGPLAKFYSVAPANIIVIHDDLDL
PTH_DEIRA       RKDGEAEVCEVRLGTAPGEKVLLVKPQTFMNTSGKAVWPLMSFYKLEGEQLLVVQDDLDS
PTH_NOSS1       AENRKFQGQYGEGTAPGGVKIRLLKPLTYMNRSGQAIQAVTSWYKLSGESVLVIYDDLDL
PTH_SYNY3       YDHKRFQGWFGEGLMAGQ-KTCLLKPRTYMNRSGQAVRAVVDWYKLDPQSVLVVYDDMDL
PTH_THEMA       KTEKYFA--WNKINLAGN-EVALVKPLTYMNLSGLAMPHVLKFFSASLDDIIVVYDDVSL
PTH_AQUAE       PFEEALS-HVYKARIGGK-EVILAKPMTYMNNSGAAVYNLLEEYKLSPEQMIVVYDDLDL
PTH_RHIME       -AWSRKFKSEVSEGEIDGERVLLMKPQTFMNLSGEALGDAMRFYKLAPKDIVVIYDELDL
PTH_RHILO       -PWSKKFQGLIAEGTIAGEKIILIKPQTFMNLSGQSVGEALRFYKLELSALTVFYDEIDL
PTH_BRUME       -NWQKKFQAEIADGVIDGEKVLLVKPQTFMNLSGQSIGEAMRFYKLTPADLVVIYDELDL
PTH_RICCN       FSTKKKFNCEIAETISDGQKIIFIKPTTYMNLSGKSVISVKTYYNIYPAKIFVIHDDIDL
PTH_RICPR       FSIKKKFNCEIAEAVIDRQKIIFIKPTTYMNLSGKSVILVKTYYNIKYEKVFVIHDDIDL
PTH_ANAMM       -EFSSKYDALVSVGNVGLHRAMIVKPATFMNRSGAAVLKAASMHKIPAEQITVFHDDADL
PTH_HELPY       FTFSPKHNAFLC----VYKDFIFLKPQTYMNLSGESVLSAKNFYK--TKELLIVHDDLDL
PTH_HELPJ       FIFSPKHNAYLC----VYKDFILLKPQTYMNLSGESVLSAKNFYK--TKELLIVHDDLDL
PTH_CAMJE       NLTNSKFKGELFK---IGSSLLLLKPSTYMNNSGLSVKAVNDFYK--CERMIVIHDDIDI
PTH_CHLMU       FREAPRLFSSFMKVETSCGVIVLIKPSTYVNLTGKAVLAAKRFFGVSVEGILIVADDINR
PTH_CHLTR       FREAPRLYASFAKVEISSEAVVLMKPTTYVNLTGKAVLAAKKFFDVSMEDILVVADDINR
PTH_CHLPN       FKPLSKCHALMTLVESSSGPLVFIKPTTFVNLSGKAVVLAKKYFNVALSHILVLADDVNR
PTH_TREPA       RCGCRGSIARIEGFEGSSEEVWLLKPLTYMNRSGKSVGAACAFLQTDAKQLLVVHDELEL
PTH_BORBU       KRKKKYEYSELKMI---SGRVILVKPLTYMNLSGSLFPSIFSDFYMCIKNLLVVLDNVDL
PTH_ECOLI       REEAK-FFGYTSRVTLGGEDVRLLVPTTFMNLSGKAVAAMASFFRINPDEILVAHDELDL
PTH_SALTY       REEPK-FFGYTSRITLEGEDVRLLVPTTFMNLSGKAVGAMASFYRIQPDEILVAHDELDL
PTH_YERPE       KEESK-FFGYTARLNLAGQDIRLLVPATFMNLSGKAVAAMASFYRILPEEILVAHDELDI
PTH_VIBCH       KNEPK-FFGLTGRLLINSQELRVLIPTTFMNLSGKAIAALANFYQIKPEEIMVAHDELDL
PTH_HAEIN       NPESK-FFGKTARTLVNGKEVRLLVPTTFMNLSGKAVGALASFYRIKPEEILVIHDELDL
PTH_PASMU       TPESK-FSGKTARTVINGNEIRFLVPTTFMNLSGKAISSLANFYRIKPEEILVIHDELDL
PTH_PSEAE       VADRK-YFGLVGKFSHQGKDVRLLIPTTYMNRSGQSVAALAGFFRIAPDAILVAHDELDM
PTH_NEIMA       KEEKK-FFGEVARATLPDGDVWLLKPTTFMNRSGQAVAALAQFYKIKPEEILVVHDELDI
PTH_NEIMB       KEEKK-FFGEVARAALPDGDVWLLKPATFMNRSGQAVAALAQFYKIKPEEILVVHDELDI
PTH_RALSO       RNETR-FHGYAARATLWSHEVWLLQPQTFMNRSGLATVALARFYKILPDEILVVHDELDL
PTH_XYLFA       MLESK-LFAHVARVFIAGQWVWLLRPVTFMNLSGKSICAGLSFWKIKPEQMLVAHDELDF
PTH_BUCAP       KEEKK-FFGFTGCLNIKSNFIRLLIPDIFMNINGFSVHRMASFYNISLNQILIVHDDLDL
PTH_BUCAI       KNEKK-FFGFTTSLNIESNYIRLLIPNIFMNINGQSVFKMASFYNINLSEILIVHDDLEL
PTH_WIGBR       IKNKK-YCFYYIDVKIGDYYSKLVIPDTYMNVNGTIIYNITNFYKIYSNEMLIVHDDLDL
                                         .   :* .*                : :  *:   

PTH_MYCPU       KVGQASIKIKGSANGQRGMQSIIEKLK----TENIKRIKIGVSRPLY-----------EP
PTH_UREPA       KLGTIKLRKKGSSGGQNGIKNIINILK----TDEIKRIRIGIDKDPH-----------IK
PTH_AYWBP       DEGKLKLKMQGGHGGHNGLRNIIDRLC----TKQFKRLKIGVSLDSC-----------MP
PTH_BACHD       PVGKIRLRQKGSAGGHNGMKSLIAHLG----TSDFKRIRVGVDRPAPG----------ET
PTH_BACSU       PTGKIRLRTKGSAGGHNGIKSLIQHLG----TSEFDRIRIGIGRPVNG----------MK
PTH_LISIN       PVGKIRLRQKGSAGGHNGMKSIIQHVK----TQEFNRIRVGVSRPLKG----------E-
PTH_LISMO       PVGKIRLRQKGSAGGHNGMKSIIQHVK----TQEFNRIRVGVSRPLKG----------E-
PTH_STAAM       EQGQVRLRQKGSAGGHNGMKSIIKMLG----TDQFKRIRIGVGRPTNG----------MT
PTH_STRPN       EVGKIRLRAKGSAGGHNGIKSIIQHIG----TQVFNRVKIGIGRPKNG----------MS
PTH_STRP1       EVSKLRLRSKGSAGGHNGIKSIIAHIG----TQEFNRIKVGIGRPLKG----------MT
PTH_LACLA       PVGRVRLRQKGSSGGQNGIKSVITHVG----SQTFNRVKIGIGRPKHG----------MT
PTH_LACSK       TMGKLRLRQKGSAGGHNGIKSIIAHTK----SQTFKRLKIGIQHPQK-----------ST
PTH_CLOAB       DVGKIRIRTKGSAGGHNGIKNIVLHLS----SEEFPRVKVGVGEPTE------------N
PTH_CLOPE       DIGRLRIREKGSAGGHNGIKSIIQNLG----GDKFPRVKVGVGQPKD------------N
PTH_MYCGE       DLGVIRLKMQGSANNHNGIKSVIRHLD----TEQFNRLRFGIKSQNTS----------NI
PTH_MYCPN       PLGTVRLKMQGSANNHNGIKSVIAHLN----TEHFNRLRFGIKSDNTS----------NI
PTH_RUBXD       PAGTVRVKVGGGAGGHNGLRSVISRVG----N-GFVRVRVGIGRPP--------EG--AD
PTH2_CORGL      PAGKVRLKKGGNENGHNGLKSLTEELG----TRDYLRVRIGISRPP--------AG--MA
PTH_MYCLE       DFGRIRLKLGGGEGGHNGLRSVAAALG----TKDFQRVRIGIGRPT--------GR--KD
PTH_MYCTU       EFGRIRLKIGGGEGGHNGLRSVVAALG----TKDFQRVRIGIGRPP--------GR--KD
PTH_DEIRA       PFGLLRFRLGGRHGGQNGVRDIIARLG----YDRFPRLKIGISRPP--------AG--RD
PTH_NOSS1       PLGKTRLRLSGSAGGHNGMKSAIAHLS----TQNFPRLRIGIGKPKNAV-----NGDNSE
PTH_SYNY3       PLGRLRLRQTGSAGGHNGMKSLISHLG----TQDFPRLRLGIGKS---------DG-SKD
PTH_THEMA       KLGKIRIRKKGSDGGHNGMKSIIQALG----TQEIKRIRVGIGDKP--------EG--MD
PTH_AQUAE       PLGHMRLRLKGSSGGHRGVESIIKYIG----TQNFPRLRIGIGRPK--------KK--ED
PTH_RHIME       PAGKARIKTGGGHGGHNGIKSIDAHC-----GKEYRRLRLGIGHPGV----------KDL
PTH_RHILO       AEGKLRIKTGGGAGGHNGIRSIDGHI-----GNAYRRVRIGVGHPGI----------KEM
PTH_BRUME       VPGKLRIKTGGGSGGHNGIKSIDAHMQSFPGGQNYRRMRLGIGHPGA----------KEL
PTH_RICCN       ETGRIKFKTGGGNGGHNGLKSIDGVI-----GNNYNRIRIGVGRPQN----------NQG
PTH_RICPR       EIGRIKFKTGGGNGGHNGLKSIDVVI-----GNHYNRIRIGIGRPKN----------NHD
PTH_ANAMM       QHGVVKVKQGGGNAGHNGLRSIDAAI-----GCQYWRVRLGVGRPD-----------VGS
PTH_HELPY       PLGVVRFKNGGGNGGHNGLKSIDLLC-----SNSYYRLRVGISKGI-------------G
PTH_HELPJ       PLGVVKFKKGGGNGGHNGLKSIDALC-----SNSYYRLRVGISKGI-------------N
PTH_CAMJE       NLGALRFKKGGSSGGHNGLKSIDTLC-----GNDYERVRIGVGKGE-------------N
PTH_CHLMU       EFGSIRFRQDCGAGGHNGLKNTTQVLQ----SNHYWQLRLGVGRPSNP--------ESEG
PTH_CHLTR       EFGFVRFRQDCGSGGHNGIKNTTQILQ----SNHYWQLRLGVGRPSYP--------GAEG
PTH_CHLPN       SFGKLRLCFNGGSGGHNGLKSITASLG----SNEYWQLRFGVGRPLEE--------GVE-
PTH_TREPA       PFGVVSLKQGGGLGGHNGLRSIKEVLG----TADFWRLRIGIGRPP-S--------ESVN
PTH_BORBU       PLGKCRLKERGGVSTHNGLRSISSVLG----SSNYSRLYIGVGSNL-----------MRD
PTH_ECOLI       PPGVAKFKLGGGHGGHNGLKDIISKLGNNP---NFHRLRIGIGHPGD----------KNK
PTH_SALTY       PPGVAKFKLGGGHGGHNGLKDIISKLGNNP---NFHRLRVGIGHPGD----------KNK
PTH_YERPE       LPGMAKLKLGGGNGGHNGLKDIQNKLGNNP---NFYRLRIGIGHPGD----------KSK
PTH_VIBCH       PPGVAKFKQGGGHGGHNGLKDTISKLGNNK---EFYRLRLGIGHPGH----------KDK
PTH_HAEIN       PPGTAKLKQGGGHGGHNGLKDIVAQLGNNN---NFYRLRIGIGHPGH----------RDL
PTH_PASMU       PPGVAKIKQGGGHGGHNGLRDTIAQLGNNK---NFYRLRVGIGHPGD----------KNL
PTH_PSEAE       PPGVAKLKTGGGHGGHNGLRDIIAQLGNQN---SFHRLRLGIGHPGH----------SSL
PTH_NEIMA       PCGRIKFKLGGGNGGHNGLKDIQAKLGTA----DYYRLRLGIGHPGD----------RNL
PTH_NEIMB       PCGRIKFKLGGGNGGHNGLKDIQAKLGTA----DYYRLRLGIGHPGD----------RNL
PTH_RALSO       LPGAVKLKLGGGSGGHNGLKDIAAHLTTQ----QFWRLRVGIGHPRNLLPPGTAPSGQHD
PTH_XYLFA       PPGAVRLKFDGGHGGQNGLRDITKLLGHG----RFHRLRVGIGHPGH----------KDR
PTH_BUCAP       APGIIKYKYSYGHSGHNGLRHIIKEFNT---KVNFYRLRIGIGRPKNK----------NE
PTH_BUCAI       QPGISKLKYSYGHNGHNGLRDIVNTFNK---NINFYRFRIGIGRPINR----------DQ
PTH_WIGBR       DTGIARFKFNHKNSTHNGIKSIYKSFGA---KCIFNTLRIGIGRPKLN----------KN
                  .            :.*:.                 . .*:                  

PTH_MYCPU       VSSYILKKIPENEKETFEKVIDELADKLLTYIFN-DFKTFINVSKLKNSKK---------
PTH_UREPA       LDQYVLSNFKIDELVIIKPAIIKGALATLAAIGE-DFDKVMNKFN---------------
PTH_AYWBP       LDQYLLTPVNASSQKNILKNIDIINKIIFNFIQDVDFNILMNGYNSKH------------
PTH_BACHD       VVQHVLGRYRPEEKDAISEAIDLSAEAAEAFTKKP-FLEVMNTFN---------------
PTH_BACSU       VVDYVLGSFTKEEAPEIEEAVDKSVKACEASLSKP-FLEVMNEFNAKV------------
PTH_LISIN       VIHYVLGDFPKAEQPDIIAAIQKSADAIEDFAQTP-FIEVMNKYN---------------
PTH_LISMO       VINYVLGDFPKAEQPDIIAAIQKSADAIEDFAQTP-FIEVMNKYNQK-------------
PTH_STAAM       VPDYVLQRFSNDEMVTMEKVIEHAARAIEKFVETSRFDHVMNEFNGEVK-----------
PTH_STRPN       VVHHVLSKFDRDDYIGILQSVDKVDDSVNYYLQEKNFEKTMQRYNG--------------
PTH_STRP1       VINHVMGQFNTEDNIAISLTLDRVVNAVKFYLQENDFEKTMQKFNG--------------
PTH_LACLA       VGNHVLSGFDNEDKEIAQDGIFKAVDAMKFYLENGDFQKTMNKFN---------------
PTH_LACSK       VVNWVLTPFDKDGAPVINQAIDQACEESTTGVKMTTL-----------------------
PTH_CLOAB       LVNYVLGKFSQDERKKIEEVLNIVTEAVECMVVDG-VQNAMNKFNGLKL-----------
PTH_CLOPE       LVNHVLGKFSKEDREHIEKVIPVVSDAIVEIVKND-AKESMNKFNGVNIE----------
PTH_MYCGE       LHEQVMSEFQNSELTKLEVAITKSVELLKRYIEGEELQRLMEYYHHG-------------
PTH_MYCPN       LHEVVMSEFTPAERNLLETALTKAIEALKGYIDGVTMLKLMEVFNA--------------
PTH_RUBXD       VTGYVLGRMDRAAREAIP----RAADAVEAVLEEG-PEAAMNRFNARA------------
PTH2_CORGL      VPDYVLEPVDHD-QPGIE----LAAEAVDLLLAQG-LSAAQNAIHSR-------------
PTH_MYCLE       PASFVLENFTTAERMQVPTICKRAADATELLVGLG-LEPAQNHVHAW-------------
PTH_MYCTU       PAAFVLENFTPAERAEVPTICEQAADATELLIEQG-MEPAQNRVHAW-------------
PTH_DEIRA       PADWVLSKWRDEERETLAELVRLGVGAAELWAVQG-LAEAQQMYNGTDLRPQPPAPPAAP
PTH_NOSS1       TVSHVLGKFSATETQLMSLVLQFVVECVELSLKQG-VEKAMNRCNSCTVEAPKS------
PTH_SYNY3       TIAHVLGKFSPSELPIVEKSLDLATEAIAHSLHHG-IAKTMSLFNNRDVCP---------
PTH_THEMA       LVNFVLGEFSDEEWIILNKVFEVMKEALEVILVEG-IEKAMSIYNSLEVRA---------
PTH_AQUAE       VVKYVLSPFSPEEEKVISQVIKKAVRCLMRAIEIS-PEHAMEYCNRQDLI----------
PTH_RHIME       VHAHVLGDFAKADQAWLSLLLEAIADNAAMLVKG-EDSQLMNKIALATG---GKP--ETE
PTH_RHILO       VQHHVLGDFAKADREWLDPLLDAIADNAAMIVKG-DESGFMNKAALAVQ---GKAIAELE
PTH_BRUME       VHNYVLGDFAKADNEWLDTLMGAVADNVAMLARR-EDNSFMNRIALAMGDGNQRPGGVKT
PTH_RICCN       VADYVLNHFSKPEYETVMQAIDRITSNFGLILEN-KLEEFKNKIA---------------
PTH_RICPR       VADYVLNNFSESEYKIAMQSIDNIANNFGLILEH-KLAEFTNKIV---------------
PTH_ANAMM       LSGHVLSDFH--DFDSVQQLAHKISANLTELLDG-NVNGFISKIRCDHAQ----------
PTH_HELPY       VIEHVLSKFHKNEEPLKNAAFEHAKNALKFFIESHDFNAMQNRFTLKKPLKIES------
PTH_HELPJ       ITEHVLSKFHNNEEPLKNAAFEHAKNALKFFIESHDFNATQNRFTLKKPLQIES------
PTH_CAMJE       VISHVLGKFKSEEEITLSKVLEHAKKALLELIENDDLSAISSKYSLKA------------
PTH_CHLMU       VADYVLSNFSFNERKSLNGFFEKGIEEISPWLGF--------------------------
PTH_CHLTR       VADYVLSSFSLNEKEKLNDFLEKGIEEILPWLGC--------------------------
PTH_CHLPN       LSNFVLGKFSEEENLQLGSIFVEASTLFTEWCSKF-------------------------
PTH_TREPA       IAQYVLSAFYPAEMAAFPKLGRATRDLLCQLVVTDQAATVTLLSAWRKKRLLSLCE----
PTH_BORBU       IKSFVLSRFCKDEMDRLEKLYDFLSDELIDISEANFKNKVQKINSSNF------------
PTH_ECOLI       VVGFVLGKPPVSEQKLIDEAIDEAARCTEMWFTDGLTKATNRLHAFKAQ-----------
PTH_SALTY       VVGFVLGKPPVSEQKLIDEAIDEAARCTELWFKEGLAKATSRLHTFKAQ-----------
PTH_YERPE       VTGFVLGKPPASEQTLIDDAIDESIRCTEVLLNEGMTKAMNRLHAFKASA----------
PTH_VIBCH       VAGYVLGKAPAKEQECLDAAVDESVRCLEILMKDGLTKAQNRLHTFKAE-----------
PTH_HAEIN       VAGYVLNKPSPADRDALEKVLDEATDCVEMIFRDGMVKATNRLNSFKI------------
PTH_PASMU       VSAYVLNKPSLTDWQLIDKALDEATSCVDILIKDGITKATNRLNAFKA------------
PTH_PSEAE       VSGYVLGRAPRSEQELLDTSIDFALGVLPEMLAGDWTRAMQKLHSQKA------------
PTH_NEIMA       VVGYVLNKPSTEHRRQIDDAVAKSLQAIPDILAGKCEEATRFLHSK--------------
PTH_NEIMB       VVGYVLNKPSTEHRRQIDDAVAKSLQAIPDILAGKWEEATRFLHSK--------------
PTH_RALSO       VANFVLKAPRREEQELIDRAIDRSLDALPDLVAGNAERAMMRLHTTG-------------
PTH_XYLFA       VVNWVLGCPTCEENIAIDAALERASAVLPLVVAGDFDEAMKKLHTVV-------------
PTH_BUCAP       ISSFVLSIPDFKEMKLIKKSISYAIKENFTLLNLIQ------------------------
PTH_BUCAI       IASFVLSNPTKKEKILIQKSILHAIEKN-VLSNILKF-----------------------
PTH_WIGBR       INSYLLNNPSPKEEILIKKTITKCIKCTDVLIKKNKDHAMNILHKK--------------
                    ::                                                      

PTH_MYCPU       -----------------------------------------------
PTH_UREPA       -----------------------------------------------
PTH_AYWBP       -----------------------------------------------
PTH_BACHD       -----------------------------------------------
PTH_BACSU       -----------------------------------------------
PTH_LISIN       -----------------------------------------------
PTH_LISMO       -----------------------------------------------
PTH_STAAM       -----------------------------------------------
PTH_STRPN       -----------------------------------------------
PTH_STRP1       -----------------------------------------------
PTH_LACLA       -----------------------------------------------
PTH_LACSK       -----------------------------------------------
PTH_CLOAB       -----------------------------------------------
PTH_CLOPE       -----------------------------------------------
PTH_MYCGE       -----------------------------------------------
PTH_MYCPN       -----------------------------------------------
PTH_RUBXD       -----------------------------------------------
PTH2_CORGL      -----------------------------------------------
PTH_MYCLE       -----------------------------------------------
PTH_MYCTU       -----------------------------------------------
PTH_DEIRA       APAADGAPGDAQD----------------------------------
PTH_NOSS1       -----------------------------------------------
PTH_SYNY3       -----------------------------------------------
PTH_THEMA       -----------------------------------------------
PTH_AQUAE       -----------------------------------------------
PTH_RHIME       KPVAVKK--QAAQSHIHQARATAQPKKLPVTGPMADMLKKMFGPKGD
PTH_RHILO       KPAQKQQ--PKQQSHIRQARSQQAPAKLPETGPMAAMLKKLFGNKD-
PTH_BRUME       DPAQLEKAPPKAQSHIRQARQNQKKPNIPESGPMAEMLKKLLGKKD-
PTH_RICCN       -----------------------------------------------
PTH_RICPR       -----------------------------------------------
PTH_ANAMM       -----------------------------------------------
PTH_HELPY       -----------------------------------------------
PTH_HELPJ       -----------------------------------------------
PTH_CAMJE       -----------------------------------------------
PTH_CHLMU       -----------------------------------------------
PTH_CHLTR       -----------------------------------------------
PTH_CHLPN       -----------------------------------------------
PTH_TREPA       -----------------------------------------------
PTH_BORBU       -----------------------------------------------
PTH_ECOLI       -----------------------------------------------
PTH_SALTY       -----------------------------------------------
PTH_YERPE       -----------------------------------------------
PTH_VIBCH       -----------------------------------------------
PTH_HAEIN       -----------------------------------------------
PTH_PASMU       -----------------------------------------------
PTH_PSEAE       -----------------------------------------------
PTH_NEIMA       -----------------------------------------------
PTH_NEIMB       -----------------------------------------------
PTH_RALSO       -----------------------------------------------
PTH_XYLFA       -----------------------------------------------
PTH_BUCAP       -----------------------------------------------
PTH_BUCAI       -----------------------------------------------
PTH_WIGBR       -----------------------------------------------