CLUSTAL format seed alignment for MF_00084

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

NODA_RHILT      ------------------------------MSAGVRWKITWENDLEPSDHAELSEFFRAT
NODA_RHILV      ------------------------------MSSEVRWKICWENELEASDHAELADFFCKT
NODA_RHIME      ------------------------------MSLKVQWKLCWENQLERADHQELSEFFRKS
NODA_RHIGA      ------------------------------MSSGVHWKLHWETELASSDHEELASFFRNT
NODA_RHIS3      ------------------------------MGSDVRWKLCWENELQLADHVELSDFFLKT
NODA_MESS7      ------------------------------MRSAVQWRLCWENDLQLTDHVELSDFFRKI
NODA_BRAEL      -----------------MNIAVSPSAEEPSARTQVQWSLRWESELQLADHAELADFFRKS
NODA_BRASP      -----------------MNIAVSRSAEEPSARTQVQWSLRWENELQLADHAELADFFRNS
NODA_BRADU      -----------------MNIAVSPTAEGSSGRAQVQWSLRWESELQLADHAELAEFFRKS
NODA_BRASN      -----------------MNIAVSTTAEGLSMRPQVQWRVRWESELCLADHVELSEFFRKS
NODA_METNO      -------------MRFPSDLCPSSGTGELSARSQVRWRLCWENELELADHAELAEFLRKA
NODA_MESPL      ------------------------------MRSQVRWRLCWENELQLSDHIELAEFFRRT
NODA_RHITR      ------------------------------MRSKVRWRLCWENELELAEHIELADFFRMT
NODA_SINTE      ------------------------------MCSRVRWTLRWESELQLDDHVELASFFRKT
NODA_SINFN      ------------------------------MRPQMRWKLCWENELELSDHTELAEFFRKT
NODA_RHIEC      ------------------------------MSPQVRWKVCWENELELSDHTELADFFRKT
NODA_RHILO      ------------------------------MRPDVQWRLCWENELQLPDHLELSEFFRKT
NODA_AZOC5      MMVHNYCAPENVTAPPHVSRVTQYNKRGIRMISKVTWRVAWESDLTNGDHAELSDFFKSV
                                                  : * : **.:*      **:.*:   

NODA_RHILT      YGPTGAFNAKPFETGRSWAGARPERRAIAYDSKGIASHMGLLRRFIKVGDTDLLVAELGL
NODA_RHILV      YGPTGAFNAKPFETGRSWGGARPERRAIAYDSHGVASHMGLLRRFIKVGTTDLLVAELGL
NODA_RHIME      YGPTGAFHAKPFEGGRSWAGARPERRAIAYDSVGIASHMGVLRRFIKVGETDLLVAELGL
NODA_RHIGA      YGPTGKFNAKPFEDGRSWAGARPELRAIAYDSKGIAGHLGLLRRFIRVGETEVLVAELGL
NODA_RHIS3      YGRHGAFLAKPFEGGRTWAGARPEFRAIGYDAHGIAAHIGILRRFIKVGEVDLLVAEIGL
NODA_MESS7      YGRIGSFDAKPFEGGRSWAGARPEVRLIASDAQGIAAHVGILRRFIKVGEVDFLVAELGL
NODA_BRAEL      YGPTGAFNAQPFEGIRSWAGARPEMRVIGYDAHGVAAHIGLLRRFIKIGGVDLLVAELGL
NODA_BRASP      YGPTGAFNAQPFEGNRSWAGARPELRAIGYDARGVRAHIGLLRRFIKIDGVDLLVAELGL
NODA_BRADU      YGPTGAFNAQPFERSRSWAGARPELRVIGYDARGVAAHIGLLRRFIKVGEVDLPVAELGL
NODA_BRASN      YGPTGAFNAQPFENNRSWAGARPEVRVIGYDARGIAAHIGLLRRFIKVGEVDLLVGELGL
NODA_METNO      YNPSGTFNARPFEGGRSWAGARPEVRAIGYDSRGVAAHIAALRRFIKVGAVDLLVAELGL
NODA_MESPL      YGPTGAFNAKPFEGSRSWAGARPEFRAIAYDSSGIAAHMGLLRRFIKIDGADLLVAELGL
NODA_RHITR      YGPTGPFNAKPFEGSRSWAGARPELRLIAYDANGVAAHLGLLRRFIKIGAIDQLVGELGL
NODA_SINTE      YGPTGAFNAKPFEGSRSWAGARPELRAIAYDSNGVAAHMGLLRRFIKVGEVDLLVAELGL
NODA_SINFN      YGPTGTFNARPFEGGHSWAGARPELRVIGYDAHGVAAHMGLLRRFIRVGDADLLVAELGL
NODA_RHIEC      YGPTGAYNALPFEGARSWSGARPELRVIGYDAHGVAAHMGLLRRFVRVGEVDLLVCELGL
NODA_RHILO      YEPTGAFNGKQFEGGRSWAGARPELRVIGYDVHGVAAHLGLLRRYIKVGDVDLLVAELGL
NODA_AZOC5      YGATGAFNALPFAGGRSWAGARPELRGIAYDESGVAAHMGVLRRFIKVGGEQIAVAELGL
                *   * : .  *   ::*.***** * *. *  *: .*:. ***::::.  :  * *:**

NODA_RHILT      YGVRPDLEGLGIPHSIRALAPALQELAVPFAFGTVRHAMRNHVERF-CRDGISNIVTGVR
NODA_RHILV      YGVRPDLEGLGIAHSVRAMFPILRELSVPFAFGTVRHAMRNHMERY-CRDGTANIMTGLR
NODA_RHIME      YAVRPDLERMGIAHSVGALTPTLRELGVPFAFGTVRHAMRNHVERY-CQNGMASILTGVR
NODA_RHIGA      YGVRPDLEKLGIAHSIRAMAPVVDDLGVPFAFGTVRYAMRNHIERF-CRDGAANIVSGIR
NODA_RHIS3      YGVRPDLEGLGISFSLSVVYPLLQRMGVPFVFGTVRQAMRNHVERF-CRGGLASIVSGVE
NODA_MESS7      YGVRPDLEKLGISFSMRMVHPVLQQLAVPFAFGTVRHAMRSHVERF-CREGIAAIVPGVK
NODA_BRAEL      YAVRPDLEGLGISHSMRVMYPALQELGVPFGFGTVRPALEKHLTRLVGRRGLATLMPGIR
NODA_BRASP      YAVRPDLEGLGISHSMRVMYPALQQLGVPFGFGTVRPALERHLTRLVGRQGLATLMSGVR
NODA_BRADU      YAVRPDLEGHGIGHAMRVMYPALQELGVPFGFGAVRSALEKHLTRLVERQGLATLMRGIR
NODA_BRASN      YAVRPDLEGLGITHSMRVMYPVLHELGVPFGFGTVRPALEKHITRMLGRQGLARLLSGIR
NODA_METNO      YAVRPDLEGLRISHSMLVMYPALKELGVPFGFGTVRHALQKHLTRLLGKAGLATIVSGVR
NODA_MESPL      YGIRRDLEGLGISSSLRVVRPVLQELGVPFGFGTVRPALHKHVARL-GRGGLLVVKSGIR
NODA_RHITR      YGVRPDLEGLGIGHSVHAMLPVFGELAVPFAFGTVRPALQKHIERF-GRYGPVTILSGIR
NODA_SINTE      YGVRPDLEGLGISHSLRVMYPVLQQLRVPFGFGAVRHALQKHVERF-GRHVPANVLSGIR
NODA_SINFN      WGVRPDLEGLGLNHSIRVMYPVLQQLGVPFAFGAVRHALYKLVGRL-CRNGLGTIVAGVR
NODA_RHIEC      WGVRPDLEGYGIN-SMRIVYPVLQQLGVRFAFGGVRQALRNLVLRL-CRNGLATVLEGVR
NODA_RHILO      YGVRPDLEGLGIAHSISVMYPVLQQLGVPFAFGSVRPALRNHVSRF-CRKGLANILSGVR
NODA_AZOC5      YGVRRDLEGLGIGHSTLAMLPVLKALGVPFAFGCFRNELRIHFQRF-CRNGKGAIVDNVN
                :.:* ***   :  :   : * .  : * * ** .*  :   . *   :     :  .:.

NODA_RHILT      VRSTLPDALPDMPSTRTE-DVLVLVFPIGRPMSEWPSGSLIERNGCEL
NODA_RHILV      VRSTLPDAHSDLPATRTE-DVLVLVVPVDRPMTEWPAGSLIERNGSEL
NODA_RHIME      VRSSIAEVNADLPSTRTE-DPLVVIFPVGRPLNEWPPGTLIERNGSEL
NODA_RHIGA      VESTLADVYRDCPATRTE-DVLVVVVPVGRTMSDWPSGSLIQRRGPEL
NODA_RHIS3      VRSTLANIHPDLPPTRVE-DVIVFVAPIGRSMDEWPSGTLIDRNGPEL
NODA_MESS7      VRSSRANVHHDLPSTRLE-DVIVLVSPIGRSIDEWPPGDVIDRNGSEL
NODA_BRAEL      VRSTQADVYPNLSPIRIE-DVLVVVFPVGRSMGEWPAGTIIDRNGPEL
NODA_BRASP      VRSTQPDVYPNLSPIRIE-DVLVVVFPLERPIGEWPAGTIIDRNGPEL
NODA_BRADU      VRSTLPDVYPNLSPTRIE-DVIVVVFPVGRSISEWPAGTVIDRNGPEL
NODA_BRASN      VRSTHPDVYLNLPTTRSD-DALVLVLPIVRSIGEWPTGTVIDRNGPEL
NODA_METNO      VRSTLRDMRLDMPPTRVE-DLLILVFPIGRPMSDWPAGTIIDRNGPEL
NODA_MESPL      VRSTLRDALLDKPPTRID-DALVVVLPVGRPISDWPAGEMIDRNGAEL
NODA_RHITR      VSSTLPEARLDKPPTRID-DALVIVLPIGRSISDWPAGTVIDRNGPEL
NODA_SINTE      VRSTLPDARLDLPPTRIE-DVLVVVFPVELAMSDWPTATFIDRNGPEL
NODA_SINFN      VRSTLSDVYLNLPPTRTE-DVLVVVFPIGRPMSEWPSGTLIERNGPEL
NODA_RHIEC      VRSTLADVYLNLPPTRCE-NVILVVFPIGCSMSDWPSGTLIERNGPEL
NODA_RHILO      VRSTHPDVYLDLPPTRVDDNVLVLVLPIGRSMSEWPAGTLIDRNGPEL
NODA_AZOC5      IKSTQPDIYPDLPPTKIE-KKAAVILPLTETLDRWPEGVDIERNGPEL
                : *:  :   : .. : : .   .: *:  .:  ** .  *:*.* **