CLUSTAL format seed alignment for MF_00087

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

HEM1_ARTS2       ------------MVLFSLVATHADIDLETVAQLSTGASELATSALSGSPAVKG-------
HEM1_RENSM       ---------MNVVVLFSLVATHADIDLETVARLSAGSAAVSTSTV---------------
HEM1_CLAMS       -------------MLICLTASHHNASFEVLEKLSVAAPSVAGTLMEQNDFIAG-------
HEM1_LEIXX       -------------MLICFSSSHRTAAFDLLDQLERHAPAVATALAEHSELVTG-------
HEM12_PYRAR      ----------------MDLLSPLSAVILTYREADANALGRIGEE-MRRCIEVI-----GP
HEM12_PYRCJ      ----------------MDFLAPLSAVVLTYREVGGDALGALAEE-MRKCAEEL-----AK
HEM11_PYRAR      ----------------MDLVNGLVALSLTHKELGVDELSKVANG-VHRVC--V-----SL
HEM11_PYRCJ      -----------------MLVDKLYALSLSHKRLSVDELSEISRN-VHKTC--Y-----NV
HEM1_SULAC       ------------MVDNIIDTDNYYAIVYTYKTIGLSKLYEHYIPEKDLINIR------FS
HEM1_SULTO       ------------MSDEFIDINNYIAIVYTYKTVGISKLYEHYVKDQELLLLKG-----LI
HEM1_SACS2       ------------MSKDEELLQNYCSILFTYKTIGISNLHLYYFRETEIKSLKQ-----LI
HEM1_METS5       ------------MNPVNDIIDSYSAIVYTHKTVGVDKLASHYLGWNEIKELSK-----YY
HEM1_THEAC       -----------------MQILTLISWDFKRNNNFFNQAVLNPYEYWADILEK------NG
HEM1_THEVO       ---------------MLMNIVTLISWDFKRNNESFQRAIINGYDYWSRILDD------HG
HEM1_PICTO       --------------MIIMIPIYAITWNFRDTPEGFDKIVNNDYNYFESLCKK------SS
HEM1_PROA2       ------------MNIISVGVNHKTAPIEIRERISLS-EVQAKEFLSDIISSGI-------
HEM1_CHLT3       ------------MNLIAVGVNHNTAPIELREKISLT-DSMARSLLTELIDSKL-------
HEM12_FLAJ1      ---MENFNMPRSTTFYALGLSYKKADAVIRGKFSLD-AQAQSDLLLQAKAEG--------
HEM1_GRAFK       ---MEDYHISRGKHFYTIGLSYKKADAEIRGHFSLT-EESKQRLLEQAKEEG--------
HEM1_BACME       ------------MHIIAVGLNFRTAPVEIREKLSFN-EQELASAMKTLSGQKS-------
HEM1_BACP2       ------------MHILVVGLDYKTAPVEIREQLSFE-PSELGTAMSKLKEEKS-------
HEM1_BACCN       ------------MHILVVGVNYRTVPVEIREKLTFQ-ETELKRAMTTLQSQKS-------
HEM1_LYSSC       ------------MHTIVVGLNYKTAPVEIREKLSFI-ESELPQAMEALQKQKS-------
HEM1_GEOTN       ------------MQIIVVGVNYKTAPVEIREKLAFG-EAELGEAMKQLAKQKS-------
HEM1_OCEIH       ------------MHILKVGFNYKTTPVDIREKFTFS-EDSLQDAMVELKNQKS-------
HEM1_BACSK       ------------MHTIAIGLNYKTAPVEIREKLVFS-EHQLPEALKKLRSSKS-------
HEM1_BACHD       ------------MHILMIGLNYKTAPVEIREKFSFQ-DSELPQALHQLRQMKS-------
HEM1_PAEMA       ------------MHIVVVGLNYRTAPVEVRERFSFA-EKDMPQALQELLRTKS-------
HEM1_STAS1       ------------MHLIAVSINHRTADVALREKVAFK-DDAIRSANVDLYETKS-------
HEM1_LISW6       ------------MFILTMGLNHHTAPIDIREKLVFK-ETEEEMALITLLQEKS-------
HEM1_EXIS2       ------------MHIVVVGLNNKTAPVSIREQVSFG-EHEMKGAVVALRDEKS-------
HEM1_STRSV       ------------MHLLYVGLTHRETPLTILEKAHFS-DQEGLKALKLLKREKS-------
HEM1_LACRJ       ------------MYLMCVSLNYHQLPLDLREKFSFT-KEEVPKADKLLNDEKS-------
HEM1_SYNP2       ------------MNIVVVGLSHKTAPVEIREKLSIQ-EAKMDEAIAHLKSYPH-------
HEM1_ACAM1       ------------MNIAVVGLSHKTAPVDVREKLSIP-DDVKEKATSQLRSYPH-------
HEM1_SYNP6       ------------MHLAVVGLSHRTAPVAVREKLSIP-EQQVEAAIQQLKSYPH-------
HEM1_THEEB       ------------MNIAVIGLSHKTAPVDVREKLSVP-EDVRERALQHLCGYAH-------
HEM1_CYAPA       ------------MNIIVVGLSHKTAPVDFREKLSIP-KVRIGEAIRELCNYPH-------
HEM1_SYNJA       ------------MFIAVVGLSHRTAPVEIRERLSIP-EAEVGERIQQLRAHPH-------
HEM1_GLOVI       ------------MQIAVIGLSHRTAPVEIRERVSIA-EGQVPEYVSRLRSCSQ-------
HEM1_SYNS3       ------------MHIAVVGLSHRTAPVEVREKLSIP-EQTMEESLQNLRNHEQ-------
HEM1_SYNR3       ------------MHLAVVGLSHRTAPVEVRERLSIP-EHHLETSLQSLRSHEQ-------
HEM1_PROMP       ------------MHIVVVGLSHRTAPVEVREKLSIP-DQSISESLKTLSINSD-------
HEM1_FRASN       ------------MSLLAVGLNHRTAPTSLLELAAVS-ADDAPKVLHDLVGA-------DH
HEM1_KINRD       ------------MALMVVGLSHRTASLEVLERAAFD-ARGAEEVLRALTAS-------PH
HEM11_NOCSJ      ------------MSVLVVGISHKSAPVALLEQLALD-GPGLHKLIDDVAAS-------EH
HEM1_THEFY       ------------MSVLALGLSHRSAPVTLLERVALS-GEVRLKLMTEMVNT-------SA
HEM1_MYCA9       ------------MSVLLFGASHRSAPVPVLEKLAIG-EADQPKIIEHILQS-------PL
HEM1_RHOJR       ------------MSVLLVGVSHRTAPVPVLERVAVT-DTDRPKLTDKLLAS-------SH
HEM1_SACEN       ------------MNLLTVGLSHHSAPVRVLERVAIG-ADELGKVLHELLQR-------DH
HEM1_SALTO       ------------MKLLVVGASYRTAPVAALERLTVA-PADLSRVLTRLVAQ-------PY
HEM1_ACIC1       ------------MSLLVVGVSHRGTPLSLLERAVLD-SDQATKLLDDLVGS-------PV
HEM1_COREF       --------------MLVVGMSHRSAPVALLERLSMD-DSVRGQTTSALVER-------PS
HEM1_CORDI       ------------MSVLVVGMSHRSAPVALLEKLSMD-DGVRTNTVSDLVAR-------PS
HEM1_CORJK       ---MSGSTRTGSASVLLVGLSFRSAPVTMLEQATVA-DADLPKMQLSLVDN-------DV
HEM1_CORU7       ---MAGHVHTGSAAVLLVGLSFRSAPVSLLEQVSTV-DTDLPKLENALLDH-------DS
HEM1_ROSS1       ------------MQITLIGVHQRNTPVTVRERLAFN-LYELPDALLALRR---------Y
HEM1_HERA2       ------------MQLVVVGAHQRTAPISIRERIAFA-EAELAQALSSLRQ---------I
HEM1_CHLAA       ------------MNLFLAGLDHTTAPVEIREQLAFS-QTDLPSALMQLTSSETGTP--PL
HEM1_RHOBA       ------------MTLKMIGCSHHDAAVEIREQLSFT-ENEINRTFELFGQR-------FA
HEM11_ANADF      ---------MNGKEIFLVGLSHKSAPIEVRERVALT-GDLLKAALCELRAAES-------
HEM1_MYXXD       ------------MELICIGLSHRTAPLTVRERLALP-ESRQVDVL--QRLAQA-------
HEM12_ANADF      -------------MLVAVGLNQKGATVADREVLALP-AEGFQSTLAEYAALDA-------
HEM1_THET8       ----------MALPLYLVGLSHKTAPLEVRERAALD-PVV--ALPAALSALG--------
HEM1_DEIRA       ------MPQPAPLDFVVVGLNHQTAPVEVRERVAVR-PEEEGALLGHLARHA--------
HEM1_RUBXD       ------------MLIAVAGMSHRSAPVEARERVAFA-PCAARSFLRRLREEDG-------
HEM1_CARHZ       ------------MYLVVVGVNHRTAPVEVREKLSFS-DHQLKDAFSALLSYPS-------
HEM1_HELMO       ------------MFIFVVGLNHKSAPVEVREKLSFT-EAQLSEALHKLQGMAG-------
HEM1_DESRM       ------------MLIAVIGVNHRTAPLEVREKLAFT-EWGMKDSLKRLMSYPG-------
HEM1_PELTS       ------------MLILVVGLNHRTAPVEVREKLSFS-AKSLQGALAQLKSYPV-------
HEM1_DESAP       ------------MLITVVGLNHRTAPLAVREKLSFP-EHTLKEVLRGLSDREG-------
HEM1_MOOTA       ------------MFVVAAGLNHRTAPVAIREQLAFA-RHGLPPALCRLKEEAG-------
HEM1_DESHY       ------------MFPITIGLNHKTAPVEIREKVSFH-PSEINKALMELNELSA-------
HEM1_AKKM8       ------------MRMVCLGLNHRTAPVEIRERFAVP-SHKLREEGQRIRSLPG-------
HEM11_KORVE      ----------MEPSLVVVGLNFKTSPVAVRERFWMS-ELRRYEALHQLVRAEG-------
HEM1_DESAG       ----------MDQEIFIIGLNHRTADVEVREKFALT-GCTS-LEPAVIPLGNG-------
HEM1_LAWIP       ----------MEQHIYLIGMNHRTASIDVRECFALT-EHCS-KDDWAIPLIKG-------
HEM1_DESPS       ---------MFEKQVFLFGVNHKTTPVAVREKIAFT-DGYE-TALTRLQEEVG-------
HEM1_SYNFM       -----------MCHIILLGMNHKTAPVEMRERLAVA-CRQEVNPLRLLPRLEN-------
HEM1_SYNAS       ------------MGILLIGMSHKTSPLAVRERFSLS-CENRDHPLDRIRQMPS-------
HEM1_PELPD       ------------MNIIVVGLSHKTAPVEVRERVAFS-PNLIERPLRELVSLDD-------
HEM1_PELCD       ------------MNFLVIGLSHKTAPVELRERISFS-SDDPGGVLRAITALPG-------
HEM1_MAGMM       ------------MKLVVVGLNHKSAPVSLREKVAYS-SDTLPRSLQALTRLDA-------
HEM12_KORVE      ------------MNFFVIGVNHKTAPVEVRERFAIP-ESRLPEATKLLASYPG-------
HEM1_SOLUE       ------------MKLLITGVSHKTAPVEVRECLAFR-EETLPAALADLKACEG-------
HEM1_THEYD       ------------MSLIVIGLNHKTAPVEIREKIAFNSKEAIKEALKELIQREG-------
HEM1_SULSY       ------------MVIFSTGFNYKTAPVEIREKLAIT-ENNYGLILEKLNSIED-------
HEM1_AQUAE       -----------MGEIFVAGVNFKVAPVEVREKLACS-LEETKKVLPILKRETP-------
HEM1_NATTJ       ------------MILAVIGINHETASVETREQLAFS-SKQVKELVQKLIEGQP-------
HEM1_RHOFT       ------------MAVWTLGINHTTAPLDLRGRFAFA-LDQVEPTLRALRGSLSR------
HEM1_METPP       ------------MSVFALGLNHTTAPVDLRGRFAFT-LEQLAPTLQGFRERLTTGQRPG-
HEM1_RALSO       ------------MQLLTLGINHHTAPLSLREKVAFP-LEQLKPALGTLRQHLPHRKST--
HEM1_POLAQ       ------------MKLLTLGINHHTAPVAIREKVAFD-PEFLQEALHDLRQHLLGANQSGL
HEM1_JANMA       ------------MQLLAVGLNHTTAPVSLREKVAFP-ADQLGQAVASARSWYGRSDATTY
HEM1_BORA1       ----------MSVAVLAFGLNHTSAPVSVRERVSMP-VDLVKPALAGLRSAFGGAVRE--
HEM1_AROAE       ------------MQLYALGLNHHTAPLTIREQVAFQ-PERLDDALHDLTHERT-------
HEM1_DECAR       -------------MIFTLGINHHSAPLAIRERVAFG-ADKLPHALADLTRERP-------
HEM1_NITMU       ---------MSSTQLFAFGINHQTAPLDVREQVSFP-ADAMEHALHDLVSHRP-------
HEM1_THIDA       ------------MQLLTLGVNHHTAPLAIREQVAFG-PDKLVQALHELTLSKR-------
HEM1_METFK       ------------MHLFTVGVNHTTAPVSIRENVAFQ-NEHLSGALRDLNSHG--------
HEM1_NEIM0       ------------MQLTAVGLNHQTAPLSIREKLAFA-AACLPEAVRNLARSNA-------
HEM1_CHRVO       ------------MHLLAFGLNHHTAPLSIREKLAFP-AETLPRALESLLASQA-------
HEM1_MANSM       ------------MTILVLGINHKTASVALREKVAFS-PEKRDLAFQQIAQSEL-------
HEM1_PASMU       ------------MTILVIGINHKTASVAIREKVAFS-AEKRVEALAQIQQQAL-------
HEM1_HISS2       ------------MTILVLGINHKTASVALREKVAFS-DEKRLLALKQIKQTQL-------
HEM1_ACTP2       ------------MTILALGINHKTASVNLRSKVAFD-DQKRQLAFEQIQHRAL-------
HEM1_AERS4       ------------MSLLALGINHNTASVALRERVAFG-PDCIDRALRELVTQPG-------
HEM1_SHELP       ------------MSLVAIGINHKTATVDLREKVAFA-PDKIHEAMKSLASRTK-------
HEM1_PSYIN       ------------MPLFALGINHQTASVALREKVAFS-ADLLLDAYQALLAQPT-------
HEM1_ALISL       ------------MSLLVIGINHTSATVDLREKVAFS-PDKLTKALDELKNSDA-------
HEM1_PHOPR       ------------MTLLALGINHNTASVDLREKVAFS-PDKLKEALQQLESHPE-------
HEM1_SODGM       ------------MTLLALGINHKTAPVALRERVAFS-PETLDQALGSLLAHPL-------
HEM1_PROMH       ------------MTLLALGINHKTAPVALREKVSFS-PDTMGDALNNLLQQPA-------
HEM1_COLP3       ------------MSIVAVGINHKTAPVAVREKISFN-PDKLSIALQEMLNAVQ-------
HEM1_PSEHT       ------------MTIIALGINHKTAPVELREKVAFS-PEQISEALQQLSGHAH-------
HEM1_PSEA6       ------------MTLIAFGINHKTAPVELREKVAFS-PDAMVEALKSLAHLTG-------
HEM1_IDILO       ------------MTISALGINHKTASVDLREQVAFS-AEQLDAALQAVRNLQG-------
HEM1_ALCBS       ------------MNLVAVGVNHTTADVELRERLAFS-TQQAEVALASLREMPG-------
HEM1_CHRSD       ------------MTLLALGINHKTATIEVREQVAFT-PAELAGALAELKSLPG-------
HEM1_HAHCH       ------------MALFVISINHKTAPVAIREKVAFG-PEKLADALERLRCRPD-------
HEM1_MARHV       ------------MALVTLGINHRTAPVEIRERVAFT-PERMAEAFSELRAASG-------
HEM1_PSEU5       ------------MAFLALGINHKTASVDVRERVAFT-PDQMVEALRQLCRVTP-------
HEM1_SACD2       ------------MTLIALGINHNTASLDVREKVAFS-STQIESALRAAIAGAG-------
HEM1_MARMS       ------------MPLITVGINHKTAPVSIRERVAFA-PEKMIDALSSLISENK-------
HEM1_ALKEH       ------------MSLFALGLNHKSAPVNIREQIVFA-PDAVTAALQHLRAHTT-------
HEM1_HALHL       ------------MPLFAIGLNHDSAPVAVRESLAFN-AEALGDALQSARSETG-------
HEM1_NITOC       ------------MQLLAFGVNHKTASVAIREQITFA-PERLPSALTELVNRSG-------
HEM1_METCA       ------------MAILTLGVNHTTAPVSIRERLAFP-AEQLQSALRDLIDLPQ-------
HEM1_HYDCU       ------------MKLLVLGVNHETAPVDIREKVSFS-PAQVQNALSELKSQGL-------
HEM1_COXBR       ------------MPLLVCGINHQSAPLTVREKLVFT-PERTPLALQSLLAEKA-------
HEM1_LEGPL       ------------MVFVACGLNHKTAPIHVREKVALQ-PAMQDSLLSSLLDLPE-------
HEM1_XYLFT       ------------MTLWVLGLNHQTAPMELRERASFV-GDALPRALDSLRNLPN-------
HEM1_DICNV       ----------MHNTIYVLGFRHQTTPASVREKLAFS-PENILNTLPFLQAQCA-------
HEM1_VESOH       -----------MSQIAILSVNHQLAPVEVREKVAFT-PDKLTQALSDLHGIYG-------
HEM1_FRAP2       ------------MALISLAIDYKKSPIEVRSEFALS-GLDVSMLYKSILAIDN-------
HEM1_WIGBR       ------------MKLLVFGISYKTAPISLRERVIFS-PENINIALNNLLKKSD-------
HEM1_PSYCK       ------------MRLVVIGVNHKTAPVALRERLALV-GDEVSIALAQLQGFS--------
HEM1_PSYWF       ------------MNLVVIGVNHKTAPVALRERLAFV-GGDIQVAQAQLQQIT--------
HEM1_ACIAD       ------------MSFFALGVNHQTASVELREQVAFN-AERLKDLLAQQRNHAH-------
HEM1_METBF       -----------MTEISSMVISHKKAKIEEMESAWHGDLDGLLHNLYNHEYIH--------
HEM1_METBU       -----------MTEISSMVITHAKATVEEMEDSWHGDIDLVLSQLYSNELVY--------
HEM1_METTP       -----------MSRITSMLVTHKKASISEIENAWHGDVEALLKWVSSHDTVE--------
HEM1_METAR       -----------MAQVCSISVNHRHAGIEGIERARFRDPDVAMLRLLSLPGVS--------
HEM1_ARCFU       ------------MEIGCITISHKNAKVEEIEKIWLT-VKPRLEDVISKCSFS--------
HEM1_METKA       -----------MEDLVCVGITHKEAEVEELEKARFE-SDEAVRDIVESFGLS--------
HEM1_METVS       --------------MLVIKADYKKYPLPVLESMRIN-EDEFYGKYD--------------
HEM1_META3       --------------MLLFRADYNNYAVSELQKLRFD-EDEFYKKYD--------------
HEM1_METJA       --------------MIILKADYKKYNVSELEKLRMD-EEKFYETFD--------------
HEM1_METTM       -------------MILNIRLDHKTSDVKTMETASGR-IEEIVGELEALGAVT--------
HEM1_METS3       -------------MILNLRVDHKIANIDAMENIAKE-MDQLFLELQEKYSIV--------
HEM1_METST       -------------MLVNIRIDFKIADIETMEKSYAK-LDMINAELHEKLDIL--------
HEM1_METMJ       ------MPELFTIPLALAGISHHAADIATLEAFRFP--DEAAFLHEARERFR--------
HEM1_METB6       -------MSKHPSRFAVAGVSHHTADVLALEAFRFG--DEPAFLAAAQKKFA--------
HEM1_METHJ       ------MTHALFSPFTIAGISHHTASVADMESVRFP--DEEAFLTRAGDWFK--------
HEM1_METLZ       ------MTRTLLTDIAVATADHSKYGEEVLGLFRFK--DETAFFEKASKIFP--------
HEM1_HALMA       -------MRGDTGAIVGVCISHERASVDQLETAAADSERHAVESLLANPAVE--------
HEM1_NATPD       -------MTVETGIVVGASVSHSHASIDQIETAADGSQQTAVEELLSKEGVS--------
HEM1_HALS3       -------MNGNTGVVSGVRVSHETASLDELAAASAASTEAALDALLEQPPVE--------
HEM1_HALWD       ---------MNTGVICGVRVSHNRASVEEIELAGERDSRTIMETLLTRDGIT--------
HEM1_ALKOO       ------------MNIIMAGIDYKLAPIDVREGFSFTKAMMKQVYSNILKD--T------M
HEM1_CLOTH       ------------MNVIMAGIDYTLAPIDIREKFSFTKSTLQAVYNDLLKN--E------N
HEM11_LACP7      ----------------MLGIDHNKASIEEREIFSFTKKMAADVLLNIKEI--E------G
HEM12_LACP7      ------------MNISMVGIDYNTASIEDREHFTLTSDKQLEIAKIIKET--Y------H
HEM1_CLONN       ------------MNLAVIGINYNNTPIDIREKVSFSKSQKYKACTYLIKK---------G
HEM1_ALKMQ       ------------MKIIVFGITHKKATIDLREKVAFSQSKKQEAYSLLKES--P------F
HEM1_CLOAB       -------------MIQLLALKRD-LKVEIREKFSIIEKRIGDKDVLLKEV----------
HEM1_CLOTE       -------------MIGVLGVKTE-VKLDIREKLSIIPKRYESSLMKLKEK----------
HEM1_CLOK5       -------------MIQLIGIKSQ-CDIGIRQKFSITSEVLEGKLKYINEL----------
HEM1_CLOBB       -------------MIAVLGIKRN-TPIEIREKLTIKVNKHDEYLDKLLKY----------
HEM1_CLOB8       -------------MIGLIGIRKN-TPLEIREKFIVKSKKYNEYFGELLKE----------
HEM1_CLOP1       -------------MIGVIGVKRN-VDIAIREKLALYPKKHKKYVGELLNS----------
HEM1_CALS8       -------------MLWVIGINHK-VEVDIRQKFSLTKTKLQEKLISLKKL----------
HEM1_CAMC5       ------------MHYLNISFTYKNTDISVREKLAFDSDEKKDQILRLLKS-SK------N
HEM1_CAMFF       ------------MHYVSISFTHKNTDIGVREKLSFSDNNRRREILRLIGA-ND------S
HEM1_CAMHC       ------------MNYMSVSFTHKNTDIIVREKLSFANDVKKREILKLICS-NK------A
HEM1_CAMJD       -------------MYYCISFTYKNTDIALREKLSFSNETKKSEFLKIIST-HE------N
HEM1_NITSB       ------------MQYLVVSFSHKNTDIVTREKLALSDDNKREDVATTLLQ-NP------V
HEM1_WOLSU       ------------MHYLIVSYSHKNTDIATRERLAFDNGVRSESFLRELVA-NK------F
HEM1_HELHP       ------MQEKMEVQYMVVSFSHKNVDIATREKLSFSQE-EIVPFLQEINV-CD------S
HEM1_ARCB4       ------------MSYLVISFSHKNTDIKLREKLAFNSDEDKDRFLKLILE-ND------I
HEM1_SULDN       ------------MHYLNISFSHKNSTLDVREKLSYKDDYATKGCLSKLNS-GE------S
HEM1_SULNB       ------------MYYQIVSFSHKNCEQSMREKLAFPNDEEKATFLEQLTG-FE------F
HEM1_HELAH       -------MELETTKYFILAFTHKSMSLEMREKLAINSPAILKEFLQTIKNYCP------N
HEM1_CHLTB       MVREGEERIGNRVLLGVIGVSYRETTLQQREQVLHILQ--QAQGSFRPEVFQE-------
HEM1_CHLMU       MVREGEEHIDEEFSLGVIGVSYRETALQQREQVLQFLQ--QAQLSFYPKFPQE-------
HEM1_CHLFF       ------------MVLGVVGISYREAALKEREAVINILKTFEADTLLAQRFFGG-------
HEM1_CHLPN       ------------MVLGVVGISYREAALKERERAIQYLQSFEKNLFLAQRFLGK-------
HEM1_SALRD       ------------MRFYAVGLNHECTSLEQTETFALSAEEQEALYANLSLSADA-------
HEM1_CYTH3       ----------MISNFKSISLTYRKAPLEIRERVALNEAECKSLMLRIKDFTDT-------
HEM1_RHORT       -----------MDGYVMVGVNHQTTPMALRDRLVLDDPALAALLVRLRARGVT-------
HEM1_CUTAK       -----------------MTVDHAEQGLGVVSEAAAQ-VDGLGLALTDHPQIRG-------
HEM1_IGNH4       -MPAAARVPLFVDDLVMVGVNYKTSGKELVEKAQFPDPLAAYSAISRIPAVRE-------
HEM1_HYPBU       -------MPRLLEELTAVILTHRDAPLDVVGSFESR----VGEAYQILRGVVD-------
HEM1_AERPE       ----------MIDRLAMIGVNVKTASREHVARLEKEWEKHLDTIGYASRG----------
HEM12_NOCSJ      -----------MSRLTCLAFPGRSIPMAVLERLSVA-ARELPASVRALRAVPG-------
HEM1_CENSY       ----------MIPGLINARVTFHNSPVHALERFTFR---DVGAALEGFRAGSG-------
HEM1_THEM4       ------------MKLNLVGLGRN-TPIYILEKFDFD----EQEFFSSLKVKTT-------
HEM1_CALMQ       -----MGIDDYLSKIRALTLNHKRVSTITLSETYFN----RDEVYGKLMNYYD-------
HEM1_TROWT       -------------MLLCVSANHKKTSFTVLEQLARVSPDFASELVEAEDIDGA-------
HEM1_PARUW       ------------MRIGVIGINHKLADLKLRDALAKACQKRFGANQSVHDQHHF-------
                                                                             

HEM1_ARTS2       ---AVVLATCNRFEIYGEAPHPDDV-----------------------------------
HEM1_RENSM       -----VLATCNRFEIYSAAENP--------------------------------------
HEM1_CLAMS       ---AVVLATCNRFEAYLDVEEPLTAAR---------------------------------
HEM1_LEIXX       ---SVVLATCNRFEAYLDIDEPLPAAR---------------------------------
HEM12_PYRAR      KTPMFVLHTCHRVEAYLYGASE--------------------------------------
HEM12_PYRCJ      ATPMFVLHTCGRVEVYLYGASE--------------------------------------
HEM11_PYRAR      RQPLFVLHTCNRVEAYLYNPPD--------------------------------------
HEM11_PYRCJ      QA--FVFHTCNRVEVYLYDADA--------------------------------------
HEM1_SULAC       DTQVSLLQTCNRVELYLYTKDR--NKIN--------------------------------
HEM1_SULTO       KGEISVLQTCNRAETYLYTYNK--EEFK--------------------------------
HEM1_SACS2       NAEFAILQTCNRVEIYLYSDTNTLKEVN--------------------------------
HEM1_METS5       DGEMAVLQTCNRIEIYLFSRNE--SSVN--------------------------------
HEM1_THEAC       ISRYVILLTCNRVEIYLRA-----------------------------------------
HEM1_THEVO       VEKYVILLTCNRVELYYR------------------------------------------
HEM1_PICTO       IDEFVILITCNRVEIYAYT-----------------------------------------
HEM1_PROA2       AQEAMVLSTCNRTEL------YVVPGM---------------------------------
HEM1_CHLT3       ASEALVLSTCNRTEL------YVVPAM---------------------------------
HEM12_FLAJ1      IESLVVTSTCNRTEI------YGFAHH---------------------------------
HEM1_GRAFK       IDGILVTSTCNRTEI------YGFAQH---------------------------------
HEM1_BACME       ILENIIVSTCNRTEI------YAVVDQ---------------------------------
HEM1_BACP2       ILENIVISTCNRTEI------YAVVDQ---------------------------------
HEM1_BACCN       VLENVIVSTCNRTEI------YAVVDQ---------------------------------
HEM1_LYSSC       ILENVIVSTCNRTEI------YAVVDQ---------------------------------
HEM1_GEOTN       ILENVIVSTCNRTEI------YAVVDQ---------------------------------
HEM1_OCEIH       ILEDVIISTCNRTEI------YAVVDQ---------------------------------
HEM1_BACSK       MMECVILSTCNRTEL------YVVADQ---------------------------------
HEM1_BACHD       ILECTIVSTCNRTEL------YVVADQ---------------------------------
HEM1_PAEMA       VLEGVIIATCNRTEI------YVVVDR---------------------------------
HEM1_STAS1       ILENVILSTCNRTEV------YAVADQ---------------------------------
HEM1_LISW6       ILENVIISTCNRTEI------VAVVDQ---------------------------------
HEM1_EXIS2       IFESVIVSTCNRTEL------YVVTDQ---------------------------------
HEM1_STRSV       ILENIILSTCNRTEL------YLVVDQ---------------------------------
HEM1_LACRJ       ILENLLISTCNRTEV------YAVVDQ---------------------------------
HEM1_SYNP2       VEEVAVISTCNRLEI------YAVVQE---------------------------------
HEM1_ACAM1       LEEVAILSTCNRMEV------YVVAQE---------------------------------
HEM1_SYNP6       IEEVAILSTCNRLEI------YCVTRA---------------------------------
HEM1_THEEB       IQEATILSTCNRLEI------YIVTSD---------------------------------
HEM1_CYAPA       IEEVAILSTCNRLEI------YLLTSD---------------------------------
HEM1_SYNJA       IEEAAILSTCNRLEV------YIVTPE---------------------------------
HEM1_GLOVI       VAECAILSTCNRLEI------YTVLRD---------------------------------
HEM1_SYNS3       VLEASILSTCNRLEI------YTLVRN---------------------------------
HEM1_SYNR3       VLETSILSTCNRLEI------YSLLRH---------------------------------
HEM1_PROMP       ILEVSILSTCNRLEI------YALVKE---------------------------------
HEM1_FRASN       LSEAVLLSTCNRTEI-----YAE-VET---------------------------------
HEM1_KINRD       VEEAFVLSTCNRVEL-----YCD-VSR---------------------------------
HEM11_NOCSJ      VTEATVIATCNRLEI-----YAE-VDR---------------------------------
HEM1_THEFY       VNEAMVVSTCNRTEV-----YAD-VDQ---------------------------------
HEM1_MYCA9       VTEVMVLSTCNRVEV-----YAV-VEA---------------------------------
HEM1_RHOJR       ISEAMIVSTCNRVEI-----YAV-VDA---------------------------------
HEM1_SACEN       ICEAFVVSTCNRVEV-----YAV-AET---------------------------------
HEM1_SALTO       VSEAVLVSTCNRVEV-----YAV-VSG---------------------------------
HEM1_ACIC1       VREGMVLSTCNRVEI-----YAC-VEK---------------------------------
HEM1_COREF       LSEALIVSTCNRLEV-----YTV-TSS---------------------------------
HEM1_CORDI       LAEAMIVSTCNRLEV-----YAM-TSS---------------------------------
HEM1_CORJK       ISESLVLSTCNRMEF-----YTV-ANA---------------------------------
HEM1_CORU7       LSEALVLSTCNRMEF-----YTV-ANA---------------------------------
HEM1_ROSS1       VDEGIILSTCNRVEV-----CAV-TRN---------------------------------
HEM1_HERA2       AVEGFILSTCNRVEL-----YAL-VEE---------------------------------
HEM1_CHLAA       FAEAVILSTCNRVEL-----YGV-TNP---------------------------------
HEM1_RHOBA       DAELVLLSTCNRVEL-----YGAGSNP---------------------------------
HEM11_ANADF      VAEAFVVSTCNRVEV-----YVQADGI---------------------------------
HEM1_MYXXD       PVEALWVSTCNRVEV-----YLFAPDA---------------------------------
HEM12_ANADF      VDEIAVMSTCYRVEI-----YAATRCP---------------------------------
HEM1_THET8       -KGVVL-STCNRTEL-----YGVG------------------------------------
HEM1_DEIRA       -DEVLLLATCNRTEV-----YLAGV-----------------------------------
HEM1_RUBXD       VPEAVLLSTCNRTEL-----YVVAEAE---------------------------------
HEM1_CARHZ       IDGSVILSTCNRTEV---YVASLDV-----------------------------------
HEM1_HELMO       IEGCCILSTCNRTEI---YGASTDM-----------------------------------
HEM1_DESRM       IDGCAIVSTCNRTEI---YIAPMEL-----------------------------------
HEM1_PELTS       IEGCAILSTCNRTEI---YAATLEM-----------------------------------
HEM1_DESAP       VESCVVISTCNRTEV---YAVLSE------------------------------------
HEM1_MOOTA       VEGCVILSTCNRTEV---YIACNQE-----------------------------------
HEM1_DESHY       LNGIVLLSTCNRLEI---YAATPEV-----------------------------------
HEM1_AKKM8       VDQCVVLSTCNRMEI---YYWSNAP-----------------------------------
HEM11_KORVE      IDELVVLATCNRTEF---ILWTSDA-----------------------------------
HEM1_DESAG       ISEVIILSTCNRVEI---MVAGRGD-----------------------------------
HEM1_LAWIP       IQESLILSTCNRVEI---LAVG-DS-----------------------------------
HEM1_DESPS       CDESYLLSTCNRVEI---LVYADST-----------------------------------
HEM1_SYNFM       VDELLFLSTCNRVEF---LFTCRDR-----------------------------------
HEM1_SYNAS       IREALYLATCNRVEV---LVSAAEEA----------------------------------
HEM1_PELPD       ISEGVIVSTCNRVEI---YATTHDI-----------------------------------
HEM1_PELCD       ISEGMILSTCNRVEV---YAASGDP-----------------------------------
HEM1_MAGMM       VHEGTILSTCNRVEI---YMASRDP-----------------------------------
HEM12_KORVE      IEEGMIVSTCNRVEM---VARSVNGN----------------------------------
HEM1_SOLUE       VSEAVILSTCNRVEISLTTEDAVDPR----------------------------------
HEM1_THEYD       IGEVVIISTCNRVEIYVYTANVSDLKR---------------------------------
HEM1_SULSY       IYEICVISTCNRVEL-YGVSNDNIEK----------------------------------
HEM1_AQUAE       LEEVMLLSTCNRVEV-YAY--NFVEN----------------------------------
HEM1_NATTJ       IKEASVLSTCNRTEVHFTVNTGQIEA----------------------------------
HEM1_RHOFT       QPEAALISTCNRTEIYCAGEKPEL-----------EHTLD--------------------
HEM1_METPP       TPEAAILSTCNRTELYCAAEPQLV-----------RPALE--------------------
HEM1_RALSO       -AEAAILSTCNRTELYCATDGNLP-----------EDTAHEHAIR---------------
HEM1_POLAQ       -PEATILSTCNRTEVYCAANDANA-----------ANILHEATFD---------------
HEM1_JANMA       TDEAAILSTCNRTELYAASNLPGG-----------VNEAIDITAH---------------
HEM1_BORA1       ---AAILSTCNRTEVYCAADAAVA-----------EQLPI--------------------
HEM1_AROAE       VREAAILSTCNRTELYFATEQP-------------QHAAD--------------------
HEM1_DECAR       VREVAILSTCNRTEIYCSAESP-------------DVVID--------------------
HEM1_NITMU       VREAAIVSTCNRTEIYCSTDKP-------------DEATH--------------------
HEM1_THIDA       ASEAAILSTCNRTELYVNTVSP-------------DALSQ--------------------
HEM1_METFK       IREAAILSTCNRTELYCNTDDP-------------QKALE--------------------
HEM1_NEIM0       ATEAVILSTCNRTELYCVG-DS-------------EEIIR--------------------
HEM1_CHRVO       AREAAIVSTCNRTEIYCSSPDP-------------HAALD--------------------
HEM1_MANSM       AQSEVILSTCNRTEIYLHNKHISPEA-DQENQRWLEQCIQ--------------------
HEM1_PASMU       AESAVILSTCNRTEVYFHHKAIPP----QEAESWTARCMQ--------------------
HEM1_HISS2       AECAVILSTCNRTEVYLHNKNVGP----QNDEVWLDSCVQ--------------------
HEM1_ACTP2       AESVVILSTCNRTELYFHNAEITPREEHEDNIAWREQCFE--------------------
HEM1_AERS4       VSEAVIVSTCNRTELYCSLEKGQ-----------GEQVLH--------------------
HEM1_SHELP       TGEAVIVSTCNRTELYCNT--GD-----------EADVIS--------------------
HEM1_PSYIN       VLEAVIVSTCNRTEIYCHLKQDN-----------CDEVIK--------------------
HEM1_ALISL       IKSGVILSTCNRTEIYCEVKLGI----------SSGYVIN--------------------
HEM1_PHOPR       VTSSIIVSTCNRTEVYCDVTHS-----------GPGVMID--------------------
HEM1_SODGM       VQGGVVLSTCNRTELYLSVEQQA---------DLQEALVR--------------------
HEM1_PROMH       VRGGVVLSTCNRTELYLSLEDKE---------NSHEQLIS--------------------
HEM1_COLP3       CREVAILSTCNRTELYLVQDGDFD--------VTQQRLIK--------------------
HEM1_PSEHT       FNEAVIVSTCNRTEVYCSLAQ-----------QNSQTLLQ--------------------
HEM1_PSEA6       ADESVIVSTCNRTEIYAQAEN-----------LTADALTT--------------------
HEM1_IDILO       VEEAVIVSTCNRTELYCRGEVSG------------DLLLG--------------------
HEM1_ALCBS       VREAALLSTCNRTELYCLTDDV------------TPNFAQ--------------------
HEM1_CHRSD       VNEAAVLSTCNRTELYCVTDSQG-----------EREVLD--------------------
HEM1_HAHCH       IDEVTILSTCNRTELYCATPGEP----------DEISLIE--------------------
HEM1_MARHV       ASEAAILSTCNRTELYLAGDDD-----------CAPSVLR--------------------
HEM1_PSEU5       TREAAILSTCNRSELYLQ-QDEV----------EAEAVLA--------------------
HEM1_SACD2       LSEVAILSTCNRTELYAYGSSQ------------ANSLIQ--------------------
HEM1_MARMS       ANEAVIVSTCNRTELYCSVEDLS----------KVDDVIA--------------------
HEM1_ALKEH       AREAAILSTCNRTELYVRMDDR-----------APEMLGE--------------------
HEM1_HALHL       ADEVAILSTCNRTEIYIRLPHT-----------DPEVVIG--------------------
HEM1_NITOC       AKEAAILSTCNRTELYCGCAPG-----------QQEAVIE--------------------
HEM1_METCA       VGEAAILSTCNRTEVYCELDGR-----------DQRPIVD--------------------
HEM1_HYDCU       ANESVILSTCNRTEIYTTLKSQ-----------SPEKIRA--------------------
HEM1_COXBR       VNEALLLSTCNRTEIYTTVDEA-------------ATILR--------------------
HEM1_LEGPL       VNEAAILSTCNRTEIYCDTNTP-------------EVLGN--------------------
HEM1_XYLFT       VNEAALLSTCNRTELYAETTNA-------------QMLLN--------------------
HEM1_DICNV       GAEILLLSTCNRSEWYFASNTP-------------PRLEE--------------------
HEM1_VESOH       IYACIILSTCNRVEIYVNSDNENP----------KEVLSN--------------------
HEM1_FRAP2       VVHAVILSTCNRTEVYLEITDLR-------------VVDDILAWW---------------
HEM1_WIGBR       ILGGVILSTCNRTEVYLSIKNFY-------------KAKKIIILW---------------
HEM1_PSYCK       -DGSVIVSTCNRTEIYALVPESILSP--------HTLLPNSASAVVETSVIESSMTANNS
HEM1_PSYWF       -AGSLIISTCNRTEIYALAPST-------------QLLANSDAALSKQSDLSLADEPVST
HEM1_ACIAD       LNDMVVVSTCNRTEVYAMTEHA-------------DILLN--------------------
HEM1_METBF       --ECVVLKTCNRVEIYVVSP-SS-------------------------------------
HEM1_METBU       --ECAVLKTCNRVEIYVVSSKGS-------------------------------------
HEM1_METTP       --ECAVLKTCNRVEIYVVSPRGE-------------------------------------
HEM1_METAR       --EAVVLQTCNRVEIYAVAE-SV-------------------------------------
HEM1_ARCFU       --EYAYIFTCNRFEIYLVGENLK-------------------------------------
HEM1_METKA       --GCVLLQTCNRVEVYASGA----------------------------------------
HEM1_METVS       --ACIIVQTCNRIEAYFD------------------------------------------
HEM1_META3       --NCVLVQTCNRIEIYFD------------------------------------------
HEM1_METJA       --NAILLQTCNRVEIIFDAD--S-------------------------------------
HEM1_METTM       --EKVPLMTCNRVEYYLH------------------------------------------
HEM1_METS3       --EYVEISTCNRKEYYIH------------------------------------------
HEM1_METST       --EEVTLKTCNRYEIYLL------------------------------------------
HEM1_METMJ       --GVLLLQTCNRIEVLVQGDARS-------------------------------------
HEM1_METB6       --GALLLQTCNRVEVIVEGDAAS-------------------------------------
HEM1_METHJ       --GVILLQTCNRIEIMVHGNADL-------------------------------------
HEM1_METLZ       --GVVLLETCNRVEILVHGSAKQ-------------------------------------
HEM1_HALMA       --EAIALQTCNRTEGYVVVSDHE-------------------------------------
HEM1_NATPD       --EAFVLQTCNRAEAYVVANDSE-------------------------------------
HEM1_HALS3       --EAFVLQTCHRVEAYVVTADQA-------------------------------------
HEM1_HALWD       --ESFAIQTCNRSEAYVVADGAV-------------------------------------
HEM1_ALKOO       IYGTVIISTCNRTEIYISCEEDFCV-----------------------------------
HEM1_CLOTH       IFGAVIVSTCNRTELYLSCEEGLYI-----------------------------------
HEM11_LACP7      INGCIILSTCNRMEVWVSCFEEFET-----------------------------------
HEM12_LACP7      ASGCIILSTCNRTEIWFSELGTSEA-----------------------------------
HEM1_CLONN       ISEIIIVSTCNRSEIYICSDEIDSHI----------------------------------
HEM1_ALKMQ       IHEAVILSTCNRSEVFAVVQDTSIAR----------------------------------
HEM1_CLOAB       CNEVVILSTCNRIEIYFNSEKN--R-----------------------------------
HEM1_CLOTE       CDEVVILSTCNRTEVYYSYKKH--N-----------------------------------
HEM1_CLOK5       VGSVLILSTCNRTEIYVDSNLE--E-----------------------------------
HEM1_CLOBB       LEGVVILATCNRTEIYFNVSSI--N-----------------------------------
HEM1_CLOB8       LNEVVILATCNRTEIYFNASLN--E-----------------------------------
HEM1_CLOP1       FKEVVILNTCNRTEIYFNCTEEISE-----------------------------------
HEM1_CALS8       ADEVIILSTCNRTEIYFFSEEY--------------------------------------
HEM1_CAMC5       IIECMVLSTCNRVEVLAYTNDIKSAMTH--------------------------------
HEM1_CAMFF       IAESMALSTCNRVEIFAYVLDTQSSIRH--------------------------------
HEM1_CAMHC       IKECLVLSTCNRVEVLAYIDDFNYTSDY--------------------------------
HEM1_CAMJD       IEECLVISTCNRVEIVAFVK--MACAEF--------------------------------
HEM1_NITSB       INEAIILSTCNRIEIILSVKDPFSATEA--------------------------------
HEM1_WOLSU       INEGILLSTCNRVEFILSVKEAHKAGDF--------------------------------
HEM1_HELHP       IRESILLCTCNRVELYVSMIDKKRAREH--------------------------------
HEM1_ARCB4       TKEAILLSTCNRVEIITRSLNIKQSSKD--------------------------------
HEM1_SULDN       INESILISTCNRMEVFCSCSDIASATKH--------------------------------
HEM1_SULNB       VHEAFIISTCNRVEIVMATRDNFSSYHA--------------------------------
HEM1_HELAH       IKECMVLSTCNRFEIYASLKHNTHADEQK-------------------------------
HEM1_CHLTB       ERDYVLLATCHRVELYSVA-----------------------------------------
HEM1_CHLMU       EGRSVLLSTCHRVELYGMA-----------------------------------------
HEM1_CHLFF       DGSFVLLLTCHRAEIYYFSK----------------------------------------
HEM1_CHLPN       GGAFIPLLTCHRAELYYYSE----------------------------------------
HEM1_SALRD       --EVVVLSTCNRTEAYLYGTEADLRQV---------------------------------
HEM1_CYTH3       -AELLILSTCNRTEIYYTSNEDYSNDI---------------------------------
HEM1_RHORT       --EALALSTCDRVEIFGHGGDPRALRA---------------------------------
HEM1_CUTAK       ---ALVLSTCNRVCLIVETSPEAVAQGF--------------------------------
HEM1_IGNH4       ---VVLLQTCNRVEVYAITTNKKATVE---------------------------------
HEM1_HYPBU       --EAVVLATCNRFEVYALPRRG--------------------------------------
HEM1_AERPE       ---TVIIATCNRFEVYLDSPSR--------------------------------------
HEM12_NOCSJ      VDQVLVLSTCERTEVYAWWTDEADPAA---------------------------------
HEM1_CENSY       LDECVIVQTCNRVELFGASASPDMGSI---------------------------------
HEM1_THEM4       --EVAVLKTCHRREIYYIG-----------------------------------------
HEM1_CALMQ       --EVFLLQTCNRVEVYVYGDDDS-------------------------------------
HEM1_TROWT       ----AILSTCNRFEVYIDAIQKGDQDD---------------------------------
HEM1_PARUW       ----ILLSTCNRTEVYFSSHDLTATHS---------------------------------
                         ** *                                                

HEM1_ARTS2       --------EAARAALVAQISERTGLNEQLVSRSFNTRTGGEVSQHLFAVSSGLDSAVVGE
HEM1_RENSM       --------ATARAEMEAALAHATGFAPSLVSSSFKLLTGTDVAKHLFAVASGLDSAVVGE
HEM1_CLAMS       --------ALAVEATVDVVSGASGIARDDVRGSVDVKCGDAVAEHLFAVSSGLESVVVGE
HEM1_LEIXX       --------AVSAETVIAAVGNAAGIDADLLRSSSRVYCDDAAAEHLLSVSSGLDSVVVGE
HEM12_PYRAR      -----------------EELSSLVERYKRHVESARILRGIEAARHLFRVAAGLESMLLGE
HEM12_PYRCJ      -----------------EEVARVAARYRRFAEGVKVLRGAEAARHLFAVAAGLDSMLIGE
HEM11_PYRAR      -----------------EVVEIVKSGYAPYVEKVVERRGVDAARHLFRVAAGLESMLIGE
HEM11_PYRCJ      -----------------GPAEHIKRSYGPYVEKVAEFRGVEAARHLFRVAAGLESMLIGE
HEM1_SULAC       ----------------DILSKLNETHGKDISSNAIVLRGKDAINHLYQVASGLDSLAIGE
HEM1_SULTO       ----------------DFLQKLDEIHGKQISKDAMILKGEDAVKHLFEVASGLDSLAIGE
HEM1_SACS2       ----------------KIIQYLNNIHNEPIGNQARVLCGKDAAKHLFLVASGADSLSIGE
HEM1_METS5       ----------------EILHYLNEVHNKVISTDATILRGEEAIKHLFEVASGIDSLSVGE
HEM1_THEAC       ----------------------GFPEDLEAMKPNVLHD-EEAIKHLMEVSSGLDSMSLGE
HEM1_THEVO       ----------------------GDPFDVQEKGYNIISD-DMAINHLFHVAAGLDSMSIGE
HEM1_PICTO       ----------------------RNEIDKDLFKDSLIYNYPESTMHLLRVASGLESMSIGE
HEM1_PROA2       -------SEVTGHYLKEYLISYKNAEKEVRPEHFFNRFYCNTARHLFEVSSATDSLVLGE
HEM1_CHLT3       -------PEVTANYLKDYLIAHKGVRKEVTRDHFFNYFACGAARHFYNVACAIDSLILGE
HEM12_FLAJ1      -------P----YELIKLLCENSNGSIEEFQQAAYIYKNEEAVSHMFRVGTGLDSQILGD
HEM1_GRAFK       -------P----FQLIKLLCEHTHGTVEEFEKVAYVYKNKQAITHIFKVGTGLDSQILGD
HEM1_BACME       -------LHTGRYYVKAFLAEWFGIDKEEFSPYLTIYENDGAIEHLYRVACGLDSMVIGE
HEM1_BACP2       -------LHTGRFYIKRFLADWFGLEKEDVSPYLKFYENDGAVEHLFRVACGLDSMVIGE
HEM1_BACCN       -------LHTGRYYIKKFLADWFQLEIEEISPYLSIFEQDGAIEHLFRVTCGLDSMVVGE
HEM1_LYSSC       -------LHTGRHFVKQFLADWFDLPVETFSSYLTIREEDEAVEHLFKVTAGIDSMVLGE
HEM1_GEOTN       -------LHTGRYYIKAFLAEWFDIEAEAIAPYLRVLEGEAAAGHLFRVAAGLDSMVLGE
HEM1_OCEIH       -------LHTGRYYIKQFLSNWFGIEKEEFSTYLRITEDDGAMEHLFRVSTGLDSMVLGE
HEM1_BACSK       -------LHTGRYFAKAFLAEWFSVDMEDVTPYLVIRENDHAIEHLFRVACGLDSMVIGE
HEM1_BACHD       -------LHTGRHFTKTFLADWFKLPKDEFTPFLTIRENDHAIEHLFRVVTGLDSMILGE
HEM1_PAEMA       -------LHMCGYFIRSFMERWFGVPREEFTRHLYMYEDEQAVRHLFRVACGLDSMVLGE
HEM1_STAS1       -------IHTGRYYIQRFLARSFGLDVEDIKNMTEVKVGDEAVKHLLQVTSGLDSVVLGE
HEM1_LISW6       -------IHTGRYYLKRFMANWFQMDMEKIEPYLFFHEEKEAVNHLYKVTAGLDSLVLGE
HEM1_EXIS2       -------PHTGRYYTKRFLANWFGLTMEELEPYLFIHEGFDAMKHLFRVTSGLDSMIVGE
HEM1_STRSV       -------LHTGRYYSKHFLADWFQIPVKELEEYLVFREGDEALRHLLRVSIGLESKIVGE
HEM1_LACRJ       -------IHTGRYYIRRFLAEWFHYTIDDFTKFVTVTTKDAVAEHLFKVITGLDSLIKGE
HEM1_SYNP2       -------TEQGVREICQFLAETGQLQLNRLRRYLFTLLHQDAIRHLLRVAAGLESLVLGE
HEM1_ACAM1       -------TDDGIRELTQFLSEWSQIPLLELRQHLFILLHQDAVMHLMRVSAGLDSLVLGE
HEM1_SYNP6       -------TEPGVREITQFLSEHSHLPLGELRPHLFVLLHQDAVMHLMRVAAGLDSLVLGE
HEM1_THEEB       -------TEVGVREVHQFLSEWSHIPLPQLRPYLFILLHQDAVMHLMRVASGLDSLVIGE
HEM1_CYAPA       -------TYQGIREATQFLADSSDLSLPELRQHLFILLHQDAVMHLMRVTAGLDSLIIGE
HEM1_SYNJA       -------MESGVRQTMQFLAEAKGIPLPQLRPHLFTLLYQDAVTHLMRVAAGLDSLVLGE
HEM1_GLOVI       -------SEHGLREVTRFLAESKGVLLPTLQRHLFVLLHQDAVMHLMRVAAGLDSIVLGE
HEM1_SYNS3       -------PDLGIAAVRDFLSGHSGLESRDLSPHLFTYHHDEAIAHLMRVTAGLDSLVLGE
HEM1_SYNR3       -------PEDGVEAIRDFLANHSGLADPDLQPHLFALHHEEAIQHLLRVSAGLDSLVLGE
HEM1_PROMP       -------INIGISSIKEFLTDYSSVNFEDLNPHLFDFRQEEAVLHLMKVSAGLDSLVLGE
HEM1_FRASN       -------FHGGLADISDQLSRVCGVPLTDLASHLYVHHEARAVSHLFSVVCGLDSMLVGE
HEM1_KINRD       -------FHGGVADIGDVLCRRIGRGLDELGDQLYVHYEDAGVEHLFKVACGLDSMAVGE
HEM11_NOCSJ      -------FHGSVEEVSRLVVDRAGERTEAMLPHLYVHYDDGAVSHLFQVVAGLDSMAVGE
HEM1_THEFY       -------FHPGVAAICELLSQYTGVSQEELTQHCYVHYEERAVQHLFSVACGLDSMVVGE
HEM1_MYCA9       -------FHGGLTVIGEAIARHAGMGMNELTKYAYVRYSEAAVEHLFAVASGLDSMVVGE
HEM1_RHOJR       -------FHGALAEVGELLADHSGLDLTDLHRHAYVRYSEAAAEHLFAVASGLDSMVIGE
HEM1_SACEN       -------FHGGLEDVTSVLARHSGSDVAELTDHMYVFYAGAAVEHLFSVAAGLDSMVVGE
HEM1_SALTO       -------FHGGLGDICAVLAESTGCQPAALADHLYVHFDAAAVNHVFRVAVGLDSMVVGE
HEM1_ACIC1       -------FHPALTLISELLSRHGNVNFDEIAGHVHVHYDDRAVQHLFAVAAGLDSMLIGE
HEM1_COREF       -------FHTGVNDVVEVLHEISGVDIETLRGYLYVRYADAAAEHMLVVASGLDSMVVGE
HEM1_CORDI       -------FHTGVNDVVEVLHDMSGVDMEELRGYLYVRYADAAAEHMMEVTSGLDSMVVGE
HEM1_CORJK       -------FHSGLDHVVDTIAQFSGLQTAELEPHLYVHYADSAAEHMLKVASGLDSMVIGE
HEM1_CORU7       -------FHPGLDHIVDTIATYSGLDDSELEPHLYVHYSDAAVEHMLNVASGLDSMVLGE
HEM1_ROSS1       -------GVAGDEALKTFLVEQRGVDQALFAPSLYVYHNEAVVRHLYRLAAGLDSMVLGE
HEM1_HERA2       -------ADGG-RSLRQFLAQQRSIDLDELMPHVYTYLDEDAVRHLFRVASGLDSMALGE
HEM1_CHLAA       -------GTTA-QHVVDFLAAFHRRPAASFVHTLYFYQGEAVARHLCATAAGLRSLVLGE
HEM1_RHOBA       -------ASLQSDDLIDLVADCLNQSRDFVANHMIIREGREAVEHLFLVAASLDSMVVGE
HEM11_ANADF      -------EPARR-----FFTERAPDAD----EHLYAKIGVEAIRHLFRVSASLDSMVVGE
HEM1_MYXXD       -------AMARQRALMELQVLGGVEAL----EHLYEHQGEAALVHLFRVACSLDSMVLGE
HEM12_ANADF      -------AAATLSLRQALNARAGREL------PLFELHGEEAYRHLVRVASSLESAILGE
HEM1_THET8       ---------SPEKARAFLLSRGVAP------RHLYVKEGVEALRHLYRVAAGLDSLVVGE
HEM1_DEIRA       ---------HGDPLAAFEGAWGHALL-----DHLYVYRGEAAVRHLYRVTAGLDSLVIGE
HEM1_RUBXD       -------PARDRLLGLLAEDRGVEPGSL--YRDTYWHTDAEAVRHLYRVSASLDSMVVGE
HEM1_CARHZ       --------DTGLKVVREFLANWAGLSLSDIKNYTYNYTLYDAVHHLFRVASGLDSMILGE
HEM1_HELMO       --------EKGMTAVKRFVLEWGQLQPQDFSKYFYVHTLYDAIRHLFRVASGLDSMVLGE
HEM1_DESRM       --------DSGMSSVWSFLSEKSGLDISEIKNFTFCHTLYDAIRHLFRVVSGLDSMILGE
HEM1_PELTS       --------DDGLNAIWDFLSRWSGVGISEIKNFTYSHTLYDTIRHLFRVAAGLDSMILGE
HEM1_DESAP       --------EDGLQNIWCFLAERCGSPVEAIKSHTYNYSFGESVRHLFRVSSGLDSMVLGE
HEM1_MOOTA       --------EAGLKAAKNFLGRSCKLALADLEGYLYTLNTHHAVRHLFRVAAGLDSMILGE
HEM1_DESHY       --------ELGVSVIKKFLARHGKLREEDINQYLYVHTLYDSVRHLFRVVAGLDSMVMGE
HEM1_AKKM8       --------ENAQEHILSHFLG-DGRGELDMASYFYSHQGEDALGHLCRVLSGLDSMVLGE
HEM11_KORVE      --------GEAADSVLRFLTHEYGLKMSDWSHFYRLMD-DVALNHIFRVASSLDSMVIGE
HEM1_DESAG       ---------DVPDTVLSLWANARGQHPEELRPYVYIHRGLAAVEHLFTVASSLDSMVLGE
HEM1_LAWIP       ---------NTPEIILSAWAKVKTRSIEELVPHTYTYQGRSAISHLFCVASSLDSMVLGE
HEM1_DESPS       ---------RDIEAEVSRFLFAGKVPEEDCRDYLYALKGLPAVQHLFTVAASLDSMVVGE
HEM1_SYNFM       -------DGGLREVTALLRTYLGLDSTEGVENHVYAFRGMEAVRHVFRVASSLDSMVVGE
HEM1_SYNAS       -------EQAVEEGLKALMAERGGISGQELERCLYTLSGAEAVRHLFRVASSLDSLVMGE
HEM1_PELPD       --------AGGTARIKRFLADHHRIPLESLEQYLYSYHSEAAIRHVFRVASSLDSMVVGE
HEM1_PELCD       --------AGGCACLQRFMAEHHGLDEAQLKPHLYIHSGRDAIRHLFRVASSLDSMILGE
HEM1_MAGMM       --------DAAAAQTSQWIARDHALDPADVTPHLYTKAESEAVRHGFCVASSLDSMVLGE
HEM12_KORVE      ------------ADMRGFLKQLYNIDPAQYEQYLYEYRSTEAVRHMFRVASSLDSMVVGE
HEM1_SOLUE       ------------EIVDNFLSRHKAVSSASIGPHLYRHEGRDAIHHLFRVAASLDSMVVGE
HEM1_THEYD       -------ENQVEETIKAFLSNFHNIEIGEFENYLYVYKDTEAVEHLFKVASSLDSMIVGE
HEM1_SULSY       ----------VKEEILRILSQYSTVPVNTLKDYLFFYTNKEAIRHIFRVSSSLDSMVIGE
HEM1_AQUAE       ----------SEDLINKLLEIKRLNP--SFKRYFFVKRGEEAVYHIFKVASSLDSMVIGE
HEM1_NATTJ       ----------GKNHIMTYLSDFSDLDPREYVDHLYFITDQEAVSHIFKVTAGLNSLVTGE
HEM1_RHOFT       -----------------WLAQTGGVSSSLLRTHSYTLQDDLAARHAFRVASGLDSMVLGE
HEM1_METPP       -----------------WLAGVGGVGADTLSHHAYMLEGGEAARHAFRVASGLDSMVLGE
HEM1_RALSO       -----------------WLAHHHNIDAGELAPHVYALGQSQAVRHAFRVASGLDSMVLGE
HEM1_POLAQ       -----------------WLAKTQQLAPSSLQPHIYSLPQSDAVRHAFRVACGLDSMVIGE
HEM1_JANMA       -----------------FLADYHKLPYAELRPYLYALPQDNAVRHAFRVASGLDSMVLGE
HEM1_BORA1       -----------------WLADHHCMEAGSLHPHLYRLHQNDAVRHAFRVASGLDSMVLGE
HEM1_AROAE       -----------------WLARFHHMPLSEVSPYLYTYPQRDAIRHVFRVASGLDSMVLGE
HEM1_DECAR       -----------------WLAHYHQVGREEIAPYIYTHDQPEAIRHAFRVASGLDSMVIGE
HEM1_NITMU       -----------------WLADFHRLPTRELEPYLYRLPREKAVKHAFRVASGLDSMVLGE
HEM1_THIDA       -----------------WFADFHHLDVRELAPYLYTLPREKAAQHAFRVAAGLDSMVLGE
HEM1_METFK       -----------------WLANYHRLKPQAIAPYMYTLPQENAVKHAFRVASGLDSMVLGE
HEM1_NEIM0       -----------------WLADYHSLPIEEISPYLYTLGMQETVRHAFRVACGLDSMVLGE
HEM1_CHRVO       -----------------WLCQFHGLSRAELEPYLYRLEASQAARHAFRVASGLDSMVLGE
HEM1_MANSM       -----------------WFADVHQLDVDELRNCLYIKQNQSAVNHLMRVSCGLDSLVLGE
HEM1_PASMU       -----------------WFAEIHQLSLDALAGCLYSQQNQQAVLHLMRVACGLDSLVLGE
HEM1_HISS2       -----------------WFADIHQVDLEELKSCLYSQQNLQASRHLMRVASGLDSLILGE
HEM1_ACTP2       -----------------WFAEIHQLEHNELRECIYFKQNMESARHLMRVACGLDSLILGE
HEM1_AERS4       -----------------WLQRFHGLDAAEVVSAIYQHQDEEAVRHLMRVACGLDSLVLGE
HEM1_SHELP       -----------------WLESYHQLSHDDVLPCLYKYQGQQVVQHLMRVSSGLDSLILGE
HEM1_PSYIN       -----------------WLCSFHQIEDHKLRPSLYCYSEYQAIQHLFRVSCGLDSLVLGE
HEM1_ALISL       -----------------WLAEFHHVALDLLMPSIYIYEEQAAVKHLMRVSCGLDSLVLGE
HEM1_PHOPR       -----------------WLAKFHRLSAEEILPSLYFHEEQAAARHLMRVACGLDSLVLGE
HEM1_SODGM       -----------------WLCDYHQLEPDEVRQSLYWHLGDEAVSHLMRVASGLDSLVLGE
HEM1_PROMH       -----------------WLCQYHQIEPHELKNSVYWHQDNQAVSHLMRVASGLDSLVLGE
HEM1_COLP3       -----------------WLESFHNVPASTILPSLYWHKDQQAVNHMMRVACGLDSLVLGE
HEM1_PSEHT       -----------------WLSSFHGLDEHELSKNIYCHEGSDAINHLMRVACGLDSLVLGE
HEM1_PSEA6       -----------------WLAEFHQAKADELGLNSYIYHQEDAIKHIMRVACGLDSLILGE
HEM1_IDILO       -----------------WLTGFHKLAPNALENHHYHFQGEQAITHLMSVASGLDSLVLGE
HEM1_ALCBS       -----------------WLASSRNLSVERLSTVLYQHTGEQALEHMMRVAGGLDSLVLGE
HEM1_CHRSD       -----------------WLGRFHALPPETLMQSAYHYLDGEAARHLMRVAAGLDSMVLGE
HEM1_HAHCH       -----------------WLGQYHQVSLTELKACCNIYNDEDAAQHMMRVASGIDSMVLGE
HEM1_MARHV       -----------------WLAGFHELDVADLENVLYVHRDSDAVRHMMRVAAGLDSMVLGE
HEM1_PSEU5       -----------------WLASYHRLSLDELKACAYVHVDDQAVRHMMRVASGLDSLVLGE
HEM1_SACD2       -----------------WLAEYKQVNVAELEQSHYLYTASEAASHMMKVASGLDSLVLGE
HEM1_MARMS       -----------------WLGKYHGIALPELQQYCYTHADDDSVRHVMRVASGLDSLILGE
HEM1_ALKEH       -----------------WLARYHRLDPEWLRDYLYLHEGAGAVRHLMRVSAGLDSLVLGE
HEM1_HALHL       -----------------WLTRHQRVDLRKVRPHLYVRRSTEAMRHLMRVSAGLDSLVLGE
HEM1_NITOC       -----------------WLRQYHGMEPKILETCLYTHPDHSAVRHLLRVASGLDSMVLGE
HEM1_METCA       -----------------WMCDQRQFDDQDISQYLYSHFDAGTIRHMFRVACGLDSMILGE
HEM1_HYDCU       -----------------WLHEYFELEEDSINSFLYEYADIEAIKHMMRVSSGLNSLVLGE
HEM1_COXBR       -----------------WLSKQPQLSGIDLRSFCYARRDIEMVRHVMRVGSGLDSMVLGE
HEM1_LEGPL       -----------------WLAHEHQLSEELLSQFLYIHQGKEGIKHTLRVASGLDSMMIGE
HEM1_XYLFT       -----------------WLEQHRPG----LQNHLYQYRDAAAVRHLFRVATGLDSMVLGE
HEM1_DICNV       -----------------WLYQHTAISSEELKRHLFIYTDREAVQHLYRVACGLDSLILGE
HEM1_VESOH       -----------------YLAKIHNITRDRINPYLNYFEDNEALTHVCNVATGLDSLVLGE
HEM1_FRAP2       -----------------QSYVRN--PEFKIRDYFKLRQGTEVIMHLMKLACGLESMVLGE
HEM1_WIGBR       -----------------LYKFFNDLKIKEIKNNFYSYIDNYAVSHLMRVTSGLDSMILGE
HEM1_PSYCK       ANLSSTIISAHILKIKTWLAGFKQLSLDEIDPYLYVHRNTHALTHWLRVAAGLDSMILGE
HEM1_PSYWF       VDLTEQLI--------TWLADFKQVPLEETRPYLYDYVDGQALTHMLRVAAGLDSMILGE
HEM1_ACIAD       -----------------WLAQTNGIDIKQLLHHVYRYEDAQAVTHLMRVASGLDSLMLGE
HEM1_METBF       ----------------SILFSFAKEMG-ASTHIIDFYGHDESLEHLLRLAGGLESMIVGE
HEM1_METBU       ----------------SVLFHYAKEMG-VSAKIVEFYDHDESLRHLLRLACGLESMIIGE
HEM1_METTP       ----------------KVLFEIAKKAR-VSSRIIDIHDHDESLLHLLRLASGLESMIIGE
HEM1_METAR       ----------------EDIVGFARAEG-MPLEIAEVRAGDDCLKGLLRLACGLESMIVGE
HEM1_ARCFU       ----------------SCLQDIAEELG--ITGKAEIFVGESCLRHLLRVASGIESMIVGE
HEM1_METKA       -------------------RDRAEELGDLIHDDAWVKRGSEAVRHLFRVACGLESMMVGE
HEM1_METVS       -----------------EEINDIEKI-IPDFKGFDVIKGKKATLHFLNVACGMDSMILGE
HEM1_META3       -----------------KNAKIID---INEFAEFEMIKSNNAIKHLLRTASGLNSMIVGE
HEM1_METJA       ----------------LEEIKGIE---NIDLEKFDILFGDKAIEHLFRVACGLESMIVGE
HEM1_METTM       ----------------VTGVPPE-----FDFNGFTVEKDEDALLHLLRLASGLESMIIGE
HEM1_METS3       ----------------NDNIDASDSLLSHENKSIIIDYGDSVIKHLFRMTSGLESMIVGE
HEM1_METST       ----------------IDEEVNI------PTTTFIVEKNDMAINHLLRLASGLESMIMGE
HEM1_METMJ       ----------------LEGFLQEK-----GRHGFTVIEGEAVPRHLLELAAGIDSLIVGE
HEM1_METB6       ----------------LRDFLESQ-----ERKGFFLLEGREALRHLFSLAAGIDSMIVGE
HEM1_METHJ       ----------------LGTFLESE-----GRAGWQMWKDADALSHLLDLAAGLDSMVIGE
HEM1_METLZ       ----------------LRDFLHGE-----QRFGFDILEGEAALMHLLELAAGTKSMIIGE
HEM1_HALMA       ----------------DGLEALELFTRAVPDDVVVEMGHEESLRHLLRVAAGLESIVLGE
HEM1_NATPD       ----------------TGTAALAGYLAGVDDDAIRMLSHNQSLKHLMAVACGLESLVIGE
HEM1_HALS3       ----------------SGRRALGGAGFNPAGGGAISMGHEDSLRHLLRVAAGLESLVVGE
HEM1_HALWD       ----------------AGRRALASFAPDVRDGAVVDMSHEESLRHLLRVATGLESLVLGE
HEM1_ALKOO       -------------NPFEVLCNAAGIDFTPYEKVHRVKEGDEVIKHLCQLACGVKSQIWGE
HEM1_CLOTH       -------------NPFELLCDAANFDYEEYSNMHVLRTGVDVIRHLCELACGVKSQIWGE
HEM11_LACP7      -------------SIYEILCSIKKVDDNRYRHCFIERGGYDAIEHLFYMTCGLKSKIIGE
HEM12_LACP7      -------------ECFHQLVLGENAK-ETMRSICVCRQGDEAVTYLMELGCGIHSQIFGE
HEM1_CLONN       ------------NEVVNFYKIFFNVE--SVNEYIFIKKDKEAVSHIYNVSAGLDSMILGE
HEM1_ALKMQ       ------------RWFKRFYTDFFQLKETALEGCNHFEKGREAVQYLYHVCVGVDSLVIGE
HEM1_CLOAB       ------------KQIIEEIFSKMGWNINFLENFFYCK-GDEAINHLMEVACGFDSLILGE
HEM1_CLOTE       ------------ENIISHIFKCLNWDENYKKYTFHYK-DDEAINHLMRVICGFDSLILGE
HEM1_CLOK5       ------------KKLIDTVFYGLDWDYDLVSYIFYIK-DKYAIKHLMEVSCGFHSKILGE
HEM1_CLOBB       ------------EELLKKIFEIFNWNYSYRKYIFISE-DKKACKHLFEVTCGFHSKILGE
HEM1_CLOB8       ------------EELLKKIFDIFNWDYEYKKYVFITN-NKDAYRHLFEVCSGFHSKILGE
HEM1_CLOP1       ------------DEIFDKIFNVFNWNDDLKKYMFLSK-EKRAVTHLMEVICGFHSRILGE
HEM1_CALS8       -------------VDIEKIFTELDWDRRYMPLFYIYK-DKDCIKHLFEVVCGFDSLLIGE
HEM1_CAMC5       --------------IIRCLTVYSGVFEDELFERADIYEDSGAVHHLFAVASSLDSLVVGE
HEM1_CAMFF       --------------ILNSISILTLVPFEALELRADIYEDQGAIHHLFAVASSLDSLVVGE
HEM1_CAMHC       --------------VIKAISKLSGVDFDELKERADIYEDDGAIHHLFSVASSLDSLVVGE
HEM1_CAMJD       --------------IVKSLALLCDVDKDILLEKADIFEDSGAIHHLFSVASSLDSLVVGE
HEM1_NITSB       --------------VLKKLSEVSGINYEELEGRADIYEDNGAIHHVFSVASGLDSLVVGE
HEM1_WOLSU       --------------LMEKLSEYSKIPKEELSERADVYEDTGAIHHLFCVCSSLDSLVVGE
HEM1_HELHP       --------------IYECFCTHKNIALEDIKNIALMRLNQYAIYHIFSVASSLDSLVIGE
HEM1_ARCB4       --------------IIEKLATYSKVDFDVLYDRADIYDADGAVHHLFSVASALDSLVIGE
HEM1_SULDN       --------------IFEMLAARSGVSIDELEGRADIFDDSSAIHHLFSVASSLDSMVIGE
HEM1_SULNB       --------------VLGLMSQKGGLNFYELKSTAKRYDDEEAIEHIFSVVSSLDSLVIGE
HEM1_HELAH       ------------NALLKILAQNKKMSVSDLEKCVLMSTDESAVHHVFSVCSSLDSLVVGE
HEM1_CHLTB       ---------------PAELFDSLAQEIKLLGVSPYFYRNQDCFAHLFCVAGGLDSLVLGE
HEM1_CHLMU       ---------------TEAIFSTLEKEIREMGAIPYFYRNQDCFSHLFCVVGGMDSLVLGE
HEM1_CHLFF       --------------SNANVQSKLLSWISSLGTRPYCYQGLACFTHLFTVTSGMDSLIFGE
HEM1_CHLPN       --------------SPEIAQAALLSELTSQGIRPYRHRGLSCFTHLFQVTSGIDSLIFGE
HEM1_SALRD       -----------------KALIGQGGGTRWPEETAFQERDEAAVRHLLQVTSGLRSVVLGE
HEM1_CYTH3       -------------IKLLGVEKNITGLIQQKEYFEIYNEQADAVLHLFEVGIGLDSQVVGD
HEM1_RHORT       -------------LLLAELCAVGPIEPAALAGQMVDLRGLAVVAHMFRITSALESQVLGE
HEM1_CUTAK       -------------DEAALRRCIADHGANVLAESAQLVCENDAVWRLFRVAAGMESMVFGE
HEM1_IGNH4       ---------------SIKSLLEARAGEPIPEEKFVIYYGTDAVRHLFRVAAGLESMVLGE
HEM1_HYPBU       ------------------FVETVIGFLGEASRYARILHGMDVVRHLFRVAAGLESAIIGE
HEM1_AERPE       -----------------LVEDLASSIASPGGEGLVRLQGIDAARHLFRVASGLESQIIGD
HEM12_NOCSJ      --------------LLRALAGQRGLGPEPLLEHAVGLTGREAVQHLLRVTAGLDSFVRGE
HEM1_CENSY       ---------------RRTWASLAGIDESLFGGHLESSGGGEVLEHLLRLTSGLDSMVVGE
HEM1_THEM4       -------------------DKEPLTINEIIEPYIIRKSGIDVVRHLFKVSCGLDSMVLGE
HEM1_CALMQ       -------------------VAEDMYKVKGTINHVDKLVGMNAVRHIFRVAAGLESAAVGE
HEM1_TROWT       -------VCKTGLLVQNRIGELCNISPSTIIEQTSFLAGCEVSRHLFSVATGLESMIIGE
HEM1_PARUW       ----------------YLLSILRQDVKEDFDHKLYSFFGMDCFSHLTRVTSGLDSAIVAE
                                                                    .  *   .:

HEM1_ARTS2       REIAGQVRRALINAQHEG-------TASSGLVRLFQAASKTAKDVGAQ-TALGSRGLSIV
HEM1_RENSM       REIAGQVRRALIDAQTAF-------PVPGPLVRLFQTASRTAKDVGSQ-TALGSQGRSIV
HEM1_CLAMS       GEIAGQVRRALEGARTGG-------TTSTGLERLFQTASNTSRGVKTR-TGLQSAGRSMV
HEM1_LEIXX       GEIAGQVRRALTTARQAG-------TVSQDLERLFQVASRTSRGVKNR-TGIATAGRSIV
HEM12_PYRAR      TDILGQLEEAYDRQVRAG-------FTRGLLKTVVERAVRVGKKVRTE-TGISRGPAGLG
HEM12_PYRCJ      TDILGQLEEAYDRQVKAG-------YTRGLLKTVVERAVRVGKRVRTE-TGISRGPRGLG
HEM11_PYRAR      TDVLGQLEEAFDRQVRAG-------YTRELLKTVVERAIRVGKRVRTE-TGISRGPRGLG
HEM11_PYRCJ      TDVLGQLEEAYESQVRRG-------NLRGLLKTVVERAVAVGKRVRTE-TGISRGPRGLG
HEM1_SULAC       YEILGQIKEALTSCKKHS-------LCNEEIELLFNAAIKVGRKVRSL-TNISKGKVGIY
HEM1_SULTO       YEILRQLKESIEKSKKLG-------LSSEKLEFLFKNAIKVGRKIRQQ-TEISKGKTGIY
HEM1_SACS2       YEILSQIRSTIDMFKKLG-------FSGKYLQIFFERAIKVGRKVREE-TSISKGKVGIY
HEM1_METS5       YEILKQIKDAMRDSIKLG-------IGSRYIRALLERSLKVGRRVRLE-TGISRGKVGVY
HEM1_THEAC       NEILKQVKEAYELSVRNG-------KVDKVLSLIFQKAIFVGKKVRSE-TEISRGKVSVP
HEM1_THEVO       NEVLKQVKQAYEKSSSMG-------KSDKFLSLIFQRAISVGKLVRSK-TGIGKGKVSIP
HEM1_PICTO       NDIMRQVKEAYELSIKRK-------TSGKILSYIFKKALNVGKEVRTQ-TSISRGKTSIP
HEM1_PROA2       GQILGQVKNAYRIAVEEQ-------SAGILLTRLCHTAFSVAKKVKTR-TRIMEGAVSVS
HEM1_CHLT3       VQIIGQVKTAYNRAVEMK-------TVGPILNKMCHTGFGLANRVRSK-TKLTAGAVSVS
HEM12_FLAJ1      FEIISQIKTAFNNSKQEG-------LVNTFLDRLVNTVIQASKKVKTE-TKISSGATSVS
HEM1_GRAFK       FEIISQLKIAFVRSKKLG-------LVNAFLERLVNAVIQASKRIKNE-TEISTGATSVS
HEM1_BACME       TQILGQVRSSFLLAQEEE-------TIGTVFNQLFKQAVTLAKKAHHE-TEIGANAVSVS
HEM1_BACP2       TQILGQVRSSFKVAQEEK-------TIGTVFNYLFKQAVTVAKRSHAE-TDIASNAVSVS
HEM1_BACCN       TQILGQIRNSFLTAQEVK-------TTGTIFNELLKQVITLAKRAHSE-TTIGESAMSVS
HEM1_LYSSC       TQILGQVKKSFLSGQEIG-------TTGTVYNQLFKQAVTFAKRAHNE-TAIGENAVSVS
HEM1_GEOTN       TQILGQVKGSYLLAQEIG-------TSGTILNHLFKQAVTFAKRAHSE-TGIGAHAVSVS
HEM1_OCEIH       TQILGQVKQAFLNSQQVN-------TTGTIFNELFKQAITFGKRAHKE-TAIGEHAVSIS
HEM1_BACSK       TQILGQVKQAFLLAQEEK-------VTGTVFNQLFKQAVTLGKRVHSS-TEISSQAVSVS
HEM1_BACHD       TQILGQVRNSFFIAQEEQ-------VTGSIFNHLFKQAITLAKRAHSE-TDIGQNAVSVS
HEM1_PAEMA       TQILGQVKSAFLLSQRQK-------GTGTWFNMLFKQAVTLGKRAHSE-TAIGQSAVSIS
HEM1_STAS1       TQILGQIRNAFFLAQEED-------TTGTIFNHLFKQAITFAKKAHNE-TDIADNAVSVS
HEM1_LISW6       TQILGQVKHAFEIAKQTG-------TTGTLLNKLFREVVTFAKKVHHQ-TKINENAVSVS
HEM1_EXIS2       TQILGQVKTSFFTAQKLE-------TTGTVFNKLFKEAVTLAKRAHAE-TGIGENAVSVS
HEM1_STRSV       SQVLGQLKQAFLTAQDAG-------TTGIVLNQAFKQALTFAKRMHDT-YRINDRPISIG
HEM1_LACRJ       PQILGQMKDAFQIATKEG-------TTGAILNHLFRQAITFSKRMHTK-YRVSELAQSSG
HEM1_SYNP2       GQILAQVKAAHKLGQQHK-------GLGRLLDRMFKRAITAGKRVRSE-TNIGTGAVSIS
HEM1_ACAM1       GQILAQVKQTHKLSQKYS-------GAGPILNRLFKQAISAGKRVRTE-TSIGTGAVSIS
HEM1_SYNP6       GQILSQVKTMYKLGQQYE-------GVGRILNRLLKQAVTAGKRVRTE-TSIGTGAVSIS
HEM1_THEEB       GQILSQVKRCHQLGQQYK-------SIGPILNRVFTGAIAAGKRVRTE-TSIGTGAVSIS
HEM1_CYAPA       GQILSQVKQCYQLGQQYQ-------GIGPVLNNIFKQAISAGKRVRTE-TQISTGAVSIS
HEM1_SYNJA       GQILSQVKKAQQLGQACN-------GMDRILNRLFKAAITAGKRIRTE-TGIGTGAMSIS
HEM1_GLOVI       GQILAQVKMTQSLAQQGK-------GVDRVLNQLFKTAITAGKRVRSD-TNIGTGAVSVS
HEM1_SYNS3       GQILSQVKKMMRLGQEHK-------SIGPILNRLLTQAVSTGKRVRSE-TNLSTGAVSVS
HEM1_SYNR3       GQILSQVKKMYRLGQDHK-------SIGPILNRLLNQAVSTGKRVRSE-TNLGSGAVSIS
HEM1_PROMP       GQILSQVKKMMRLGQENQ-------STGPILNRLLSQSVSAGKKVRSE-TNLGTGAVSIS
HEM1_FRASN       TQILGQVRAAFRLAQAAE-------VTSGTLANLFQTALRVGKRAHTE-TSIDAAGASIV
HEM1_KINRD       SQILGQLRLALRGLHERG-------LAGGTLDRLLQTALRVGKRAHSE-TRLDAAGASLV
HEM11_NOCSJ      GQILGQTRAALNAGQEIG-------TVGPALNVLFQQALRVGKRARAE-TGIDRAAPSLV
HEM1_THEFY       GQILGQVRNALKDAQHVG-------TLGRVLNDLGQRALRVGKRAHTE-THLDKAGASMV
HEM1_MYCA9       QQVLGQVRNAYATAESHQ-------AVGRVLHELSQSALRVGKRVHSE-TGIDAAGASVV
HEM1_RHOJR       QQILGQIRTAYASSDAQQ-------AAGRTLHELAQQALRVGKRVHSE-TGIDSAGASVV
HEM1_SACEN       AQILGQIRQSYGVADEAG-------TVGRTLHELAQQALRVGKRVHAE-TGIDSEGASVV
HEM1_SALTO       AQILGQLRDAYHWASEAE-------TVGRLLHELMQQALRVGKRAHSE-TGIDRAGQSVV
HEM1_ACIC1       HQVVGQVRDAFRLAQERG-------YAGRDLHAIVQDALHAARRVRAE-TRIDSAGQTLV
HEM1_COREF       QQIIGQVRTAYQQATEAG-------TVGPALHALAQTALHTGKRVHTE-TDIDEAGASMV
HEM1_CORDI       QQIIGQVRTAYHSATEAG-------TVGPALHGLVQASLHTGKRVHTE-TDIDDAGASMV
HEM1_CORJK       QQIIGQLRSAYQSANETG-------TVGRTLHDLTQRALRTGKRVHSE-TAIDSAGASMV
HEM1_CORU7       QQIIGQLRGAYEESKGAG-------TVGRTLHDLTQRALRTGKRVHSE-TEIDSAGSSMV
HEM1_ROSS1       DQIVGQVKEALAIAHAAG-------AIGPVLHRVLHGALAAGKRARTH-TGIATGHVSVV
HEM1_HERA2       AQILSQIKTAYNAAQQTE-------LLGTTMHRLIQAALTTGKLVRTE-TQLAHAQLSVV
HEM1_CHLAA       AQIQGQVRNAYEAAQRIG-------SVGSILHRLFQIALVAGKRVRHE-TTIGKGAASVS
HEM1_RHOBA       AQILSQVKQSYDLANDAD-------RTGPITHGVFQAANRTAKRVQTE-TSIHRRRLSVP
HEM11_ANADF      QQILGQVKEAYGLASAAE-------AAGPFMSRLCNRAFATAKRVRTE-TDIGRGATSMS
HEM1_MYXXD       AQILGQVKEAFERGQGAG-------AVRGELMRACAAAFSCAKRVRTE-TAIGRAATSMA
HEM12_ANADF      PQILGQVKEAFQRSIDQG-------VAAKELTSVLNRALSAAKRVRTD-TAIGRAGISWG
HEM1_THET8       AQILGQVREALFLARRQG-------ATESLLEKAFQSAIALGKRARSE-TGIGMGAVSVA
HEM1_DEIRA       TQIQGQVKRAWQSARERG-------LSGTLMNKVVQGALAAGKRVRSH-TGLSDKVVSVS
HEM1_RUBXD       AQILGQVRDAYRMATEER-------CTGPVLNRLFHTALRVGKRVRAE-TGIGDSSLSVP
HEM1_CARHZ       TQILGQVRDAFLKASSLK-------ASNKILNTLFQHAITVGKKVRTE-TGIDKNPVSIS
HEM1_HELMO       TQILGQVRTAYQRSCNED-------CSNGIVNTWFQQAITVGKRVRTE-TGIDQHPVSIS
HEM1_DESRM       TQILGQVKKAYELALEAK-------TTNVVLNTLFQQAITTGKRVRTE-TGIDQNPVSIP
HEM1_PELTS       TQILGQVREAYQRAIEYE-------STNRVLNTLFQQAITVGKRVRTE-TGIDRNAVSIS
HEM1_DESAP       TQILGQVKQAYQFAQQVG-------TVNWLLNCAFQQALAVGKRVRTE-TGIDKNPVSIS
HEM1_MOOTA       DQVLAQVAEAYQVARETG-------TTNNVLNTLWQQAIYAGKRVRTE-TRIDANTVSVS
HEM1_DESHY       TQILGQVAEAYEKSSQLN-------LSNKIIHAIFQNALAVGKRVRSE-TQIDQHPTSVS
HEM1_AKKM8       TEIFGQVKTAYQTALDAG-------VTAACANKTFQKAFTIGKKVRTE-SQIHAGATSVG
HEM11_KORVE      PEIVGQFKNAWSQAQAAG-------TTGRFLDAVMQKALTVSKRVRNE-TAIGNAAVSIP
HEM1_DESAG       PQILGQLKDAYRDAVARN-------TTRVILNRMMHKAFSVAKRVRTE-TAVASSAVSIS
HEM1_LAWIP       PQILGQLKDAYKLATIAG-------ASKTILNRLLHKAFSVAKRVRTE-TSIASNAVSIS
HEM1_DESPS       AQILGQLKTAYRHASALG-------CTGPLLNRLLHKSFSVAKRVRTE-TAIGASAVSIS
HEM1_SYNFM       PQILGQLKSAYREATEWR-------TVKVILNRLLHKTFSVAKRVRSE-TCIGSNAVSIS
HEM1_SYNAS       PQILGQVKEAYREAVEHG-------VTGILLNRILHHAFQVAKRVRTE-TGIADNAVSVG
HEM1_PELPD       PQILGQIKTAYGYAAEYR-------TSGTILNRFLHKAFSVAKRVRTE-TRIASSAVSVA
HEM1_PELCD       PQILGQLKEAYNLAESSC-------TAGPVLNRLLPRAFAAAKRVRNE-TAIAQHAVSVS
HEM1_MAGMM       AQILGQMKQAYQDALSAG-------STGVVLNRFFQHAFLTAKRVRTE-TSIAENSVSVA
HEM12_KORVE      PQILGQVKEAYATARAVG-------AVSSQLDALLTRAFAVAKRVRTD-TSIASSSVSIA
HEM1_SOLUE       PQILGQLKVAYAAAKDCG-------ALCGWLDGLMSRSFSVAKRVRSE-TGIGQMAVSVS
HEM1_THEYD       PQITGQVKESYEIALSER-------TTSLILNYLMNRALFTAKRVRNE-TRIGENPVSVS
HEM1_SULSY       PQIVCQFKDSFTKAKEYK-------AVRHILTRLFDKALNVSKKIRTS-TGISRRAVSIS
HEM1_AQUAE       PQIVAQFKEAYRVAKEAG-------TVGKILNRVYEKALRASKRVRTE-TGISRSAVSVS
HEM1_NATTJ       TEILGQVKKAYQLSDEAG-------GVDSIFHGLYQQALRTGKRVHRE-TGINDNAASVS
HEM1_RHOFT       TQILGQIKNAVRAAEAAG-------ALGNTLSQLFQRSFAVAKEVRSS-TEIGAHSISMA
HEM1_METPP       PQILGQMKQAVREADAAG-------TLGSTLHQLFQRSFAVAKEVRTA-TEIGTHSISMA
HEM1_RALSO       TQILGQMKDAVRTATEAG-------ALGTYLNQLFQRTFAVAKEVRGT-TEIGAHSVSMA
HEM1_POLAQ       TQILGQMKDAVRTANDAG-------VLGTYLNQLFQKTFAVAKEVRGS-TEIGTHSISMA
HEM1_JANMA       PQILGQMKDAVRQAEAAG-------GLGTYLHQMFQRTFAVAKEVRST-TEIGAHSVSMA
HEM1_BORA1       PQILGQMKDAVRAAEEAG-------SLGTLLHQLFQRTFAVAKEVRSQ-TEIGAHSVSMA
HEM1_AROAE       PQILGQVKDAVRRAEEAG-------TMGTLLHKLFQNTFAVAKEVRST-TAIGANIVSMA
HEM1_DECAR       PQILGQMKDAVRAAEENG-------TLGTQLHKLFQRSFSVAKEVRST-TAIGANIVSMA
HEM1_NITMU       PQILGQLKDAVKSAEHAG-------TLGMLLHKLFQRTFFVAKEVRSS-TEIGTNSVSMA
HEM1_THIDA       TQILGQMKQAVAAAEEAG-------TLGLLLHKLFQRTFSVAKEVRSS-TEIGANSVSMA
HEM1_METFK       AQILGQMKQAVRIAENAG-------TLGTLLHKLFQRTFSVAKEVRTN-TNIGANSVSLA
HEM1_NEIM0       PQILGQIKDAVRVAQEQE-------SMGKKLNALFQKTFSVAKEIRTD-TAVGENSVSMA
HEM1_CHRVO       TQILGQLKDAVRSAEHAG-------ALGTLLNGLFQRTFAVAKEVRSS-TAVGASSVSMS
HEM1_MANSM       PQILGQVKQAYQYSEDYCQAQHMP--MSSEFSRLFQKTFSVAKRVRTE-TNIGNSAVSVA
HEM1_PASMU       PQILGQVKDAYQLSKMYYQGQNQP--LSSEFSRLFQKTFSVAKRVRTE-TNIGGNAVSVA
HEM1_HISS2       PQILGQVKQAYQMSEEYYSLHSDIGMMSTELSRLFQKTFATAKRVRTE-THIGESAVSVA
HEM1_ACTP2       PQILGQVKQAYQYSENFYQSQNSH--ISTKLSRLFQRTFSTAKRVRSE-TEIGSSAVSVA
HEM1_AERS4       PQILGQIKQSYAHAQQSE-------AVKGSLERLFQKSFSVAKRVRTD-TEIGASAVSVA
HEM1_SHELP       PQILGQVKQSFVKAKEAG-------TVAVTMDRLFQNTFSVAKKVRTE-TEIGAAAVSVA
HEM1_PSYIN       PQILGQIKQAFATAKQAK-------GVDKIVQKWFQHTFTVAKRVRTE-TQIGANAISVA
HEM1_ALISL       PQILGQVKKAFADAREHN-------AVEGVVEKLFQSDFSVAKRVRTE-TNIGGNAVSVA
HEM1_PHOPR       PQILGQVKQSYYSSQEYD-------AIHGTLEKLFHKTFTVAKRVRTE-TDIGGNAVSVA
HEM1_SODGM       PQILGQVKKAFAESRRGH-------GLSVDLERWFQKSFSVAKRVRTE-TEIGSHAVSVA
HEM1_PROMH       PQILGQVKKAFADSQNYH-------SLSSELERLFQKSFSVAKRVRTE-TQIGANAVSVA
HEM1_COLP3       PQILGQMKQAYSQAKAAG-------SMSLIMDRLFQRTFGVAKQVRTE-TEIGASAVSVA
HEM1_PSEHT       PQILGQIKQAYNSAKTHN-------AVGVTFDRLFQKTFSVAKQVRTE-TNIGASAVSVA
HEM1_PSEA6       PQILGQVKQAFVSAKDSG-------VIKSDFERLFQQTFSVAKRVRSE-TEIGSNAVSVA
HEM1_IDILO       PQILGQVKQAYQAAKRQA-------SVGGILERLFQQTFRVAKTVRNE-TAVGQNAVSVA
HEM1_ALCBS       PQILGQMREAYARAHEAG-------LLNGELSRLFQEVFSVAKRIRTE-TGIGANPVSVA
HEM1_CHRSD       PQILGQLKEAYQLARDNA-------GLGGELERLFQHTFSVAKQVRSE-TGIGENPVSVA
HEM1_HAHCH       PQILGQMKEAHASGRAAG-------SLGGPLDRLFQHAFAVAKRVRTE-TAIGENPVSVA
HEM1_MARHV       PQILGQLKDAYALAREHS-------ATGSFLSRLFEQTFSVAKRVRTQ-TAIGENPVSVA
HEM1_PSEU5       PQILGQMKSAYAVAREAG-------SVGPLLGRLFQATFSTAKTVRTD-TAIGENPVSVA
HEM1_SACD2       PQILGQMKSAYAVAREAG-------VLGGHLHDVFQRVFSVAKRVRSE-TAIGENPVSVA
HEM1_MARMS       PQILGQVKSAYAVSQEGS-------CIGPELESLFQRTFSVAKRVRTD-TAIGENPVSIA
HEM1_ALKEH       PQILGQAKIAYQGAIDAG-------TMGRVLDRLFQHAFSVAKQVRTD-TGIGANPVSVA
HEM1_HALHL       PQILGQVKDAYHKAANAG-------CLGAVLERLFQHAFAVAKQVRTD-TDIGSNPISVA
HEM1_NITOC       PQILGQIKAAYSYGLEAG-------TIGRVLGRLFQHTFYVAKQVRTD-TAIGTSPISVA
HEM1_METCA       PQILGQMKTAYQAAREAG-------TVGKILTKLFHRTFAAAKKVRTD-TAIGCSPVSVA
HEM1_HYDCU       PQILGQIKEAFHLAHKSD-------SVHQTLHALFQYIFKTAKQVRTD-TAIGSSPVSVA
HEM1_COXBR       PQILGQMKQAYLLARRIG-------AVGSELGRLFPAVFAATKRIRSE-TAIGANPVSIA
HEM1_LEGPL       PQILGQMKQAYQHACRLG-------TVKTQLRPVFEYIFRASKRIRTR-SGIGANPVSIA
HEM1_XYLFT       SQILGQVKDSWSMARTHG-------TLGNTLDRLFQHSFSVAKHARTN-TRIGTNPVSIA
HEM1_DICNV       PQILGQLKAAYRLAKKAG-------SIGSWLERLFQHSFALAKHVRHQ-TDIGKNPVSVA
HEM1_VESOH       PQILGQLKNAYHMAKEAK-------TLNKLLEKLFQHAFSTAKKVRTD-TQIGVSPVSIA
HEM1_FRAP2       PQILGQVKDSYTLSKKNH-------AIGKELDRVFQKVFATAKKVRSE-TRIGHCPVSVA
HEM1_WIGBR       HQILSQVKSAFFRSLKNK-------NISIDLQKLFESAFSVAKKIRSE-TKIGSYSISIP
HEM1_PSYCK       PQILGQIKRAVHMAQDQK-------ALSNQLGWIVDQVFAAAKRVRNE-TQVGAQAVSLS
HEM1_PSYWF       PQIFGQIKRSVNQAKEQG-------FLTNQLNWVVEQIFAAAKRVRNE-TDVGTQAISLG
HEM1_ACIAD       PQILGQVKSALALSKESH-------TVSRDLNRIFEYAFYAAKRVRSE-TAVGSHAVSMG
HEM1_METBF       DQILGQIKELYAYSKKAG-------TTGKILDTAFDKAIQVGKRIRNE-TRINKGSVSIG
HEM1_METBU       DQILGQIKDFFLMAKGAG-------TVGKVLSTAFSKAIQVGKRVRTE-TFINRGAVSIA
HEM1_METTP       DQILGQMKELYRTAKSLG-------YTGWVLDTAFKKAIQVGKRVRKE-TAINERSVSVG
HEM1_METAR       DQILGQLKTALLQARRLG-------TIGPVLSTAIQKSIHVGARARIE-TEINKGSVSIG
HEM1_ARCFU       EQILGQVRQCFNLCREGG-------QAGEVLERVFGKAVQVGRRVRRE-TAISKGSVSIG
HEM1_METKA       QEILRQVKKAYDRAARLG-------TLDEALKIVFRRAINLGKRAREE-TRISEGAVSIG
HEM1_METVS       NQILGQIKSSYHKSKELK-------KTSKYLENLFLKAIHVGQRVRAE-TKINEGGVSIG
HEM1_META3       DQIIGQIKNSHRKAKELK-------KTTKYLDTIFLKAIHTGQKVRNN-TKINKGCVSIG
HEM1_METJA       DQILGQLKNAYLKAKEKG-------RISKKLEKIILKAIHTGQRARVE-TKINEGGVSIG
HEM1_METTM       DQILGQIKAARLQALREG-------TCGPLLDMVFTKAVHVGQTVRRK-TKINRGSVSIG
HEM1_METS3       DQILGQVSDAKQKAFKER-------HCGKILDSIFTKAIHVGRVVRNK-TNINKGSISIG
HEM1_METST       DQILGQIKTARKNAIKNK-------TIGPKLEKVFTKAIHVGQTIRKN-THINEGGVSVG
HEM1_METMJ       DQILGQLKQALAAAEEAG-------TCCSAIGLCIKKAVHAGVRVRRQ-TQINRGAVSVG
HEM1_METB6       DQIIGQLKKSLADGEAAC-------TASPFLSLCINKAVHVGVGVRRT-TKINRGAVSVG
HEM1_METHJ       DQILGQLRKSLSLSESMS-------VADPLITLCINKAIHAGSEARRI-SGINRGAVSIG
HEM1_METLZ       DQILGQMRRALLLAESHD-------TNDVITDVCLNTAIREGVSIRQK-TSINKGAVSIG
HEM1_HALMA       DQILGQLRTAYETARGVG-------GIGPMLEDGVTKAIHVGERARTE-TKINEGVVSIA
HEM1_NATPD       DQILGQVRDAYEDARGVG-------GVGPTLNDAVLKALHVGERARTE-TAINEGAVSLG
HEM1_HALS3       DQILGQLRDAYDAAKDAG-------GIDHVLREAVTKAMHVGERARTE-TAINEGATSLG
HEM1_HALWD       DQILGQFKRAIEVARGIG-------ALGPMLEAGVTKAIHVGERARSE-TSINEGAVSIG
HEM1_ALKOO       DQIITQVKNAIAVSREMR-------AADSYLEVMFRNAIAAAKKVKST-LILNSRENSIV
HEM1_CLOTH       DQIITQVRNAIELAREMN-------ASDSTLEVMFRIAVTSAKKVKTT-LKLSSTERSIA
HEM11_LACP7      DQILTQVREALELSRENY-------CTDSVLETLFRFAITSAKQVKTQ-IHLSVVNSSVI
HEM12_LACP7      DQILTQLKQALQQARDYQ-------YVDSVLECLFRTAITAAKKVKTS-IQIAKGNTSLP
HEM1_CLONN       DQILGQVKEALRYSMENK-------FSRKVLNKLFREAITSAKKIKSE-LKISETPISMV
HEM1_ALKMQ       DQILGQVKEAHAEALDFA-------ATGKILNKLFLEAVTTAKEVKTE-TAISENALSIS
HEM1_CLOAB       DQILGQIKAAYDTALKNK-------TSGSELKKLFQLVITCGKEFRSI-SMLNRIPVSSA
HEM1_CLOTE       DQILSQIKQAYEIALSSK-------SVNRDLNKLFQMAITCGKEFRNK-SQLYKIPVSSA
HEM1_CLOK5       DQILGQIKTAYDAALEAK-------TIKGKLQRLFQKAITCGKEFKHI-CESYRIPVSIP
HEM1_CLOBB       DQILGQVKTSYFKSLNAK-------ALNLELQRLFQYAITCGKKFKSQ-SRLFEIPVSSA
HEM1_CLOB8       DQILGQVKDAYEEALEFK-------AVSLELHRLFQEAITCGKRFRKE-AKLFEIPVSSS
HEM1_CLOP1       DQILGQIKGAYKTAISDN-------SISSELQKMFEIAIACGKKFKTE-CKMFEVPVSSV
HEM1_CALS8       EQIVAQVKEAKDIAKQVG-------GKNPVLERLFEVALKCSKEFRTK-ARLNEHPITIA
HEM1_CAMC5       TQIVGQLKNAFKFAFDNA-------SSGEHISRLVHYACKCAARVRNE-TQISKNPISVS
HEM1_CAMFF       TQIAGQLKEAFKFAYDNE-------DCGVNISSAMHFAFKCAAEVRAL-TTISKNPVSVS
HEM1_CAMHC       TQIVGQLKDAYNFAKNER-------KSGVMLDLAINSALKCAAVIRSK-TDISKNPISVA
HEM1_CAMJD       TQIAGQLKDAFAFAVKNS-------FCGVHLSRAVHSAFKCATKVRNE-TQISKKPISVA
HEM1_NITSB       TQITGQIKDAYKEAYEKG-------WCGQKLGRVMHYAFKCSKEVRSS-TDITRSPVSVA
HEM1_WOLSU       TQIAGQLKSAFKFAYDGG-------FCSQKLSRAMHFAFKCAASVRNC-TEISKNPVSVA
HEM1_HELHP       TQITGQLKLAYKLAFENA-------LCAKDMTRLMHFAFKCAASVRKE-TDISAHSVSVA
HEM1_ARCB4       TQIVGQLKDAFRFSQAKG-------YCSLNITRVMHYAFKCAAQVRTA-TSLGTGSVSVA
HEM1_SULDN       TQIAGQLKDAFRFSYDNG-------FCSQKLARAMHHAFKCAAKVRNA-TDISSKPVSIA
HEM1_SULNB       SQITGQVKEAFRFSFQHG-------TAGRRLNRVLSYAVKCAAEVRNA-TNISQNPISIA
HEM1_HELAH       TQITGQMKNAYKFAFEEK-------FCSKDLTRLLHFAFKCAAKVRNL-TGISKQGVSIS
HEM1_CHLTB       TEIQGQVKRAYLQAAREQ-------KLSFALHFLFQKALKEGKVFRAK-GGAPYAAITIP
HEM1_CHLMU       TEIQGQVKRAYLQAIEEQ-------KLAFALHFLFQKALKEGKVFRTK-RSSPSTEITIP
HEM1_CHLFF       TEIQGQVKRAYIKAKTDR-------ELPFALHFLFQKALKEGKDFRSQ-VSLSYPVVTME
HEM1_CHLPN       TEIQGQVKRAYLKGSKER-------ELPFDLHFLFQKALKEGKEYRSR-IGFPDHQVTIE
HEM1_SALRD       RQIFAQVKAAYERAVDAG-------GIHSVMHRLFHTAFRAAKRVSSE-TGLGRGAASVS
HEM1_CYTH3       MQIVNQVKYAYQWSADLN-------LAGPFLHRLMHTIFFTNKRVVQE-TAFRDGAASVS
HEM1_RHORT       PHILGQVKAAHRIARDAG-------TVGSATEALMQAAYAIAKRVRSE-TRISEGPVSLA
HEM1_CUTAK       REVAGQMKRALSEARREQ-------TVSYTIGHVVEEALKTSRHVATE-TALAAEGRTVV
HEM1_IGNH4       PDILRQVREAAEFAAKEG-------YIGKALKLTFENAVRVGKRVRTE-TALGKGSIGIP
HEM1_HYPBU       NEILGQVARAYEEARRRG-------VAGKYLGLLFSQAVRTGKLVRSR-TRISYGNVGAP
HEM1_AERPE       HEVLGQVRRAWLKSREKG-------FTTPLLDEVFHRALKTGARVRSE-SAISSGGVGYS
HEM12_NOCSJ      SDIVGQVRAAVQAARAEG-------AVGLEVQRLVDAAVNTSRRVHRS-TGAGLAAGSVA
HEM1_CENSY       EQILGQVKNAITSARTSG-------ASGRRLNTLFDRAIRSGTRIRNS-TGIGSGGVSVG
HEM1_THEM4       HQILSQVKNTHKNFCHGK-----------ILNKLFNEAVSLGKEARTK-TGINKYPLSIS
HEM1_CALMQ       SEILGQVEDAFNDARKRG-------ALGGLLGFTIERAIRTGKEIRSRFPEISIGLASIG
HEM1_TROWT       TEIAGQVKRALTYAQKCR-------TTSPELERLFQRASAVNRHIRQS-TKINEVGQSLV
HEM1_PARUW       TEIQGQVKNAYNLATTFL-------CLPKELHFLFQKSMGIAKRIRSE-LHLGRGLPNLE
                  .:  *                                                      

HEM1_ARTS2       SVALDLATDLSENPD------------------------------------------WSA
HEM1_RENSM       SVALDLAGDSS-ATA------------------------------------------WDQ
HEM1_CLAMS       RLALDLA--ESRIAD------------------------------------------WSA
HEM1_LEIXX       RLALDLA--ESRVSD------------------------------------------WSR
HEM12_PYRAR      SLSIIYVSQFVDL---------------------------------------------KS
HEM12_PYRCJ      SLAVMYVSRMLDL---------------------------------------------RE
HEM11_PYRAR      SLSILYVKEKIDL---------------------------------------------TN
HEM11_PYRCJ      SLSIVYLSRRLPL---------------------------------------------RE
HEM1_SULAC       SIAIQKSLEVMGD--------------------------------------------LTD
HEM1_SULTO       ALAVEYAKHVSNNN-------------------------------------------IGN
HEM1_SACS2       SLAIDEAKKRFND--------------------------------------------FYD
HEM1_METS5       SLAVEFAKSRFGD--------------------------------------------ILG
HEM1_THEAC       SIVYDILSSRVVQ---------------------------------------------K-
HEM1_THEVO       SIVYDIVRKNGGN---------------------------------------------K-
HEM1_PICTO       AISLDICDNEYGI---------------------------------------------NN
HEM1_PROA2       YAAVELAQKIFSN--------------------------------------------LSM
HEM1_CHLT3       YAAVELTQKIYSD--------------------------------------------VST
HEM12_FLAJ1      FASVQYIIRNVAD--------------------------------------------IGS
HEM1_GRAFK       FASVQYILKHIDK--------------------------------------------VSE
HEM1_BACME       YAAVELAKKIFGD--------------------------------------------LSS
HEM1_BACP2       YAAVELAKKIFGR--------------------------------------------LSD
HEM1_BACCN       YAAVELGKKIFGD--------------------------------------------LTD
HEM1_LYSSC       YAAVELAKKIFGS--------------------------------------------LQR
HEM1_GEOTN       YAAVELAKKIFGH--------------------------------------------LNG
HEM1_OCEIH       YAAVELAKKIFGD--------------------------------------------LQE
HEM1_BACSK       YAGVELGKKIFGT--------------------------------------------FSG
HEM1_BACHD       YAAVELGKKIFDD--------------------------------------------FKG
HEM1_PAEMA       YAAVELGKRIFGS--------------------------------------------FSG
HEM1_STAS1       YAAVELSKKVFGK--------------------------------------------VNN
HEM1_LISW6       YAAVEVAKKLYGS--------------------------------------------LEN
HEM1_EXIS2       AAAVTLAEQLLGS--------------------------------------------LED
HEM1_STRSV       LTAIQELDRMGLD--------------------------------------------YST
HEM1_LACRJ       QAGLHQIKMQFGS--------------------------------------------LEG
HEM1_SYNP2       SAAVELAQMKVKD--------------------------------------------LSN
HEM1_ACAM1       SAAVELAQIKTED--------------------------------------------LSA
HEM1_SYNP6       SAAVELAQLKVIARDDR------------------------------------SDGNLAG
HEM1_THEEB       SAAVELADLRLQN--------------------------------------------LQN
HEM1_CYAPA       SAAVELAQIKKQD--------------------------------------------LRT
HEM1_SYNJA       SAAVELALQEQGS--------------------------------------------LSQ
HEM1_GLOVI       SAAVEMALRKKGP--------------------------------------------LHN
HEM1_SYNS3       SAAVELAQLKLGQSRGQD-----------------------------------ALVTLET
HEM1_SYNR3       SAAVELAQLKVGQEQGVD-----------------------------------DLVSLSQ
HEM1_PROMP       SAAVELAQLKIGQDHGVD-----------------------------------GLVSLKS
HEM1_FRASN       SVGVRMAAFDLQARRPDMLVAPVASPGCDPGDAVEALLRPELTAPVEVAGPAPL----AG
HEM1_KINRD       DTAMTRAA--------------------------------------GVVGELP------G
HEM11_NOCSJ      SAALDRSR--------------------------------------ATVGELS------G
HEM1_THEFY       SFGLTVAGRFLTPDREPQ------------PSAAAAVCPVDGDTGVEVSAALPDPQLLTG
HEM1_MYCA9       SVALNLAD-----------------------------------------NKLD---GLPG
HEM1_RHOJR       SVALDRAA-----------------------------------------GIVGDG-GLTG
HEM1_SACEN       SEALADAE-----------------------------------------TELG---GLAG
HEM1_SALTO       TAALGLAT-----------------------------------------ELLHS--DLAC
HEM1_ACIC1       DVGLQILS-----------------------------------------ERLGP---LAG
HEM1_COREF       SFAIDRALTQMGIDPAS-------------------------------------DKPLAG
HEM1_CORDI       SFACDEALAQM-----S-------------------------------------ATNFAG
HEM1_CORJK       SFALDQALRYIEPARALS----------------------------AVVDDAPLSQPLAG
HEM1_CORU7       SFALDRALTVLGIPEAS-------------------------------------SDALSG
HEM1_ROSS1       SVAIDAMRQYPD--------------------------------------------LLKR
HEM1_HERA2       SVGLSLARQHLD--------------------------------------------LTNR
HEM1_CHLAA       QAGVELARRRLG--------------------------------------------DLRG
HEM1_RHOBA       SVAIGEVVPEVF-------------------------------------------NRLQG
HEM11_ANADF      QVAVELVEKIFG--------------------------------------------DLKG
HEM1_MYXXD       AAAVQLASKVFD--------------------------------------------GLAG
HEM12_ANADF      HAAATLAEKVLG--------------------------------------------KMQG
HEM1_THET8       YAALDLALAVYG--------------------------------------------DLSG
HEM1_DEIRA       SAAVELAQAALG--------------------------------------------ELSQ
HEM1_RUBXD       HVAAKLAGEVFG--------------------------------------------SLEG
HEM1_CARHZ       YAAVQLACSFF--------------------------------------------GSLKD
HEM1_HELMO       YTAVELAEQVL--------------------------------------------GGLKG
HEM1_DESRM       YAAVELAKQGF--------------------------------------------GTLSG
HEM1_PELTS       YAAVELARQHL--------------------------------------------GSLDG
HEM1_DESAP       YAAVELARQTL--------------------------------------------GSLEG
HEM1_MOOTA       YAAVELARQVFH-------------------------------------------DELDG
HEM1_DESHY       YTAVELAKQTF--------------------------------------------GDVQG
HEM1_AKKM8       SVAVELAEQIF--------------------------------------------GDLSG
HEM11_KORVE      YTTVELSKQVL--------------------------------------------GELFD
HEM1_DESAG       YAAVELAKRIF--------------------------------------------GEMNE
HEM1_LAWIP       YAAVKLAKKIF--------------------------------------------GTMNQ
HEM1_DESPS       YAAVQLARKIF--------------------------------------------GNLDT
HEM1_SYNFM       YAAVELAKKIF--------------------------------------------GSLQD
HEM1_SYNAS       YAAVELAKKIF--------------------------------------------GRLDG
HEM1_PELPD       FAAVELARKIL--------------------------------------------GDLSG
HEM1_PELCD       YAAVELARKIF--------------------------------------------GDLAG
HEM1_MAGMM       SAAVDLAKRIF--------------------------------------------GDLSG
HEM12_KORVE      SVAVELAKKIF--------------------------------------------GSLQG
HEM1_SOLUE       YAAVELARKIF--------------------------------------------GSLTN
HEM1_THEYD       YAAVGLIKKVF--------------------------------------------DELSK
HEM1_SULSY       YAAVLLAKKIF--------------------------------------------GDLKD
HEM1_AQUAE       YAAVELAKKIF--------------------------------------------GDLKE
HEM1_NATTJ       YASVELATKIF--------------------------------------------GSLQN
HEM1_RHOFT       AAAVRLAGQLFED--------------------------------------------LGQ
HEM1_METPP       AAAVRLAAQLFED--------------------------------------------LRE
HEM1_RALSO       AAAVRLAQRIFES--------------------------------------------IAE
HEM1_POLAQ       AASVRLSERIFEK--------------------------------------------ISE
HEM1_JANMA       AASVRLSQRIFDK--------------------------------------------ISE
HEM1_BORA1       AAAVRLAERVFGD--------------------------------------------LGQ
HEM1_AROAE       AAALHLSERIFER--------------------------------------------MSD
HEM1_DECAR       AAGVHLAERIFES--------------------------------------------IAG
HEM1_NITMU       AASTRLAERIFGD--------------------------------------------IGE
HEM1_THIDA       AAAVRLAERIFPS--------------------------------------------VKE
HEM1_METFK       AASTRLAQRIFGA--------------------------------------------LNN
HEM1_NEIM0       SASVKLAEQIFPD--------------------------------------------IGD
HEM1_CHRVO       AAAVKLAEQIFPS--------------------------------------------VAE
HEM1_MANSM       YAACSLARQIFEG--------------------------------------------LKD
HEM1_PASMU       YGACSLARQIFDS--------------------------------------------LKT
HEM1_HISS2       YAACSLARQIFDS--------------------------------------------LRN
HEM1_ACTP2       YAACGLARQIFDN--------------------------------------------FGK
HEM1_AERS4       FAAVSLGRRIFSD--------------------------------------------LSQ
HEM1_SHELP       FAAVSMAKHIFSA--------------------------------------------LSA
HEM1_PSYIN       FAAVCLAKQIFSD--------------------------------------------LSQ
HEM1_ALISL       YAACTLARQIFES--------------------------------------------LAE
HEM1_PHOPR       YAACTLAKQIFES--------------------------------------------LSD
HEM1_SODGM       FAACTLARQIFES--------------------------------------------LAD
HEM1_PROMH       FAACTLARQIFES--------------------------------------------LSS
HEM1_COLP3       FASVNLAKHIFGG--------------------------------------------LEK
HEM1_PSEHT       YAAVNLAKHIYGK--------------------------------------------LDK
HEM1_PSEA6       YASVQLAKHIFSS--------------------------------------------LKK
HEM1_IDILO       YAAVSMARHIFAN--------------------------------------------LQK
HEM1_ALCBS       YAAVSFARHIFAD--------------------------------------------LKK
HEM1_CHRSD       YAAVSLASHIFDD--------------------------------------------FGR
HEM1_HAHCH       YAAVSMASHIFSN--------------------------------------------MEQ
HEM1_MARHV       YASVSMAHHIFAD--------------------------------------------MSR
HEM1_PSEU5       FAAVSLARQIFSN--------------------------------------------LQR
HEM1_SACD2       YAAVSLAQQIFSD--------------------------------------------LKQ
HEM1_MARMS       FAAVSLAQRIFAD--------------------------------------------IRN
HEM1_ALKEH       FAAVTLARQIFDD--------------------------------------------FQN
HEM1_HALHL       FAAVTMAKQIFDD--------------------------------------------FPK
HEM1_NITOC       FAAVSLAKQIFGD--------------------------------------------LES
HEM1_METCA       FAAIRLAQRIFDD--------------------------------------------LGD
HEM1_HYDCU       FSAVALSKQFFGK--------------------------------------------LEN
HEM1_COXBR       YAVVQLAKRIFSH--------------------------------------------LNQ
HEM1_LEGPL       YAAVQLIGQLFKN--------------------------------------------YHS
HEM1_XYLFT       STAVRLAQDAFSP--------------------------------------------LNE
HEM1_DICNV       YAGVQLTHQFFDD--------------------------------------------YSK
HEM1_VESOH       YCSVKLSEKIFEC--------------------------------------------LSE
HEM1_FRAP2       FSAITLAKKQLDN--------------------------------------------IST
HEM1_WIGBR       YIICVLLKKIFIS--------------------------------------------FTE
HEM1_PSYCK       YAAAKLVTQIFDD--------------------------------------------LPS
HEM1_PSYWF       YAASKLVTQIFDR--------------------------------------------PEE
HEM1_ACIAD       YAVAQLALQVFSN--------------------------------------------PEK
HEM1_METBF       SAAVDLAEEILDG--------------------------------------------LAG
HEM1_METBU       SAAVDLAEDILDG--------------------------------------------LND
HEM1_METTP       SAAVDLAEQILGG--------------------------------------------LEG
HEM1_METAR       SAAVELAESLLGD--------------------------------------------LRG
HEM1_ARCFU       SAAVEVAERVLGT--------------------------------------------LKG
HEM1_METKA       SAAVELAERELGS--------------------------------------------LHD
HEM1_METVS       SAAVELAEMKLG---------------------------------------------LKN
HEM1_META3       SAAVQLAEKTVG---------------------------------------------LNN
HEM1_METJA       SAAVELAEKIFG---------------------------------------------LEG
HEM1_METTM       SAAVDLAESIHGD--------------------------------------------LKC
HEM1_METS3       SAAVDLAEKHLGN--------------------------------------------LEN
HEM1_METST       SGAVELIEEKYGS--------------------------------------------LKG
HEM1_METMJ       SAAVTLAENLLGT--------------------------------------------LRD
HEM1_METB6       SAAVLLAESELGT--------------------------------------------LEG
HEM1_METHJ       SAAVLLAEEQLGS--------------------------------------------LAG
HEM1_METLZ       SAAVLLAEELMGD--------------------------------------------LDG
HEM1_HALMA       SAAVRLLKQESS---------------------------------------------LTD
HEM1_NATPD       SAAVRFAAERHG---------------------------------------------VTG
HEM1_HALS3       TAAVRLAERKTQ---------------------------------------------LAD
HEM1_HALWD       SAAVRLAGQSVG---------------------------------------------LNG
HEM1_ALKOO       HKALKIIK-DQE--------------------------------------------TMNI
HEM1_CLOTH       YSALKIIK-SKE----------------------------------------------NI
HEM11_LACP7      HHVVHELKLSNY--------------------------------------------LFKG
HEM12_LACP7      QTIVEQLEKEQG--------------------------------------------DLLG
HEM1_CLONN       YIAIKLLEKNIG--------------------------------------------TLKG
HEM1_ALKMQ       SIAVKQMENHLK--------------------------------------------GLVG
HEM1_CLOAB       SIAVNKAR------------------------------------------------QENL
HEM1_CLOTE       SIAVNEGR------------------------------------------------KHGG
HEM1_CLOK5       SIVAKEIL------------------------------------------------NMDI
HEM1_CLOBB       SIVVNESI------------------------------------------------NKDC
HEM1_CLOB8       SIVVSEAI------------------------------------------------KREC
HEM1_CLOP1       SISINSAL------------------------------------------------LKGC
HEM1_CALS8       SVVGKVLK------------------------------------------------ESNI
HEM1_CAMC5       SVAVAKAKEIFG--------------------------------------------TLEN
HEM1_CAMFF       SVAVAKAKEIYG--------------------------------------------NIGG
HEM1_CAMHC       SVAVCMAREKIG--------------------------------------------DLGG
HEM1_CAMJD       SVAVAKAKE-LA--------------------------------------------DLTQ
HEM1_NITSB       SAAVSMAKEKLG--------------------------------------------NLGG
HEM1_WOLSU       SASVSKAKDILG--------------------------------------------DLGG
HEM1_HELHP       STAVRMAEQKLALC----------------------------------------DKTLEN
HEM1_ARCB4       STAVSKAKDIIG--------------------------------------------NTKD
HEM1_SULDN       SVAVSKLKSVLD--------------------------------------------NVEG
HEM1_SULNB       SVAVAQAHKLLG-------------------------------------------DNIQG
HEM1_HELAH       SVAVKEALSIFE------------------------------------------KEKIED
HEM1_CHLTB       ILVDQELRRRQID---------------------------------------------KK
HEM1_CHLMU       AFVQHELQKQKMA---------------------------------------------RS
HEM1_CHLFF       SIVEETLDLHGKS---------------------------------------------TK
HEM1_CHLPN       SVVQEILLSYDKS---------------------------------------------IY
HEM1_SALRD       TAAVEMARQDLSEAG---------------------------------------GEGLRN
HEM1_CYTH3       YATVELSEELLSA--------------------------------------------TPN
HEM1_RHORT       AVAAQIARDLHGD--------------------------------------------LGE
HEM1_CUTAK       AVGLDLVAQRMDL---------------------------------------------DG
HEM1_IGNH4       SASVKLLEELIGLE---------------------------------------------G
HEM1_HYPBU       GAAVKLAREAAGG--------------------------------------------FDG
HEM1_AERPE       SAAVSLAASLLGG-------------------------------------------GLDG
HEM12_NOCSJ      STAVAAVAGLLPD-------------------------------------------GLAG
HEM1_CENSY       SMAVRLVEENMDD--------------------------------------------LHS
HEM1_THEM4       YIAVKLIEEQINIE---------------------------------------------G
HEM1_CALMQ       SLVAEYVHRVRGL----------------------------------------------N
HEM1_TROWT       SLSLDLASSRIGD--------------------------------------------WSG
HEM1_PARUW       HAILQTGKYFFRN--------------------------------------------TQQ
                                                                             

HEM1_ARTS2       KKAVVFGTGAYAGATMSLLRER-GCTDISVFSSSGRAEGFVAT-----------------
HEM1_RENSM       RKAVVFGTGAYAGVTMALLRER-GVSDLSVYSSSGRAADFVAS-----------------
HEM1_CLAMS       TRVLLVGTGAYAGASLAALRDR-GVVDVHVYSPSGRAQKFAGP-----------------
HEM1_LEIXX       MRVLLIGTGKYAGASLAALRDR-GVADVQVHSPSGRAEKFALS-----------------
HEM12_PYRAR      AKVAVLGAGAVGAGLAKELAER-GVAKLYILNRTLEKATEVAKKT---------------
HEM12_PYRCJ      ASVAVLGAGAVGAGLAMELAAR-GVKRLVVLNRTYEKAVEVANRV---------------
HEM11_PYRAR      ARVCVIGAGSVGRGLVKELIDA-GARRLVVVNRSVEKAADL-------------------
HEM11_PYRCJ      ISVCVIGAGAVGRGVVKELIDA-GVRRVAVVNRTVEKAADL-------------------
HEM1_SULAC       IKIAIVGAGEIGSKLAFMLKNN-GARNLTIFNRNLDRALELSNKF---------------
HEM1_SULTO       VKIAIVGAGEIGNKLALMLKNE-GAQNVTIFNRTYEKALEVANKY---------------
HEM1_SACS2       RRILVIGAGEMAQKITSMLHNE-GAKDVTIMNRTIEKAKQLALKF---------------
HEM1_METS5       KKIAILGAGEIGGKLALILHNE-GATDVTIFNRTFERGRNLAIKY---------------
HEM1_THEAC       --VLIIGNGMIAGEIAPYLS---GKFEVTIAGRNIDHVKDLASKY---------------
HEM1_THEVO       --ILLVGNGMLASEIAPYFSY--PQYKVTVAGRNIDHVRAFAEKY---------------
HEM1_PICTO       KSILIIGNGKMATDFSRYLKEY-RPGNVTIAGRSIDHARNLAVLY---------------
HEM1_PROA2       KKILLVGAGETGELAAKHMFQK-NARNIVITNRTMSKAE-----------ALAEELGTN-
HEM1_CHLT3       KNILLVGAGDTAKLAAKNLLDK-RVRDFYITNRTYEKAE-----------LLAQELGTG-
HEM12_FLAJ1      KNILLFGTGKIGRNTCENLVKHTKNSHITLINRTKNKAE-----------LLAGKLNV--
HEM1_GRAFK       KNILLFGTGKIGRNTCENLVKHTRNNHITLINRTKDKAE-----------RIAGKFNL--
HEM1_BACME       KHVLILGAGKMGQLAVQNLYGS-GAKKVTVVNRTFEKAQ-----------ELANRF----
HEM1_BACP2       KHVLILGAGKMGELAAQNLQGQ-GIGQVTVINRTYEKAK-----------ELAGRF----
HEM1_BACCN       CHVLILGAGKMGELALQNLYGS-GVQKVTVMNRTFTKAE-----------TMAEKY----
HEM1_LYSSC       KHVAILGAGKMGELAIENLYGS-GVGKVTVINRTFEKAE-----------SLAAKF----
HEM1_GEOTN       KHVLIIGAGKMGTLAAQNLYGN-GVGKVTVVNRTLEKAK-----------QLAAQF----
HEM1_OCEIH       KHVAILGAGKMGELAAKNIQGS-GATKITVVNRTLENAN-----------EMAEKF----
HEM1_BACSK       KHVLILGAGKMSELTAKHLYAN-GAASISVMNRTKENAV-----------ELASQF----
HEM1_BACHD       KQVLILGAGKMGELTAKHLHSN-GAEQVTVINRTREKAA-----------ELAKRF----
HEM1_PAEMA       KRVLILGAGKMSELTAKHLSGG-GADEVIVANRTYARAQ-----------ELAAKF----
HEM1_STAS1       KQALIIGAGDMSELSLLNLIGS-GVTDITIVNRTLSKAQ-----------DLAMKH----
HEM1_LISW6       KKIVLVGAGEMSELALQNLAGS-GIADITIINRTKANAE-----------ILADQF----
HEM1_EXIS2       KSIVVIGAGETGELTTLNLYEA-GARDITVFNRTLAKAE-----------EVANRF----
HEM1_STRSV       KKIAVIGLGEIGQLVTKYALQR-PFESVMLLNRTVSKAQ-----------AFLTE--D--
HEM1_LACRJ       KTLAVVGLGQIGKHTAYNASNM-GFSKVLLLNRTDSKAE-----------QIATELQG--
HEM1_SYNP2       QKIAIIGAGKMSRLLVQHLVSK-GAEDITIVNRSERGAR-----------DLAKKFPD--
HEM1_ACAM1       HRVAIIGAGKMSRLLVKHLLSK-GANQIAILNRSLKRAE-----------QLADQFQG--
HEM1_SYNP6       QRVLILGAGKMSRLLVQHLIAK-GADTIQILNRTLGRAE-----------ELAKQYGGD-
HEM1_THEEB       CRIAVVGAGKMSRLVVQHLIAR-GVKEIRIINRSLERAQ-----------ELAQQFPE--
HEM1_CYAPA       ANITILGAGKMSRLLVQHLLSK-RVKDINIVNRSVERAK-----------LLVDQFKE--
HEM1_SYNJA       GKVTVVGAGKMARLLVQHLLAK-GAVDITVVNRSLERAE-----------ALAKQFEQ--
HEM1_GLOVI       QRCLVVGAGKMGELLVRHLLAK-GARQIIVLNRSLEKAA-----------QMVEQFGL--
HEM1_SYNS3       EQIAVVGAGRMSRLLLQHLQAK-GASGVVLLNRTIERAS-----------ALATDFPN--
HEM1_SYNR3       EKVAVVGAGRMARLLLQHLQSK-GARSITVVNRTVAKAE-----------VLAKDFPD--
HEM1_PROMP       EKVLVVGAGRMSRLLITHLKSK-GCNRLTLLNRNIERAV-----------NLAGDFPD--
HEM1_FRASN       ARVLIIGAGAVGSLAAQTVRRA-GAGDVVVANRTAARAA-----------RVAD------
HEM1_KINRD       RRALVVGAGAMSALVATTLARA-GL-DVVVANRTPDRAQ-----------RLAA------
HEM11_NOCSJ      KRVLVVGAGSMAGLATSTVAAR-GTASVTVVNRTSGNAD-----------RLAE------
HEM1_THEFY       RRIMVLGAGSMSALAANTVARH-GASTILIANRTFDRAQ-----------RLAECLTEGY
HEM1_MYCA9       RTAAVVGAGSMGSLATAQLIRA-GIDNLWVVNRSAERAR-----------RLAATARE--
HEM1_RHOJR       RTAVVVGAGSMGGLSVAHLTRA-GIGRIVVVNRTKERAE-----------HLADTARA--
HEM1_SACEN       RRALLVGAGSMGGLAAAQLRRA-GIGEVVIANRTAVNGE-----------RLAESLRT--
HEM1_SALTO       RPALVVGAGAMGSLGVATLARL-GAGPVSVTNRGVDRAI-----------RLAES-----
HEM1_ACIC1       RRALVIGAGAMASVAVAALTRV-GITGLTVASRTLRRAT-----------ALAQ------
HEM1_COREF       KTALVLGAGAMSSLAATHLGRE-GVDKLIMANRTRERAE-----------RLASHSLE--
HEM1_CORDI       CRALVLGAGAMASLAATHLGRL-GIEHITVANRTFERAQ-----------RLADHAVE--
HEM1_CORJK       HRALIIGAGAMASLASTHLGKL-GIDHVTVANRTLSRAE-----------NLVNHARQ--
HEM1_CORU7       RRAVVIGAGAMASLASTHLGRL-GIEHVTVANRTVDRAE-----------QLASHAVE--
HEM1_ROSS1       GRALVIGAGHIAELSLKHLLAG-GCSAITIVNRTEARAD-----------ALAQR-----
HEM1_HERA2       S-VVIIGAGRTGELALKHYLEY--TSNITVLSRTFERAA-----------RLAEH-----
HEM1_CHLAA       REVLLIGGGEVSELAAQNLIAN-GADRLTIVNRTSARAA-----------ALAER-----
HEM1_RHOBA       KRVVLCGAGEMAEETLRYLKNG-GANNLCVVNRSLDRAQ-----------KLADE-----
HEM11_ANADF      RAILLVGAGKMGALSAKALAVL-GADRILVTNRSPERGL-----------ALAEQ-----
HEM1_MYXXD       KTVLVVGAGEMGELAARHLKQA-GASKLYVTNRTLSRAE-----------ALAAE-----
HEM12_ANADF      RRVVVVGAGEMARLSAQHLRDQ-G-ARIVVLNRTLVNGE-----------ALARE-----
HEM1_THET8       LSVAVLGAGEMAELFLTHLKAH-GVGRILVVNRTEEKAQ-----------ALAER-----
HEM1_DEIRA       RRALILGAGETAELTLTHLRAA-GVQDVLVVNRTAERAR-----------ALAEK-----
HEM1_RUBXD       RRALVLGAGEMSELLVRHLRDR-GVAEIRIANRTRERAE-----------RLAAL-----
HEM1_CARHZ       KKALLIGAGKMSSLTAKHLSYY-GIKEIIVANRSFEKAE-----------QFARE-----
HEM1_HELMO       RTAMVLGAGKMSVLTLKHLVAE-GVDKIIIANRSVEKAE-----------ELAKS-----
HEM1_DESRM       RSVLVVGAGEMSELTVVNLVAN-GVSSVIVSNRSYDRAV-----------QLAEK-----
HEM1_PELTS       RSVLVIGAGKMSELTARHLVAN-GVSSVIVSNRSFERAV-----------ALAEQ-----
HEM1_DESAP       REVLIVGAGKMSELTVKHLLSH-GVAGVIVSNRSYPRAV-----------ELAAQ-----
HEM1_MOOTA       RTVLVIGAGKMSTLAARYLKDK-GVTTVLVSNRSYDRAV-----------ALAAT-----
HEM1_DESHY       KSILILGAGEMSALTAKHLVAS-GADTVLVSNRSMQRAQ-----------ALAEE-----
HEM1_AKKM8       TRVLILGAGEMSRVTGRALHAR-GAEGIYVANRSFDRAV-----------ELAGM-----
HEM11_KORVE      KAVVLMGAGKMSESAAKYLMNH-GASQICVINRTLHKAQ-----------EFSEK-----
HEM1_DESAG       YKAMLIGAGEMAELAATHLLNC-GVNKIYVANRTFERGL-----------ELAKQ-----
HEM1_LAWIP       YKAMLIGAGEMAELAAMHLMQA-GIQQLKIVNRTYSQAQ-----------ELASQ-----
HEM1_DESPS       KKVMLVGAGEMAELAAEHLVGQ-GVSSVVVANRTLTRAV-----------ELADK-----
HEM1_SYNFM       KRVLLIGAGEMAELAAEHLLAQ-GVRHMVVANRTLERAV-----------DLAKR-----
HEM1_SYNAS       KVILLVGAGEMSELAARHLLKQ-GIKSIFVANRTHARAL-----------EMAEQ-----
HEM1_PELPD       KTVMLIGAGEMCELAAKHFLTS-GARGLLVANRTFAKGE-----------RLAAE-----
HEM1_PELCD       KSVMIVGAGKMCELAARHLTGQ-NIGEVLVTNRTLARAQ-----------SLAEQ-----
HEM1_MAGMM       HSCLLIGAGEMCELAARHLVTH-GVKEVLVTNRTFSRAV-----------DLAQQ-----
HEM12_KORVE      RSVYIVGAGKMCELAARHFVAH-GVEKIYVANRTYERGV-----------AFAKK-----
HEM1_SOLUE       RTVMIVGAGKMSELAARHLRRS-GASHVFVTNRTHERAV-----------DMAKL-----
HEM1_THEYD       KSILLVGAGEMAELALRHLIGS-GIKNVYLTNRTFQRAE-----------EIAKE-----
HEM1_SULSY       KNVLIIGAGEMAELAAKHLHSL-NVKHIFVSNRTFEKAV-----------ELADK-----
HEM1_AQUAE       AKVLLIGAGEMGELAANYLRRF-GAK-LHITNRTYERAL-----------KLVKE-----
HEM1_NATTJ       RRALIIGAGKMSELAARHLYSN-GVKDVIVINRTIERAK-----------NLADK-----
HEM1_RHOFT       VKILFVGAGEMIELCATHFAAK-SPKAIAIANRSLENGEKLASRF---------------
HEM1_METPP       IRVLFVGAGEMIELAATHFSAR-APARMAVANRTLERGERLASRF---------------
HEM1_RALSO       QRVLFIGAGEMIELCATHFAAQ-KPRETVVANRTLERGEKLAEALSNQGL----------
HEM1_POLAQ       QKILFIGAGDMITLCATHFVAR-KPKNVAIANRTIERGQELADSISAQDV----------
HEM1_JANMA       QNVLFIGAGEMIELSATHFAAQ-NPKSVTIANRTLERGQTLAHRF---------------
HEM1_BORA1       ARTLFIGAGEMIELCATHFAAQ-HPRSMVVANRTAERAESLAGRF---------------
HEM1_AROAE       QRVLFIGAGEMIELCAAYFAGA-CPKRIAVANRTEARAQLVAHRF---------------
HEM1_DECAR       QRILFIGAGEMIELCAAHFCAG-KPKQVTIANRTLERGRALAEQY---------------
HEM1_NITMU       QRVLFIGAGEMIELCASHFAAR-HPKRITVANRTVERAQALAHRL---------------
HEM1_THIDA       QACLFIGAGEMIELCMTHFAAQ-HPRRMTVANRTTERARPLAERF---------------
HEM1_METFK       QHVLFIGAGEMIELCAEHFAAH-RPLSLTVANRTLERGQELAASI---------------
HEM1_NEIM0       LNVLFIGAGEMIELVATYFAAK-SPRLMTVANRTLARAQELCDKL---GV----------
HEM1_CHRVO       LNVLFVGAGEMIELVATHFAAR-NPSCITVANRTLERGQRLAEQF---GG----------
HEM1_MANSM       LNILLVGAGETIELVARHLLRH-GVKKLMISNRTLARAELLVEKLEHNK-----------
HEM1_PASMU       LNVLLVGAGETIELTCRHLLRH-GVQRIMIANRTFERAQHLVTKLDGAE-----------
HEM1_HISS2       LNILLVGAGETIELVSRHLLRH-GVNGLAIANRTLSRAEKLVEKLETTQ-----------
HEM1_ACTP2       LRFLLVGAGETIELVARYLIQH-GAKNIMIANRTPQRAETLAERLNTP------------
HEM1_AERS4       TKVLLVGAGETIELVARHLREQ-NVTRMMVANRTLQRAQLLAEEFGAQ------------
HEM1_SHELP       TKVLLIGAGETIELVARHLKDN-GVDSMIVANRTISRAEAMCEEFGAT------------
HEM1_PSYIN       SRVLLIGAGETIELVGKYLIEH-QVPNITIANRTLSRAMALVEQFDAQ------------
HEM1_ALISL       STVMLVGAGETIELVAKHLNDA-GCKQLIVANRTRERAMILADQFNAD------------
HEM1_PHOPR       TTVLLVGAGETIELVSRHLVEQ-GCNKLIVANRTKERAANLAEEFGAE------------
HEM1_SODGM       VTVLLVGAGETIELVARHLREH-KVKRLLIANRTPERAQRLAEDVGAD------------
HEM1_PROMH       LTILLVGAGETIELVARHLREH-QVKKIIIANRTKERAQRLANEVDAE------------
HEM1_COLP3       TKVLLVGAGETIELVAKHLYEN-NVGKITVANRTLARAENMATKIGAD------------
HEM1_PSEHT       TNVLLIGAGETIELVAKHLYQN-EPQNITVANRTLERARSLADQVSGD------------
HEM1_PSEA6       SNVLLIGAGETIELVAKHMHEQ-GVKKLSVANRTLARAEAIAQPLGAT------------
HEM1_IDILO       SKVLLIGAGDTSELVAQHLKQQ-GVTEILVANRTLQRASEMAERVGAT------------
HEM1_ALCBS       SRALLIGAGEMIELVARHLSEQ-QVQEITIANRTQERASELAAAVGGR------------
HEM1_CHRSD       ARALLIGAGETIELVARHLREA-GIRGLTVANRTRERAELLAHEVDAE------------
HEM1_HAHCH       NTALLIGAGETIELVARHLYRA-GVRSLIVANRTLSRARDLAAEFHGS------------
HEM1_MARHV       NKALLIGAGKTIELVARHLAEA-GVRSFLVANRTLEKAQALAEAHGGK------------
HEM1_PSEU5       SQALLIGAGETITLVARHLHEQ-GVKRIVVANRTLERASALAAELGAH------------
HEM1_SACD2       DTALLIGAGETIELVARHLAEQ-GIKKLIVANRTLGNARSLAEQFGAE------------
HEM1_MARMS       STALLIGAGQTIELVARHLKEN-GIKHIIVANRTLARAQILADELNAE------------
HEM1_ALKEH       RTALLIGAGETIELVARHLREQ-GLKNLIVANRNLERARQLVELEGGE------------
HEM1_HALHL       RTAVLVGAGETIELVARHLGQQ-GIGQVLVANRNVERAKRLAEAHDGE------------
HEM1_NITOC       TTAFLIGAGETIELAARHLFTN-GVGHIIVANRNLDKAYQLANQFNGY------------
HEM1_METCA       LTAILVGAGETIELTARHLTEN-RIGHLIIANRTFDRAHTLANQFGGF------------
HEM1_HYDCU       QTALLLGAGETVELVARHLKES-HIGNLIIANRTLSKAHQLTESLGGY------------
HEM1_COXBR       CQILLIGAGETIELVFSHLYNQ-GARHFFIANRTLTRAKQIAEPYHAQ------------
HEM1_LEGPL       LSVFLIGSGETASLVAKYLHQH-GVHRFLIASRTLENAQKLAETFDGK------------
HEM1_XYLFT       STVLLIGAGETIQLAAKHLSEG-RVQRLLIANRTHAKAQMLASQHGGY------------
HEM1_DICNV       RTAIIVGAGETAQLVARYLHDL-KIKRLIIANRTLNRAQQLAESVGGY------------
HEM1_VESOH       QTVLLIGAGEMIELCAQYLNKK-KVSNMIIANRTIENAQKIANLYQAQ------------
HEM1_FRAP2       KNVLIIGAGQTGELLFRHVTAL-NPKHIMLANRTIEKAEKITSTFNNAS-----------
HEM1_WIGBR       IKVMLIGSGTINELIAKQLFKY-KIKDLFISNRTIDHAKNLAIKVNGCV-----------
HEM1_PSYCK       RTLLVVAAGEMNRLVATHIAGL-GVGRVIICNRNPERAEALAAELRNPNR----------
HEM1_PSYWF       TTFLLIAAGEMNRLVAQNIAGL-GVKRILICNRTPERANLLAQELAHLGI----------
HEM1_ACIAD       LTVMMVAAGEMNTLVAKHLAEM-GVAKVIICNRSRERAESLAQEIAH-QV----------
HEM1_METBF       KSVLVIGAGEIGVLVAKALAAK-DIEAIYIANRTFKKAEELAYELG--------------
HEM1_METBU       KHILVIGTGEMGTLVTRALSHR-DMHVIYLANRTYEKARDLAEELG--------------
HEM1_METTP       KSVLVIGAGETGELISKALVSK-NIGSLYVTNRTFGTALSLAASLG--------------
HEM1_METAR       RTILVVGAGEMGTLVANAMAEK-SLRAIYVANRTFEQAEKLASSLQ--------------
HEM1_ARCFU       KKALLVGAGEMGTLVAKAIAGK-EVEAVLIANRTYEKAEELAKRIG--------------
HEM1_METKA       KTVLVVGAGEMGKTVAKSLVDR-GVRAVLVANRTYERAVELARDLG--------------
HEM1_METVS       RNVLLIGAGEIGTLVAKALIEK-HIKAVIVANRTYERAETLAKELK--------------
HEM1_META3       KNILVVGAGEIATLVAKALIEK-NIRAIVVSNRTYERAELLAKKLN--------------
HEM1_METJA       KNVLLIGAGEMANLVIKALKEK-NIKAIIVANRTYEKAEKLAKELG--------------
HEM1_METTM       KKVLVIGAGKMGTLVARALAEK-HLKAIMVANRTYERAYQLACELG--------------
HEM1_METS3       KSVLVIGAGKMGKLVAKALAEK-NLNAIFVANRTYYVAVELANDLN--------------
HEM1_METST       KNVLIIGAGEMGTVVSKALLEK-ETNTIVVANRTYDKARQLAQELD--------------
HEM1_METMJ       RHILVVGSGEMGVLVAQALAAR-GLTAIYVANRTYERAVMLADKIG--------------
HEM1_METB6       RHILVVGSGEMGLLVAQALAAK-HLTAMYVANRTFGRAVILAEKIG--------------
HEM1_METHJ       RHILVLGTGEMGVLVTQALAAK-QLSAIYVANRTFDRAQCLAEKVH--------------
HEM1_METLZ       KNILVVGGGEMGTLVARALCEK-NLRAIYVTNRSFDRAVLLAEEIK--------------
HEM1_HALMA       GTALVVGAGEMGQLAAEAL-SE-EVDRLLVANRTVPHAEHIAESVDID------------
HEM1_NATPD       STALVVGAGEMATLAAKAL-DD-PASRVIVANRTRERAERLAEELSTT------------
HEM1_HALS3       ARAVVVGAGEMGALAAKAFASA-TVAEIVIANRTPARAVRVADMVSVP------------
HEM1_HALWD       RKALVIGAGEMGSLVAESLAST-NISEVVIANRTIENAESIAETINSP------------
HEM1_ALKOO       REILVIGNGEMGRLMTNVLIEN-GYRATMTLRQYRYHANVIPL-----------------
HEM1_CLOTH       SKALVIGNGEIGRLMASILIEN-GYDTTITLRRYRHGDNIIPL-----------------
HEM11_LACP7      KKCLVIGNGEMGKLAATKLEEE-GSDVTVTVRQYRSGIIEIPV-----------------
HEM12_LACP7      KSCLVIGNGEMGRLMTEKLLEK-KCKVWMTLRQYKKSKAIIPE-----------------
HEM1_CLONN       KKACIIGAGDMGRLALKHLINE-ELEEIFVANRTYNNVIDLLKEF---------------
HEM1_ALKMQ       KTVLVVGFGKMSRIAIENLLCK-GIKRLYICNRTKESVQELIEKH---------------
HEM1_CLOAB       RRFMVFGFGDVGSLVCKYILSS-DFDVLYIVVRNKAAVSIKDKR----------------
HEM1_CLOTE       KNFMVLGYGAVGSLAVKYILSG-EFDKLYIVVRNPSVVDLRDDR----------------
HEM1_CLOK5       RKYMIIGFGKIGQLLFKYLNNS-QAQIIYIAVRDLNKVHDSYKKC---------------
HEM1_CLOBB       KKFMVLGYGDVGRLTMKYLLAH-NINEVYLAVRNKKIKDEIMDK----------------
HEM1_CLOB8       TKFMVLGYGEVGQLVMKYLLSH-KIQTVYLVVRNPKIKDEIQDE----------------
HEM1_CLOP1       RKFMVLGYGEIGKLAIKHLLSH-KVECIYLIVRDKSKASDLEGE----------------
HEM1_CALS8       RKIAIIGLGNIGFLFCNYFKNS-DVDKVFLIGRKNERIDQFVKL----------------
HEM1_CAMC5       KTAVVIGAGEMGELAAKHLITS-GANVIIINRSSDHVEELVENL----------------
HEM1_CAMFF       MSAVVIGAGEMSRLAAQHLINA-EVNVIIINRDEIKAQTLAKEL----------------
HEM1_CAMHC       TTAVVVGAGEMAELACKHLITH-KAKVIIINRNIDHAKKLAESL----------------
HEM1_CAMJD       KKAVVIGAGEMGELAAKHLIAA-GAKVIILNRDLQKAKDLCERL----------------
HEM1_NITSB       MSALVVGAGEMGRLAAKHLISH-GCNVILVGRDLEKTKTVAQEI----------------
HEM1_WOLSU       DTAIVVGLGEMSQLTIKHLTAL-GCNVILVNRDKAKAEAFAKEF----------------
HEM1_HELHP       LPVLVIGSGEMGRLACKHLQNA-NAQITLVSRTKENARKLALEL----------------
HEM1_ARCB4       VKALVVGAGEMSELTVKHLIAS-GFDVTIISRDTKKAQNLASTF----------------
HEM1_SULDN       KKALVIGVGEMSEITAKHLLSS-GADVYITNRTKHKAEKLAS------------------
HEM1_SULNB       MKGIVVGAGDMGVLAAKHLLRV-GCDVVLIGRDLDKVQTVADSL----------------
HEM1_HELAH       KKALVIGLGEMSQLVIKHLLNK-QFEVLVLGRNAAKFEDFLKELEE--------------
HEM1_CHLTB       ASLLFIGYSEINRSVAYHLRRQ-GFSCITFCSRQQLPTL---------------------
HEM1_CHLMU       ASLLFMGYSEINRSVAYYLQKQ-GFSRITFCSRQPLSLR---------------------
HEM1_CHLFF       DKLLFIGYSDVNRKIAKGLSAK-GYRNLIFCSRKNIPI----------------------
HEM1_CHLPN       TNFLFVGYSDINRKVAAYLYQH-GYHRITFCSRQQVTA----------------------
HEM1_SALRD       TEIVLVGAGKMGRLALEALADE-SLASLTVVNRSPDRAREVASPF---------------
HEM1_CYTH3       ANILIVGLGEIGADVCRNFKANTSFKNITLTNRSPLKSEALAAEC---------------
HEM1_RHORT       TCLLLLGTQEMGELIAEQLQMA-GVGRLVVCAPRRPRAEAVAARL---------------
HEM1_CUTAK       ARVLVMGTGSYAGASCAQLSSR-GVAEIQVHSASGRAAGFAR------------------
HEM1_IGNH4       KKLLVVGAGMAGRVVAVNAAKR--GAKVIIVNRTLSKAKELAEEV---------------
HEM1_HYPBU       KHVVVVGAGEAGSIMASLVREEAPTARISIVNRSVDRARELAGKV---------------
HEM1_AERPE       ARVGIVGAGMAAVGIARALCTRWRPRVVAVFNRTPERGWEVAGKCRGV------------
HEM12_NOCSJ      RDLLVVGTGQVAVSVVAAAREA--GARLTVCGRDPERAAAIAPA----------------
HEM1_CENSY       RSILLIGTGEVSTLVAKSLGKR--GYDFSVASRTLQRSQAFCSAMG--------------
HEM1_THEM4       KKIFVIGTGMMGQKVIKYLVSR--GADIYISNRTIKKAYEIKKMFS--------------
HEM1_CALMQ       SRIAVIGAGSIGSDIVRRLAEK-GFRNVIIVNRTLDKAKAAALRY---------------
HEM1_TROWT       VRAIIVGTGKYASKALALLKER-GVVDISVYSPSGHVNNICNT-----------------
HEM1_PARUW       PKILFVGASEINRKILHFLKSK-QYSDMTICNRSEIRSKELAILY---------------
                     . .                                                     

HEM1_ARTS2       --RGGKALDSDTLPAAVAAADVMIGCSGSDTRVEAEELARVR---AGS------------
HEM1_RENSM       --RGG--TAAESLEEALGSADLVIGCSGSDQRVSAETLADIRRRTGTA------------
HEM1_CLAMS       --HGIPAVEGRDLLKALAASDMVVTCSTAPTAVLAAHHMQGAAAVSGD------------
HEM1_LEIXX       --HGVTAVPAGGLGAALAHAHLIVTCTTVRDYTLTPGNFGQAQQQDG-------------
HEM12_PYRAR      -GAEARPLTREEVERCLLECDVVFSAVHTLEYVIDMIPPGA-------------------
HEM12_PYRCJ      -GGEARPLTEEEVEKCLAECDVVFSSVHTLQPVIKRVPPEA-------------------
HEM11_PYRAR      -GVEVWPLSERSVERCLEDFDVVFTAVATFEPIIKSVPRDA-------------------
HEM11_PYRCJ      -GVEVRPLTSENVEWCLREFDVVYTAVSSFEPVVVYVPPGS-------------------
HEM1_SULAC       -GYNAELL--DFQKVNEYDLVFIAINNSNPSQLRLD------------------------
HEM1_SULTO       -GFKAEPL--DFYKINNYDIVFVAIYYDK--KINLP------------------------
HEM1_SACS2       -GYNYEKL--DLDKLGNFDVAFISIYHENL-RLENK------------------------
HEM1_METS5       -GYSYFPL--DFSRLHNYDIIFSAIFYPE--KVKAP------------------------
HEM1_THEAC       -NYSYTTI--NDLHELIMRNDAIISATSSKTPIIRR-EEMV-------------------
HEM1_THEVO       -EYEYVLI--NDIDSLIKNNDVIITATSSKTPIVEE-RSLM-------------------
HEM1_PICTO       -GYSYDSI--KNLNNLIKNSDIIIAATSAGNYIVKDLGDLA-------------------
HEM1_PROA2       -----QVLPFETFRDNLHEFDIIITAVSTKDYVLKAPDMHQSMQKRRL------------
HEM1_CHLT3       -----KILPLEEMTERLHEFDIVVTAVGGNDHIIKKEHVAAAMQKRHR------------
HEM12_FLAJ1      -----IVKDYADLKQELHQADVLVVATGAQNPTIDKASLALQK-----------------
HEM1_GRAFK       -----IVKDYADLQAEIRNSDILIVATGAQNPTISKELIYPKK-----------------
HEM1_BACME       ---SGEAKPFADLQHALSEADILISSTGANDYVVTKQMMSEAERTRKG------------
HEM1_BACP2       ---SGEPKSLNQLEKTLSEADILISSTGAKQFVITKEMVESANKKRKG------------
HEM1_BACCN       ---MGHAKPLSELQCALLEADILISSTGSSNYVITKEMMKKVERMRSG------------
HEM1_LYSSC       ---HGQAKSMKELQCSLLEADILITSTGATDYVIDYELMQFVERLRKG------------
HEM1_GEOTN       ---DGEAKSLGELSCALLEADIVISSTGAKGYMLTKEEMAPLEKMRKG------------
HEM1_OCEIH       ---NADVESIDQLPVILQQADILISSTGADSIVVTKEMMEKVQKQRKG------------
HEM1_BACSK       ---AGTARSFAELNDALKEADVVISSTGARDFVVTKENAADALKKRKG------------
HEM1_BACHD       ---LGVDRPYNELTEAIVEADILISSTGATGYVVTSDMVSHALKKRKG------------
HEM1_PAEMA       ---DGTPCTMQEAMERLADVDILISSTGAEGIRDHVGQVERSMKRRPD------------
HEM1_STAS1       ---HVKFEPMESLPRLLVDVDIVISSTSSENYIVTNEMLQSISTERKH------------
HEM1_LISW6       ---QAKVGTYEEMNNYLSIADIVLVSTSADEPIIKQKDMQILMSQ-KS------------
HEM1_EXIS2       ---EGSAHSINEMQCGLLRADIVISSTGAKRAIIKREDIAAAQLFRSD------------
HEM1_STRSV       ---RVSAHGWDELEEVLADADVVFSAVKTEEYIIFPSMLKE-------------------
HEM1_LACRJ       ---VVEARPFNQLATVVHNVDAAIFAATVKQ-PLFKADEQI-------------------
HEM1_SYNP2       --VDLQLELLPEMLNVVEQADIVFTSTGATEPILDRAKLENL--D--L------------
HEM1_ACAM1       --ADLKLHTLADMQAVLTESDLIFTSTASTEPLLDRDILEPIVCD--R------------
HEM1_SYNP6       --LQIQVGLLSGLMNAIVEADIVFTSTSATDPILDRAKLEMVLAP--E------------
HEM1_THEEB       --VRFELFTMTDLLPIVAAMDLVFTSTAATEPLLDRDNLGAVLVG--D------------
HEM1_CYAPA       --ANINIYNLSELKTILQNSDIVFTGTSSQEPIITPELINDCDNL--P------------
HEM1_SYNJA       ---PIQVLPWESLLSSIAESNLVFTSTGATQPILTYEQLAGVLQP--D------------
HEM1_GLOVI       ---MLPVATVDELTNYVPCSDLIFTCTGATEPLLTLEKMSSLRR---D------------
HEM1_SYNS3       --LPIQCRGLDDLDQCLSTCSLVFTSTAVDDPIIDANRLNALNR---R------------
HEM1_SYNR3       --LVITCCGLDQLDAQLASNTLLFTSTGADEPIIDRQRLDAITR---Q------------
HEM1_PROMP       --LEINCKSLNELDKNISLSSLVFTSTASEKPFIDLARVEKISL---N------------
HEM1_FRASN       -LHDARAVGLAEIAHEVGRADLVISSTGASGLVVGHDAVRASLAGR---------G----
HEM1_KINRD       -AVGGRATGLDDLRAEVAAADLVVSCTGAVGHVLDVATVASALLDR---------P----
HEM11_NOCSJ      -EYGARSATLAELAAELAVADVVISCTGATGTLITRDMVAAATVD---------------
HEM1_THEFY       ESVRSSAVPFEDAARHLADIDLVISCTGAQGIVLTAEQVAAGGDR----------A----
HEM1_MYCA9       AGVNAQAITLDNLDQALAQADVVVSCTGAVRPVISLADVHHALE-----------G----
HEM1_RHOJR       NGVEAEALELSELPAAMAQADVLVTCTGAVGAVVTLADTHRALAQPGR------DA----
HEM1_SACEN       DGVPASAVALDGLRSAISWADLVVTCTGAVGAVVTTEHVETGDR----------------
HEM1_SALTO       --YGATAVPIADLTATLSTVDIVVAATAAPEAVLTRAVVTQALAGRN-------PS----
HEM1_ACIC1       -RYNGQAAALEKLADLLAETDVVVSCTGSVHPVVDAATLTKAVAGR--------------
HEM1_COREF       AGVPAEVVDFADRASVLDRVDMVVSATGADDFTVKPADIPAGV-----------------
HEM1_CORDI       AGVAASAIEFERRMDVLCDVDVVVSATGANTFTIEAANIPAAHG----------------
HEM1_CORJK       AGVDASAVPLDGVTDCLSAVDIVVSATGAVGNVVTEQDVRAAVGAAGGV-ASVAGR----
HEM1_CORU7       AGVPARGIGLDELPAALTGADIVVSATGAVGTVVSAADIKAAQQVRDG------------
HEM1_ROSS1       --YGVAWRPWSDLEDALAASDIVVSCTSAPGIVLSQQMVERAAAGRSTP-----------
HEM1_HERA2       --HKVAAKPISELAAVLQASDVVISCTSSPELMLDFEQAQLLQAQRQRQ-----------
HEM1_CHLAA       --YGAEMLDFGALPQALARADIVISSTAAPVPIIYRHHVAEAIAHKQRARACGECD----
HEM1_RHOBA       --FGADAESMDSLHDQIVQADLLIGTTSAEEPIVDASTFAALNAKRGG------------
HEM11_ANADF      --VGGAFRGWDELPRLLVEADVVIVSTGAPTYVVTRDLVQQAMKARRR------------
HEM1_MYXXD       --VGGQARPFEELLGLVAAADVVVCSTASQAPLFTRDNVGALGRGRRG------------
HEM12_ANADF      --VGGVARPLEALGEELAQADVVVSAAPVAPDAFQPEAMAELSRSRK-------------
HEM1_THET8       --FGGEAFGLPALPQVLRQADLVVASAAAPHYLVGPED-----LPKRA------------
HEM1_DEIRA       --LGGRACPAEELSAALPEVDVVIASSAAPHYVVTAQNVREALAGRPG------------
HEM1_RUBXD       --FGGRAADLGDLPRELARADIVVSSTGSGEWVIRGPE-VAAALESRE------------
HEM1_CARHZ       --FNGIAVPFAKIYDILAEVDLVISCTGAPHLIIHKEQLELVIGNRQ-------------
HEM1_HELMO       --CGGEAISFADVNHRLEEADILISCTAATHYVIRKSMVEQVMDRRGG------------
HEM1_DESRM       --FDGTAVKFDQLFQYMNRADIVISSTAAQHYVIKTSDMQKVMEQRVD------------
HEM1_PELTS       --FRGRAVRFDELYRCMEAADIVISCTAASHCVVKAEEVSRVMDKRRG------------
HEM1_DESAP       --FGGRAVRFDELYRWMGHADIVISCTAASHYVIRAEPMTSVLAERGG------------
HEM1_MOOTA       --IGGQAVRLDALEDYLPRADIVISCTAASHYILHRDQVARAVAARPG------------
HEM1_DESHY       --FSGRAIPYEELDTALAEADIVISATAAAHFVIKPERMRRVMEQRRQ------------
HEM1_AKKM8       --IGGQAIRYDVWGNYLRDIDVVVAATAAPHCIITRETLLPLRASRKY------------
HEM11_KORVE      --VGGIAVALEDRAPYLDHADIIVSSTSCPHYVIEKADAERIQAARGG------------
HEM1_DESAG       --FDGEAILFEELFTRLPEVDIVISSTGAQQAVIRAKDIRDVLKRRKN------------
HEM1_LAWIP       --FRGEAIPFEKLVTYLAEVDIVISSTGAPQTIIHFNDIKNILSKRKH------------
HEM1_DESPS       --FGGTAICMEELYAQLEDVDIIISSTGAQHIIIESAEVRPIMRVRRN------------
HEM1_SYNFM       --FRAETTPFDHILNALKNTDIVLSSTGAPEPILKYNDVRARMRERRN------------
HEM1_SYNAS       --FEGKAVVLEQVPEVLKSVDIVISSTGASNYVLTRDMVAAALRRRKN------------
HEM1_PELPD       --FGGEAIPFEELFQELHRADIVLSSTGAPHTIIAPRDVEAVVKRRKF------------
HEM1_PELCD       --FGGRAIPFAEFPLYLNQADIVLTSTAAGGLLLTRAQLEQIIRQRKN------------
HEM1_MAGMM       --FDGHAFPIEALAENLHRADIVISSTGSTVYMVGPDMVKQALKSRRQ------------
HEM12_KORVE      --FNGEAVPIEHLYETVDKADIVLSSTGAPIAIFRKEHGEKFLSRRKN------------
HEM1_SOLUE       --FQGTPVEYARFTAMLPEVDILIASSGAPHYILHKDEMQRVISARRN------------
HEM1_THEYD       --FNGVAVPFGNLKEQLVKTDIVICSTGAPHYVITEQMLKEVMPLRKH------------
HEM1_SULSY       --FSGSAIRFEKIQEFLPEADIIIVSTGAKEPILKKEDVKRAIKSRK-------------
HEM1_AQUAE       --LSGNVLRFEELKEYLPLMDIVIVSTGAKDYILKREDFERSVRERHY------------
HEM1_NATTJ       --FGGLYASYDQLSEWLNEIDIVITSTGAPHFVIKEEQIKRAMKSRKY------------
HEM1_RHOFT       ---GAEVMRLADLPDRLHEFDAVVSCTASTLPIIGLGAVERALKRRKR------------
HEM1_METPP       ---GAESIRLSDLPQRLHEFDAVVSCTASSLPLIGLGAVERALKVRRH------------
HEM1_RALSO       ---NARAVRLAELPARLGEFDIVVSCTASTLPIIGLGAVERAIKQRRH------------
HEM1_POLAQ       ---QAESLKLSELPGRLHEFDIIVSSTASSLPIIGLGMVESALKQRRH------------
HEM1_JANMA       ---NGKAIRLADLPDQLASYDIVISSTASSLPIIGLGMVERAIKARRH------------
HEM1_BORA1       ---SAGTMKLADLTERLAEFDVVVSCTASSLPILGLGMVERATRQRRH------------
HEM1_AROAE       ---GAEVMRLDVVGEMLPHFDVVVSCTASPLPIVGLGMVERAIKARRH------------
HEM1_DECAR       ---GGTAIRLDELGEHLAQHDIVVSCTASPLPIIGLGMVERAIKTRRH------------
HEM1_NITMU       ---NGQVITLNELPDQLALHDIVVTCTASTLPILGKGMLERAIKARKH------------
HEM1_THIDA       ---NAGVIPLTALPDEVAAYDIIITSTASPLPILGKGMLERAIRQRRH------------
HEM1_METFK       ---GGTSMLLADLPDRLAEFDIVITSTASQLPIVGLGMVERAIRARKH------------
HEM1_NEIM0       ---NAEPCLLSDLPAILHEYDVVVSSTASQLPIVGKGMVERALKQRQS------------
HEM1_CHRVO       ---NAIT--LAELPESLARYDVVVTSTASQLPIIGKGMVERAIKARRH------------
HEM1_MANSM       ---YIQVLSLQQLQDGLNQADIVISSTGSPIVLITAEMVKQAQQKRRN------------
HEM1_PASMU       ---NVQVLALTQLQEGLNQADIVISSTGSPTILITQDMVKIAQKARCD------------
HEM1_HISS2       ---KIDIFSLDRLSEGLKRADIVITSTGSPHVLISRNLIEQAQQMRHY------------
HEM1_ACTP2       ----MQILSLSALQIGLNQADIVISSTGSPDMLISKEMVEIAQKQRQF------------
HEM1_AERS4       ------VMTLEEIPDYLHEADIVISSTASPLPIIGKGMVERALKARRF------------
HEM1_SHELP       ------AITLEQIPDFLPKADIVISSTASPLPILGKGMVEKALKQRRH------------
HEM1_PSYIN       ------AITLGEIPNHLAQADIIISSTASPLPIIGKGMVERALKARRN------------
HEM1_ALISL       ------VISLPEIPEHLSKADIIISSTASPLPIIGKGMVESALKQRRH------------
HEM1_PHOPR       ------VIGLPEIPEHLHRADIVISSTASPLPIVGKGMVEKAIKARRH------------
HEM1_SODGM       ------VINLAEIDSQLGEADIIITSTASTLPIIGKGMVERALKQRRY------------
HEM1_PROMH       ------VITLSDIDESLSQADIVISSTASPLPIIGKGMVERALKKRRN------------
HEM1_COLP3       ------VITLAQIPEHMCNADIVISSTGSTLPIIGKGMVEQALASRKH------------
HEM1_PSEHT       ------VIALAQLPERLHKADIVISSTASTLPIIGKGVVEQALKQRRY------------
HEM1_PSEA6       ------TLTLTQIPAHLKDADIVISSTASQLPILGKGLVERALKDRRH------------
HEM1_IDILO       ------AHSLSELSELLPQADIVVSSTASTLPIVGKGSIEKALKKRRH------------
HEM1_ALCBS       ------GISLEELPVALERADILISCTAAPLPIMGKGMVERALKKRRH------------
HEM1_CHRSD       ------AISLGEIPQALAHADIIISSTASPLPILGKGMVESALKKRRH------------
HEM1_HAHCH       ------AIGLSDIPEYLHRADIVIASTASPLPILGKGAVEKALKRRKH------------
HEM1_MARHV       ------GILLSEIPDHLSDVDIVISSTASPLPILGKGAVERALKKRKH------------
HEM1_PSEU5       ------AILLADIPDELHNSDIVISSTASQLPILGKGAVEQALKRRKH------------
HEM1_SACD2       ------AILLADIPEHLHRADIVISSTASQLPLLGKGAVEQALKRRRH------------
HEM1_MARMS       ------AIMLGDIGDYLSQADIVISSTASQLPIIGKGMVERATSQRRH------------
HEM1_ALKEH       ------AIPLSEIPTRLPEADVLVASTASPLPILGKGTVERAVRKRRH------------
HEM1_HALHL       ------AMSLNDLPRRLPEADVVVSSTGSSLPILGKGTVERAVRARRH------------
HEM1_NITOC       ------AIPLAEMPKHLSEADIVISSTGSQLPILGKGTVERALRIRKH------------
HEM1_METCA       ------AISLEELPKHLAKADIIVASTGSPLPILGKGSFESALRSRRH------------
HEM1_HYDCU       ------AISLHEIDDHLHEADIVIASTASPTPILKTEMVANALKKRRN------------
HEM1_COXBR       ------AIRLSDIPTYLPKVDIVISATMSQLPLVGKGAVESALRQRKR------------
HEM1_LEGPL       ------TLSIGDIPQYLPLADVVISATACPLPFINKSLVEHALEQRNH------------
HEM1_XYLFT       ------ALPLTELNLHLAEADIIFSATAAPTPIVTQSNVESALHIRKR------------
HEM1_DICNV       ------ALSLPQLADHLHEADMIFGCARADVFLVTQNMAITALQRRQN------------
HEM1_VESOH       ------SIGLKQFSSVIHKADIIISSTAASVPIIGKGLIESALKKRKH------------
HEM1_FRAP2       ------AYYLSDLPKLIKKADIIIAAVNVTEYIVKCEDVGEKSR----------------
HEM1_WIGBR       ------VEF-NEIFKNLNKMQVIITSTYSRKLIITYKIIKSIIEKNKN------------
HEM1_PSYCK       ---RIEVRTLQELPQVLAEADIVSSCSGSMDILIDKTMTLRALKSRRY------------
HEM1_PSYWF       ---QIEVHPLTELDSLLYQADIVSSCSGSMDMLIDKAMTRRALKKRRY------------
HEM1_ACIAD       ---EVEIIGFDQLAANLHRADVVSSCTGSLHQVIFYQDVKAALKKRRY------------
HEM1_METBF       ----GYAVKLNDVQTQLKNADVVISGTGAPHYILTREIVEKAIEER--------DK----
HEM1_METBU       ----GEAVMFDQLEKYVRAADVVISATSAPHYVLKGDLVAKVMEGR--------E-----
HEM1_METTP       ----GTAVPYEEMKRKIREADVVISATSAPHYILLKDDIERAMEGR--------K-----
HEM1_METAR       ----GVAIRLERLCDYMGSADVVICATGAPHLIITKKMVEQCKGEK--------P-----
HEM1_ARCFU       ----GVAVKFDKLVDYLKVCDVVISATSAPHAVITRGDVERAMRER--------SQ----
HEM1_METKA       ----GEAVRFDELVDHLARSDVVVSATAAPHPVIHVDDVREALRKR--------DR----
HEM1_METVS       ----GMAVHFDKLKEAINFSDVIICATSSPHYILEKSDLLDV------------------
HEM1_META3       ----GMAVHFDKLGEAINYNDIIICATGAPHAIIDKDRLKNIK-----------------
HEM1_METJA       ----GMAIKFDKLEEALRYADIVISATGAPHPILNKERLKNA------------------
HEM1_METTM       ----GDAIHFDRLNRALRDADVVISATGSPHYILTRERVMDAVPPE--------RR----
HEM1_METS3       ----GHAVLFNELGKYVQTADLIISATGAPHYILNKERLEKTDGDF--------K-----
HEM1_METST       ----GEAIKFDEMNNELVNIDIVISSTGAPHSIISKER-IAFLPEE--------HL----
HEM1_METMJ       ----GRAVNFKDLYRYIALSDVVISCTAAPHPVIRTEDIRAVMEERLWP---LDTH----
HEM1_METB6       ----GVAVRMNELYHYITLSDVVISCTSAPHPVIHKTALKEAMRDRCWP---VEGH----
HEM1_METHJ       ----GTAVPMADLYRYLTMSDVIICCTAAPHPVIKVQEVMEALKGRSWP---LDHS----
HEM1_METLZ       ----GRAMRLDQLYPCIALSDVVISCTGAPHLIIHADELAETMNERFWP---LDLE----
HEM1_HALMA       ----ASALALDGIEAAVSEASAVISATGSGDQVFDIGTFSDS------------------
HEM1_NATPD       ----ASVVGVDSVDEAADAADVVVSATGSEDYVIDTADLGGV------------------
HEM1_HALS3       ----AEATTLADARGRLDAADVVVTATGSPEHVLPASAFADA------------------
HEM1_HALWD       ----AYAVSLDSLTEVITEASIIMTATGYGKYLIEPTDIDGA------------------
HEM1_ALKOO       ---NANTVDYSNRYEKMKDCDVVISATLSPHYTVEMENLKKID-----------------
HEM1_CLOTH       ---GAKTIEYVARYEKLKDCDVVISATLSPHYTLEIDKIDRI------------------
HEM11_LACP7      ---GCNRINYGDRLEHIVEYDFVISATSSPNMTIHLEQLSNLEF----------------
HEM12_LACP7      ---GSGVVLYDERYEHIAVMDYIFSATKSHHFTINKSMFENIRLK---------------
HEM1_CLONN       --PKIKLIDYEKKYEILDNVDILITATAAPHLIIKKEQLQNIKQE---------------
HEM1_ALKMQ       --PQIHYLSYDQKYEMLNGVDAVISATGAPHFIFYKEDMEKIYQK---------------
HEM1_CLOAB       ----IKVLSFNEKNSYYDDVECMISCTSAPHPVIWEK---ELP-----------------
HEM1_CLOTE       ----MTIINFNERGKYYKDVDCIISCTSAPHVVVDAF---ELPK----------------
HEM1_CLOK5       --GKIRFISFKDRKSYYNDIDCIVSCTSAPDKIISKG---DLP-----------------
HEM1_CLOBB       ---RVNVIDFEEKNKYINDMDCVISCTSAPHIVIKKQ---DINNI---------------
HEM1_CLOB8       ---RVKVITFEEKNKYINSIECIISCTSAPHPVVKTE---DISES---------------
HEM1_CLOP1       ---IVEVLDFNEKNQVINEIDCIVSCTAAPHTVVRNE---DIKTE---------------
HEM1_CALS8       ---YPGKFEYSDKKDAISEAQCLICSTSAPHAVVHKD---DIPD----------------
HEM1_CAMC5       -GDKASWDSILKLKEYINKYDLIFSSTSAPHAIITGELIEPQEF----------------
HEM1_CAMFF       -GELASYASFDKLSEYINRYRLIFSATGAPNAIITNEIIEQKDF----------------
HEM1_CAMHC       -GENASIAEFSNLGEFINKYALIFSATGANKPIITDLLAKPQNF----------------
HEM1_CAMJD       -GVLSEYDSLENLKKYLNQYEFFFSATNAPNAIITNSLIEELPY----------------
HEM1_NITSB       -DPDIRVEHVSNLQKLINSYRLLFSATSSKNPVITKDMVKEQSF----------------
HEM1_WOLSU       -GGMVSVEGFPRLGELLNHHKMLFSATGAPHTVISKDMVEPKSF----------------
HEM1_HELHP       -DSSINIESWEHLEQLLGQYEVLFSATSAPNCIIQSKMVQVSQK----------------
HEM1_ARCB4       -EVHVNVEPYDKLTQLLITTPIMITATSAPYPIITKENAPSSNI----------------
HEM1_SULDN       -ECGAKVLDMQDLHKAVNEFEILFTATSSSEPIITDEIIKPCDF----------------
HEM1_SULNB       -GEDVKADTMENLTKYINRYRLLFSATSSPEPVITGDLIENETL----------------
HEM1_HELAH       -PKKVSFQNIENLNAYINAYELLFCATSSPNFIVQNCMVKETIF----------------
HEM1_CHLTB       ----SMRQVVREELCFQDPYRVVFLGSLELQYALPHSLWESIWDIPDR------------
HEM1_CHLMU       ----SMDQVLREEVCFQDPYHVIFLGSSELRHAFPRSLWEGVWDFPGR------------
HEM1_CHLFF       ----PYDTVARSQLSFGKPYDVIFFGSSESARDFPGLSLESLAGIPNR------------
HEM1_CHLPN       ----PYRTLSRETLSFRQPYDVIFFGSSESASQFSDLSCESLASIPKR------------
HEM1_SALRD       ---GGDTEPWADRHRAVATADLALVATGASDPVLHAPALPAPDE----------------
HEM1_CYTH3       ---GIEHVPFETLWEAVAKADLVISSVAKEEPLFTKEEIQKLSILSHK------------
HEM1_RHORT       ---GASVGDHGALLDLLPNADIVVVGVGGGLLALGEEAMRRTLKRRRN------------
HEM1_CUTAK       ---RHRVSEALDIDAALAQADLVVTCRGSGVPALSAEAARRAVDARRG------------
HEM1_IGNH4       ---GGEAYPLEELPRLLREADAVVVAVGGGSKVITRDAVAEVNK----------------
HEM1_HYPBU       ---RGEAYGLDMLPKLLAAADVVLVAVTVNEPVIKRSMLEDVGR----------------
HEM1_AERPE       ---ESLVLPLDELAKLINELDALFVAIAGSTNILERGRVERGVS----------------
HEM12_NOCSJ      ---GARVLGLDDLPGALLDADAVVFGTSSPERLLRAGDLGPGLSEHRSG-----------
HEM1_CENSY       ----GSPVLFEDVLDGFGGYDVLFVATGAPYFLVTYDKISEVLESRGG------------
HEM1_THEM4       ---EVNIVDFEEKYKHISSSDVVISATNAPHYVVEEKKVNSQKN----------------
HEM1_CALMQ       ---GFNYAPIDSLRSVIRDSDVVIFATSATNPLLRRRDAEELSG----------------
HEM1_TROWT       ----EGVRNIFNLQTALSGCDLVVGCSSVDKPVITKQDIETAQASGSRTSRVRPVGRPST
HEM1_PARUW       ---GLHLLPWCQLDSWHQYDWIIFGTKSSEYLIKPEKNFIPADN----------------
                                                                             

HEM1_ARTS2       ---------AQTLIAIDLALTHDFDPAVGELDGVELLTLESVRLAAPQEQ------AESL
HEM1_RENSM       ---------GEPLSVIDLALSRDFDPAITELPGVELLTLETVRLAAPSEQ------ESAL
HEM1_CLAMS       ---------GRRRLVIDLGLPRNVDPDVVTVEGVELLDLETISLHAPLRD------LTAT
HEM1_LEIXX       ---------IERRLVIDLGLPRNVDSAVAELPGVELLDLETISLHAPVAE------LNAA
HEM12_PYRAR      ----------SVKVVVDLGVPQSVAPG----LPIKVVRLSDLAELAQRYS---ALRKEEA
HEM12_PYRCJ      ----------RVKVIVDLGVPSSVVPN----LPVAVVKIEDLRELAEEYN---RERAGEV
HEM11_PYRAR      ----------RVRIIVDMGMPRNTAAG----LPVEVVTIDSLRDLADRFN---AMRDAEI
HEM11_PYRCJ      ----------RVKLVVDLGVPRNTAPN----LPVEVVTLDHLRELAEEFN---RQRAEEV
HEM1_SULAC       ----------KPKLVIDLSVPPVVYKT------SNVIYLDDLRVISDNII---LNKREDI
HEM1_SULTO       ----------NPKLVIDLSVPQIVLG-------NNVITLENLRSISDKIM---ETKILSL
HEM1_SACS2       ----------WNTLIVDITVPPLFTG-------NNVITLEELERISNLNF---KAREEEL
HEM1_METS5       ----------EGTVVIDLGSPPVFEG-------SNVYTLKDLEELSKATL---EERQREI
HEM1_THEAC       ----------EGKLYIDLGNPRNIEDK----PGADIITIDDIYSVSNRNG---SARMESV
HEM1_THEVO       ----------PGKLFIDLGNPPNIER------GNNVITLDEIYEISKKNE---MLREEKI
HEM1_PICTO       ----------RNKYFIDISKPENIDPEIS--KYARLLSINEIGKILKRNE---DEKKGEV
HEM1_PROA2       ----------KPVIILDLGLPRNVDPEIRSLQNMFLKDIDDLKHIIDKNL---EMRRSEL
HEM1_CHLT3       ----------DPILILDLGLPRNVAPEVGQVNNVFLKDIDDLKMIIDSNL---EKRRAEI
HEM12_FLAJ1      -----------PLLILDLSIPRNVDANVEEIPGVTLIHLDALSQITDDTL---ERRKQHI
HEM1_GRAFK       -----------ELLILDLSIPKNVSDDVHELENVKLIHLDHLSQMTDETL---EKRKQFI
HEM1_BACME       ----------RPLFMVDIAVPRDLDPELDELETVFLYDIDDLNGIVESNL---QERQKAA
HEM1_BACP2       ----------RPLFMVDIAVPRDLDPAISEVEGAFLYDIDDLEGIVAANL---KERRAVA
HEM1_BACCN       ----------RPLFMVDIAVPRDIDPEINELEGSFLYDIDDLQDVVEANR---AERLKEA
HEM1_LYSSC       ----------KPLFMVDIAVPRDIDPRVGDLPNVFLYDIDDLQGIVEANL---AERERAA
HEM1_GEOTN       ----------RPLFMVDIAVPRDLDPALAELETVFLYDIDDLQDVVAANL---AERQKAA
HEM1_OCEIH       ----------RALFLVDIAVPRDMDPAISELENVFLYDIDNLQHIVDDNL---ESRKQAA
HEM1_BACSK       ----------RPLFAIDIAVPRDIDPEIATISDVYLYDIDDLQNIVETNK---KERKKEA
HEM1_BACHD       ----------RPLFMVDIAVPRDLDPALASHDDVYLYDIDDLQNIVQTNL---EERRTEA
HEM1_PAEMA       ----------RPLFMIDIAVPRDIEPEIGVLENVFLYDIDDLEGIVENNL---EMRRAEA
HEM1_STAS1       ----------DSLVMIDIAVPRDIEPNIDTIHDMFSYDVDDLKGLVDANL---RERQLAA
HEM1_LISW6       ----------TSMLVIDIGLPRNVEHDCSYIPNFHLYDIDDLAGVVSANS---LERQKIV
HEM1_EXIS2       ----------RPFLLIDIAVPRDIEPTAGDLPGVHLYDVDDLTSIVQQNM---AERMKEA
HEM1_STRSV       -----------GAIVFDLCLPRSCHPSSS----LKLYNIENLTNQLEQYK---AERQEIA
HEM1_LACRJ       -----------STMIVDLGVPRNVAVNSTK---LKYYDVDHVHMILNSND---EKRRLMI
HEM1_SYNP2       ----------HTLILIDISVPLNVAADVEEIAGVRLYNVDALKEVVAQNQ---ASRRKMA
HEM1_ACAM1       ----------QSCMIFDISVPRNVHSNVNELSQVHAFNVDDLKAVVAQNQ---ESRRQMA
HEM1_SYNP6       ----------QRLMLIDIAVPRNVAADVVELTSVESYNVDDLREVVAQNQ---ESRRKLA
HEM1_THEEB       ----------RSLAIIDISVPRNVHANVTELGTVQLFNVDDLQAVVAQNQ---EARRQLA
HEM1_CYAPA       ----------SELMLFDIAVPRNVDPNVSQFDNIKVFNVDDLKVVVSQNQ---QTRRKMA
HEM1_SYNJA       ----------QPLLLVDISVPRNIDPGVEKLRGVQVFNVDHLSRIVEENR---AQRQKLA
HEM1_GLOVI       ----------QSLMIFDIAVPRNVATEVDELPNVQLFNVDHLKQVVEENR---AYRQLMV
HEM1_SYNS3       ----------SSLRLIDIGVPRNIASDVHEVSGVESHDVDDLQEVVERNQ---EARQQVA
HEM1_SYNR3       ----------ARLMLVDIGVPRNISSDAADVSGTLSYDVDDLQEVVERNV---AARQQLA
HEM1_PROMP       ----------NKLKFIDIGVPRNISNDVKHHAFIESFDVDDLEEVVSRNQ---EFRQKIA
HEM1_FRASN       ---------ARPLVFLDLALPRDIDPAVRELPGVTLIDIEALRVALDG-----AQVAHDV
HEM1_KINRD       ---------ERPLFLADLALPRDVHPDVATLRGAHLVDLEGLGADLAS-----SAVAQDL
HEM11_NOCSJ      ---------GRELSILDLALPHDVDPTVADLPGVSLVGLTDLADELRD-----SDAGQEV
HEM1_THEFY       ---------TRPLVFLDLALPHDIDKAVRKLPGVHLVDIEELRDAAEDGTA--TGQVADL
HEM1_MYCA9       ---------GRQLVFCDLGMPRDVDPTVAGLPGVVVVDMERIQREPTA-----RAAANDA
HEM1_RHOJR       ---------ERPLVICDLGLPRDVEPAVSGLPGVTVLDMESLQRDPAA-----GAAASDA
HEM1_SACEN       ----------GPLVFCDLGLPRDTAPEVAELPGVTVVDLATLQRRLSE-----QQGGNES
HEM1_SALTO       ---------RGPLVLLDLAVPRDVEPGVADLPGVQVIDIDRMAALVAD-----GPVAADA
HEM1_ACIC1       ---------TNPLGILDIALPHDVDPDVDRLPNVIRVDLETLRPVLEN-----TASSADV
HEM1_COREF       -----------QLMLVDLSMPRDIDDACAEVPGVDLVNIERLHRAKREDP---TGAAAEG
HEM1_CORDI       -----------DLMMIDLSLPRDISDDVAEVPGVHLVNIEKLRDVAS-------SGEAKD
HEM1_CORJK       ---------RGTKVMIDLSMPADIEHSVAEIDGVKLLNIEELTTMAG-------DRVQDE
HEM1_CORU7       ----------RQQVLIDLSMPRDIEQATADVPGVALLNIEELTGMTE-------DTIEDE
HEM1_ROSS1       ------------LLLFDLAVPRDIDQGVAEIPGVYLHDVDALEPICRTNR---ALRAAEA
HEM1_HERA2       ------------WVLLDLAVPRDIDRHVGALPEVWLYDVDDMQAICERNR---ASKAAEV
HEM1_CHLAA       ---------PPTMLLIDLAVPRDIAADVAQIPGVHLFTVDDLREVVSHTI---ELRSAVL
HEM1_RHOBA       ----------RIMLVLDLAVPRDFDPVIGDEPGVYLYQIDDLQAACNRNR---REREKQW
HEM11_ANADF      ----------RSLCLIDLAVPRNVDPACADLGEVFAYDVDDMEKVVTATQ---EARRGEA
HEM1_MYXXD       ----------RPLFMVDLAVPRDIDPAVGTLDWVHAYDVDDIQKFVADNA---AARAEEA
HEM12_ANADF      ----------RPIVLVDLAVPRAIPAATGAIRDVYLCDVDDLDRVMKAAM---SERAAAV
HEM1_THET8       ----------KPLFLIDIALPRNIDPRVGDLPHAYLYNLDDLKRVVDRNL---RARAGEI
HEM1_DEIRA       ----------RAMFLIDISVPRILDPEIASVPGAHLYNLDDLTAVVQRNM---QSRRAAL
HEM1_RUBXD       ----------EPLFLIDIAVPRDVDPVVQSIEGAFLYDIDDLQAVVERNA---EDRQEAA
HEM1_CARHZ       ----------HPLYLIDIAVPRDIDPEIAKLPNVFLYDIDKLQNVVTKNL---EERKKLA
HEM1_HELMO       ----------KPVFFFDIAVPRDIDPEVAQVPGTHLYDIDAMQHVIDRNL---AERRKCA
HEM1_DESRM       ----------QPIMMIDIAVPRDIDPEVRRIPNVKLYDVDHLQNVVDANL---EERRRAA
HEM1_PELTS       ----------RAIFMVDIAVPRDIEAEVGNLAGVTLFDIDDLKNVIDQNL---AERKQAA
HEM1_DESAP       ----------RAIFFIDIAVPRDVDPAVGHLPGVVLYDIDSLQSVVDANL---AERRRAA
HEM1_MOOTA       ----------VPLMLIDIAVPRDIEPAAGDLPGVKLYDIDDLQQVVLANL---EERKKAA
HEM1_DESHY       ----------RALLLIDIAVPRDIHPNVGELEGVTLFDIDDLRGVVDSHQ---KAREEAA
HEM1_AKKM8       ----------RSLFLIDISVPRNISPDVADIDEVYLYDIDTLTQLADEAK---RSRKQEV
HEM11_KORVE      ----------KPIVMVDIAVPRDIDPAVREVPGVHLFDMDDLEKVAKRNE---SERQVAA
HEM1_DESAG       ----------RPMFFIDIAVPRDIDPDVNNLDNVYLYDIDDLKEVVEENL---SHRREEA
HEM1_LAWIP       ----------YPMLFIDIAVPRDIDPNVHQLDNIYLYDIDDLKEIVEDNI---VQRQDEA
HEM1_DESPS       ----------RPLFFIDIAVPRDLDPELNELENVYLYDIDDLSNVVEVNK---SGRDHEA
HEM1_SYNFM       ----------KPLFFIDIAVPRDIDPKINEIDNVYLYDIDDLQGVIDLNR---EERKREA
HEM1_SYNAS       ----------RFLFLIDIAVPRDIEPAAGDIDNVYLYNIDHLQELVDENR---NHRLREA
HEM1_PELPD       ----------KPMFFIDIAVPRDIDPRVNDLESAYLFTVDDLQEIVEANM---AQRNQEA
HEM1_PELCD       ----------RPMFLIDIAVPRNIDPEVNHIDNVYLYDIDDLNGVIETNL---RERRKAA
HEM1_MAGMM       ----------RPIFLIDIAVPRDLDPEIGQVDSAFLYDMDDLNKIVNDNR---QDRAEAA
HEM12_KORVE      ----------RPMFFLDIAVPRDVDAKMNELDGIFVYDIDDLQQVVHSHI---SDRKDEA
HEM1_SOLUE       ----------KPMFLIDIAVPRNIEPAINDLDNVFLYDIDDLQEVVNSNL---RERMKEA
HEM1_THEYD       ----------KPIFFIDISVPRNVDPACNELDNVYLYNIDDLQDVVDSNI---LERKKEA
HEM1_SULSY       ----------DPLFIIDISVPRNVEESVNELEGVYLYNIDDLKQVVNSNL---EERKIEA
HEM1_AQUAE       ----------EPQFVIDIAVPRNVDPEAGNVEGVFLYDIDDLKQVVEENL---KERIKEA
HEM1_NATTJ       ----------SPMFLIDIAVPRDVEPSVNNQDNAYLYTIDDLEAVVESNM---QERQEEA
HEM1_RHOFT       ----------RPMFMVDLAVPRDIEIEVKALEDVYLYTVDDLASVVQTAQA--SRQAAVA
HEM1_METPP       ----------RPIFMVDLAVPRDIEPEVARLDDVYLYTVDDLSAIVQSGGE--KRLAAVA
HEM1_RALSO       ----------RPMFMVDLAVPRDIEPEVARLSDVFLYTVDDLGAIVREGNA--LRQAAVA
HEM1_POLAQ       ----------KPMVMIDLAVPRDFEPEIARLDDVYLYTVDDLGVMIQTGTN--LRQAAVS
HEM1_JANMA       ----------KPMFMVDLAVPRDIEAEIGRLDDVFLYTVDDLGSFVQTGVE--NRQAAVA
HEM1_BORA1       ----------RPMVMIDLAVPRDIEPEVGRLDDVYLYSVDDLGRLVQSGTD--ARRAAVV
HEM1_AROAE       ----------RPIVMVDLAVPRDIEAEVGELDDVFLYTVDDLAQIVDAGLE--SRQQAVL
HEM1_DECAR       ----------RPIFMVDLAVPRDIEEEVGELDDVFLYTVDDLAQVVESGLE--SRQAAVV
HEM1_NITMU       ----------RPIFMVDLAVPRDVEPEVAELDDVFLYSVDDLADIVKEGLD--SRQGAVA
HEM1_THIDA       ----------RPIFIVDLAVPRDVEAEVADMNDVFLYSVDDLGQVVREGMD--NRVAQVA
HEM1_METFK       ----------KPMFMVDLAVPRDIEPEAGELDDVFLYTVDDLAQIVQEGME--NRQEAAA
HEM1_NEIM0       ----------MPLFMLDLAVPRDIEAEVGDLNDAYLYTVDDMVNIVQSGKE--ARQKAAA
HEM1_CHRVO       ----------RPMFMLDLAVPRDVELEVGKLDDVFLYSVDDIAGIVEVGKE--ARQNAAE
HEM1_MANSM       ----------APMLIVDIAVPRDVDERVEKLDGVYHYTVDDLHSIIQRNLS--EREKASK
HEM1_PASMU       ----------LPMLLVDIAVPRDIEESVGELDSIYHYTVDDLQTIIQRNLV--EREKASA
HEM1_HISS2       ----------KPMLIVDIAVPRDVEESAGEIESVYHYTVDDLHNIIQHNIN--QREQASQ
HEM1_ACTP2       ----------DPMLLIDIAVPRDIDENAGELDAVYSYSVDDLQHIIQRNMA--QREQAAE
HEM1_AERS4       ----------KPMFLVDIAVPRDIEAEVDELSDAYLYTVDDLQGIIEQNLE--TRKRAAA
HEM1_SHELP       ----------QPMLLVDIAVPRDIEAEVADLDDAFLYTVDDLQSIIEQNMA--SRREAAE
HEM1_PSYIN       ----------RPMLFIDIAVPRDIEAEVSELRDIYLYSVDDLQGIIEENKQ--ARQVAAL
HEM1_ALISL       ----------QPMLFVDIAVPRDIESEVADLNDVYLYSVDDLKSIIDHNIE--QRKIEAI
HEM1_PHOPR       ----------QPMLFVDIAVPRDVEAEVGDLNDVYLYTVDDLHSIIEKNRE--QRKVAAI
HEM1_SODGM       ----------QPMLLVDIAVPRDIEPEVAKLADAYLYTVDDLQAIIEKNLA--QRKHAAV
HEM1_PROMH       ----------QPMLLVDIAVPRDIEQDIEKLSNVYLYSVDDLEAIIQHNRE--QRQAAAI
HEM1_COLP3       ----------QPIFMVDLAVPRDIEEQVSELEDVFLYTVDDLQGIIAKNIA--NRRKAAV
HEM1_PSEHT       ----------KPMLFIDIAVPRDIESQVGELDDAYLYSVDDLQTIVSENMS--AREEAAE
HEM1_PSEA6       ----------KPMFLVDLAVPRDIEAEVGELDDAYLYTVDDLQQIVEKNIE--SRQHAAL
HEM1_IDILO       ----------RPMLLIDLAVPRDIEEQVNELDDAYLYTVDDLQSIISENIR--NREQAAR
HEM1_ALCBS       ----------RPMFMVDIAVPRDIEPEVGELGDVYLYTVDHLQEAIQENVR--SRQQAAQ
HEM1_CHRSD       ----------RPMFMVDIAVPRDIESQVGELDDVFLYSVDDLQEVIEENRK--QRAVAAA
HEM1_HAHCH       ----------KPMFMVDIAVPRDIEEEVSELADVYLYTVDDLRQVIEDNMK--SREGAAE
HEM1_MARHV       ----------RPYFMVDIAVPRDIEPEVASLADVYLYTVDDLRQVIEENIR--SREGAAR
HEM1_PSEU5       ----------KPMFMVDIAVPRDIESQVGELDDVYLYTVDDLHEVVAENLK--SRQGAAQ
HEM1_SACD2       ----------KPMFMVDIAVPRDIEAQVGDLADVYLYTVDDLKEVIDENMR--SRQQAAK
HEM1_MARMS       ----------SPMLLIDIAVPRDIEPEVEEVNDAYLYTVDDLHSVIEENVR--ARQDAAK
HEM1_ALKEH       ----------RPMFMLDLAVPRDIEPEAGNLDDVYLYTVDDLREVIAENRR--SREEAAH
HEM1_HALHL       ----------KPMFMLDLAVPRDIEPEAGEMDDVYLYTVDDLRGVVAENMR--SRQDAAT
HEM1_NITOC       ----------RPIFMVDIAVPRDIEPEVGELQDIYLYNVDDLQEVVQENLR--SRQAAAL
HEM1_METCA       ----------KPMFIVDLAVPRDIEPEVEQLQDVYLYTVDDLQHTVEENLK--TRQEAAL
HEM1_HYDCU       ----------KPMFMIDIAVPRDIEPAIGNFSDTYLYTVDDLQEIIEENKR--SRKDAAL
HEM1_COXBR       ----------RPLFMADLALPRDIEPETAQLEDVYLYNIDDLQTLIAQNRQ--TREAAAK
HEM1_LEGPL       ----------APMFLLDLAVPRDIEGNVNELEQVHLYNVDDLQSMIEKGMD--ERRNAAL
HEM1_XYLFT       ----------KPILLFDLAIPRDIETEVGTLTDAYLYTIDDLERAVEENRH--SRREAAE
HEM1_DICNV       ----------TLQVYIDLGIPHNFDRNIDNKENAFLYDMDNLAQLIDKNRE--TRQKAAA
HEM1_VESOH       ----------KPIFMLDIAIPRDIEPEVGQLDDIYLYTIDDLEQVINDNIG--NREKEKN
HEM1_FRAP2       -------------VFIDISIPQALDPKLGDLEQNAYYCVDDINTVIEGNKD--KRKHESS
HEM1_WIGBR       ----------KKIIFIDISIPRNIDKKIKKITGVHLYTLEDLKDLITNNLE--KRKNAAT
HEM1_PSYCK       ----------QPMLMIDLAVPRDIDSTVSRIDDVYLYSVDDLQHVIAGNIE--QRRQAAV
HEM1_PSYWF       ----------KPMLMVDLAVPRDIDSSVGKLDDVYLYSIDDLQHVIAGNLE--KRRQAAV
HEM1_ACIAD       ----------NQMLLVDLAVPRDIDSKVETLDGVYLYGVDDLQSVIDENLA--QRRQAAV
HEM1_METBF       ---------TRKLLLIDIANPRDIEESVAELDNVKLCNIDNLRVISEKTL---KMRKEEA
HEM1_METBU       ----------NELLLIDIASPRDIDPAVEEIPHVILRNIDGLRVINEKNL---QMRMVEA
HEM1_METTP       ----------NKLLIIDIANPRDVDEAVREIEGVELHNIDSLKQISDENM---RLRMREI
HEM1_METAR       ------------LIFIDITNPRNIEETVGEVPGVTLHNIDSLRQINEASM---RRRQGEA
HEM1_ARCFU       ---------K--LLIIDIALPRDVDESVAQLDGVELLTIDDLRRISEENL---ARRREEI
HEM1_METKA       ---------RSPILIIDIANPRDVEEGVENIEDVEVRTIDDLRVIARENL---ERRRKEI
HEM1_METVS       ----------GNKIIIDIANPRDVDDSVRELENISLYTIDDLRNISDKNL---QKRLKEV
HEM1_META3       ----------GYKVLIDIANPRDVSDDVMELPNIKLYTIDDLKMVSEENL---KKRKDEI
HEM1_METJA       ----------GKTIIIDIANPRDTTDDIRELPDIFLFTIDDLRLVAEENL---KKRKEEI
HEM1_METTM       ----------SSIVMVDIANPRDIEESVREL-GVRLFTIDDLRGVAEENR---KRREAEA
HEM1_METS3       -----------DLLMIDIANPRDICEDVCEL-GVKLFNIDDLREIADENT---KLRKKEF
HEM1_METST       ----------HDMIMLDLANPHDIENDVQEL-GVKLYNLDDLRYVTDKNK---ERRNKEA
HEM1_METMJ       ---------PRHLILIDIAQPRDVEEGVRSIEGVHLFTIDDLRNVNDATM---ESRRSEA
HEM1_METB6       ---------PRPLILVDIAQPRDVEEGAGAIDGVRLFTIDDLRQVNEQTM---STRRAEA
HEM1_METHJ       ---------RRPLIIVDIAQPRDVEEDVGKIPGVCLYTIDDLRKVNDDTA---QFRKEAA
HEM1_METLZ       ---------PRHLLLIDIAQPRDIDDACRDVPGVSLKTLDDLKSISEKNL---AARKTEC
HEM1_HALMA       ----------GDVSIVDIAQPRDVPAGADRLPSVTVYDLDALESVTAETR---NKRQRAA
HEM1_NATPD       ----------GETCVLDIAQPRDVAPGADGIDGVAVYDLDTIESVTDEAR---AKRREAA
HEM1_HALS3       ----------GDTVVVDLAQPRDVAPGAGGHDGVAVHDLDDLEAVTAATR---ERREDAA
HEM1_HALWD       ----------GETFIIDLAQPRNVHPATADIENAIVQDIDALESITKETE---ASRQAAA
HEM1_ALKOO       ---------KIPKLFIDLAVPRDIDPSIKNLPNIELYDVDGIGADEISKNH----AQQLK
HEM1_CLOTH       ---------KYPRLFIDLAVPRDIDPKIKSLDNVELYDLDSIYAGEVDKNR----TEQMI
HEM11_LACP7      ---------KKPVLFIDLAVPRDIDPRITELKNITLYDIDHFKVETVSDEM----KTQLR
HEM12_LACP7      ---------GKTYCLIDLAIPRDIEPSVEELSDVTVYNMDYFCQEVNDRE------KELE
HEM1_CLONN       ------------LYIMDLALPRDVEKSAGDIENIHLYDVDDFKNISDSNKI--KREELSL
HEM1_ALKMQ       ---------HRPMCMIDIALPRDIDPAVKEIEGIELFHIDDLKEIANENLA--YRMDCIE
HEM1_CLOAB       ---------YRKFTIFDLAVPRDVEETVYGRNNIDIYDIDQISMIDNNNRK--KRKEIMM
HEM1_CLOTE       ---------HKNIVVYDLAVPRDVDEEVRYMKNVKLYDIDNISCINDENCS--KREDIMN
HEM1_CLOK5       ---------CRKLTIFDLAVPEDIDRNVLDLDNVTLYDIDNISVIDEKNKA--IRKKTMG
HEM1_CLOBB       ---------GSNIIIYDLAVPRDVDDDINDIDRAQVYNIDNISHINDGNKK--MRFDKMD
HEM1_CLOB8       ---------GSRLVIYDLSVPRDVEKEVALLSRTEVYNIDTISRIDDENKK--LRKDKME
HEM1_CLOP1       ---------GETIHIYDLAVPRDVDKELSEKERVILKDIDEISKIDDKNKK--IRKERME
HEM1_CALS8       ---------GKNLLIFDLAVPRDVDVEVYKLPNVKVIDIDQVHKMDATSRE--IRISKMQ
HEM1_CAMC5       -----------RRYFFDIAVPRDIDLVNT--DKISVYSVDSLEEMVRRNLA--LREEQAQ
HEM1_CAMFF       -----------HRYFFDIAVPRDIDIEED--EYIHVYAVDDLEEIVRTNLA--LREEQAS
HEM1_CAMHC       -----------KRYFFDIAVPRDIDITCD--DLSEVYAVDDLEEIVRKNLL--LREEQAQ
HEM1_CAMJD       -----------KRYFFDIAVPRDIDINEN--ENISVFAVDDLEIVVQKNLA--LREQEAR
HEM1_NITSB       -----------DRYWFDMAVPRDIEEIYV--ARIHYFAVDDLKEIVNKNMA--FREEQAR
HEM1_WOLSU       -----------RRYWFDLAVPRDIEAFES--ETIRIFAVDDLQEIVNKNLS--LREEQAK
HEM1_HELHP       -----------QRWWFDLALPRDIENIQM--ENLHIFCVDDLEEIVQEHKN--AREDSAK
HEM1_ARCB4       -----------NRYWFDIAVPRDIDENISM-SNLEIFSVDDLQDIVNENMS--LRAEQAK
HEM1_SULDN       -----------DRYWFDMAVPRDINYHKG--DRINLYVVDDLKNIVDQNMS--FREDGAR
HEM1_SULNB       -----------PRQWFDMAIPRDIEDMEL--EKLQLFRIDDLRAISNDNHA--MREEQAV
HEM1_HELAH       -----------RRFWFDLAVPRNIEKPIF--NNIFLYSVDDLEPMVRENVE--NRQESRM
HEM1_CHLTB       -------------IVFDFAVPRALPSH--TVFPHRYMDMDQISDWLR---E--HRKEVNS
HEM1_CHLMU       -------------LVFDFAVPRALPVQ--PACRDRYIDMEQISDWLR---Q--HQKEVFP
HEM1_CHLFF       -------------VVFDFNVPRTFTLVE-RPEGISYLDMDFISERVQKKLQ--ISKQCTN
HEM1_CHLPN       -------------IVFDFNVPRTFLWKE-TPTGFVYLDIDFISECVQKRLQ--CTKEGVN
HEM1_SALRD       -----------ATLVVDVAMPRNVDPAVDERPGYRLYDLDDLEAWTAEVRE--RRADAVP
HEM1_CYTH3       -------------YFIDLSVPRSVDARAEELPGIIVYDIDHIQNRSNEAL---ENRLNAI
HEM1_RHORT       ----------RPVFIVDAGVPGNVEPSVQRLEAAFLYDLADLEAVAEEGR---AARDQAS
HEM1_CUTAK       ----------RDLMVLDLAISGDVEEPVP--AGVEVIDLETIRQAVPASA------EAER
HEM1_IGNH4       -----------KLVIVDISEPPAVDPGVSLNPYVIYKDMLAVAEVANRGL---EKRKSEI
HEM1_HYPBU       -----------HLVVVDISNPPAVEQPIP--SNVYYAGLRDVEKVIKEVL---AVRIREV
HEM1_AERPE       -----------PRVIVDISNPP-----VTPKVAGRVFHMPEVEEEAKRMM---EERLRWI
HEM12_NOCSJ      ----------RELVVVDLCVPRNVDPDVRGVPGVRLLDLTDLRGAAVPGRRPSAPAPAAL
HEM1_CENSY       ------------MMILDLSNPRTVDEKVATLGGIKLMNLDQIAEMVSKNMR---NRMSSV
HEM1_THEM4       ------------IIFIDLSMPRNIEPSIKEYH--TLYTLEDLNEISKKYNK---LRQEKI
HEM1_CALMQ       -----------KPIIIDVGVPRNVDPEIPG-----VVSIDELKNIENEIRE---GKRKAL
HEM1_TROWT       DLTAIEASNRSRHVLIDLGLPRNFDPAISDLPTADLIDLDMLRVHAPFDNL------AAE
HEM1_PARUW       -----------DKLIMDLCVPRNVEPKLGQNAKITLLNIDQINRLLKIRHR--GMTQALI
                                 *   .                 :  .                  

HEM1_ARTS2       AQASGIVTGAAAAFEQEREARSVDSAIVALRRHTMNVLDAEMEKVRARHGCTA-------
HEM1_RENSM       LQTQVIVSRAAADFELSIATRSVDTAIVALRKHTMAVLDAEMERVRAQHGCTA-------
HEM1_CLAMS       DDAREIVSTAAAEFRAASAEDEVAPAVVALRTHIFDVLEGELERVRKRGD----------
HEM1_LEIXX       DDAREIVGAAAAEFAAQTAEQAVKPALIALRKHVFDILDAEIARARTRGD----------
HEM12_PYRAR      KKAEAIVEEELEMLPKALAKRAVEEAVAEVMARAVEIAEEEGRRAGCEV-----------
HEM12_PYRCJ      EKAWAIVDEEVARLPRLLARRYVEEATSAIMAQAMAAAEEEGKRAGCDT-----------
HEM11_PYRAR      KKAEEIVEEELVALERLLRIRWVEEVSAKLLEYWFKIAEEEGERAGGLE-----------
HEM11_PYRCJ      SKAEKIVEEEVARLEEVLRRRWVELEMSALLKKWFAVAEEEGERAGGGP-----------
HEM1_SULAC       KKAEAIINEEIQKFESLLNNYNMNRLVSRFMSEIEWVREKEVDRAFNEILKNYAD-----
HEM1_SULTO       QKAEELIHIEIENFKNEIIKYNQNRLISKFMKRIEDIREAEINRAYAEILKHAND-----
HEM1_SACS2       AKINKLVEDGINELLYDYKKEIYTEFMSKIMKRIETIRENEILRAYKELEKLGIN-----
HEM1_METS5       ERAESIIREGLEEFRKDCLNLVYDNFVSSFMSRVEETRKEEVERALKVLGDDG-------
HEM1_THEAC       DEARRIIEIEMASLMNKIKDVMIDEIFADFYKFAVVVQKMEIEKFSRMHPEIPA------
HEM1_THEVO       NQAEILIENEMKATMNKIKDLMIDDIFSQFYRFASVVQTMEIQKFRKMHPEVNE------
HEM1_PICTO       EIAEVIINQEQKTIDEKLKEMMLDDVIAMFYKFANNVKKDELEELFLIQDFNDEQ-----
HEM1_PROA2       PKVQEIIDEELVGFGQWINTLKVRPTIVDLQSKFLEIK----EKELERYRHKVSD----E
HEM1_CHLT3       PKVKHFIQKELIEYARWYFSLEVKPTIVDLQEKFFEIK----ALELARIKNKVSA----E
HEM12_FLAJ1      PAAEAIIDDMKLELNTWVNGRKCAPTIHALKSKLNDIV----SAEFAFQKKKITH----F
HEM1_GRAFK       PQAKEIITEVESEFNRWLETRKFAPTIKALKKKLKTMK----DDELDFQRKKISD----F
HEM1_BACME       DEIEIMLEAEIVAFKSWLGTLGVVPVISALRQKALTIQ-AETMKSIDRKLPDLSE----R
HEM1_BACP2       EQVELLIEAEIVEFKQWLNTLGVVPVISALREKALTIQ-ADTMQSIERKLPNLTH----R
HEM1_BACCN       EKIQFMIEEEIVLFKNWLNTLGVVPLISALREKALGIQ-SETMRSLERKIPTLSD----R
HEM1_LYSSC       ADITDMIGHEVIQFKDWVSTLGVVPVISALRKKANRIQ-EETMTSIENKMPDLTE----R
HEM1_GEOTN       ALIEEMIEGELVAFGQWLQTLGVVPVIAALREKALAIQ-AETMKSLERKLPHLSE----R
HEM1_OCEIH       EKIELLIEEEIVTFKEWLKTLGVIPVISALRQKALTIQ-AETMQSIERKIPNLTD----R
HEM1_BACSK       EKIGVMIEAEIDDFKAWLNTLGVVPLITALREKALQIQ-GDTMESIERKLPHLSE----R
HEM1_BACHD       EKIELLIEEELVEFKQWLNTLGVVPIITALRTKALTVQ-GETMESIERKLPNLTE----R
HEM1_PAEMA       VKIDKMIEEEMQVFANWLQTLGVKPVIRALQEKAAHIH-ESTLDSMFNKLPELDE----R
HEM1_STAS1       EQIIQNIPNEIEAHNEWVNMLGVVPVIRALREKAMSIQ-EDTMDSIDRKLPGLSE----R
HEM1_LISW6       LALENTIETEVQNFFEWEKQLGVVPVIRALREKALEMQ-EITMTSLENKLPGLTE----R
HEM1_EXIS2       AKIERRIEAAIAEFEGWMTTLGVVPIITELRDQSLKIQ-QETMQSLERKLPNMTN----R
HEM1_STRSV       GRIALEIDEELVKFADWRQQLGIIPLIQEIRDKALEAQ-ASAMESLNRKIPDLTE----R
HEM1_LACRJ       QKIANEIPQEVNDFYIWEKQLHIVPVIRGLREHSLRIE-GEAYDSLLRKLPELDS----H
HEM1_SYNP2       EEAEALLEEEVENYIQWWQSLETVPTISSLRSKVESIREQELEKALSRLGAEFEE----K
HEM1_ACAM1       LEAESLLEEEVASFDVWWRSLETVPTISSLRTKVESIREQELEKALSRLGTEFAE----K
HEM1_SYNP6       EEAEALLEEEVDAFDNWWQSLDTVPTINCLRDKIEMIREQELEKALSRLGTEFGD----K
HEM1_THEEB       QEAEGILEEELETFLAWWHALETVPIIRSLRQKMEAIRTQELEKALSRLGSEFAD----K
HEM1_CYAPA       KAAEILLEEELSAFNIWWGSLEAIPTINKLREKAEIIRVKELEKAISRLGNEFVS----D
HEM1_SYNJA       LAAEALVEEEVEQFMEWWRSLETVPTISSLRHKVESIREQEMEKALSRLGKDFAE----K
HEM1_GLOVI       TQCEEILLEQLDEFLDWWRGLEAVPTINQLRQKVETIREQELEKALSRLGTEFAE----K
HEM1_SYNS3       REAEGLLLEEGRLFLEWWDSLEAVPTINRLRASLEEIRVEELTKALSRMGPDFSA----R
HEM1_SYNR3       QQAEVLLDEDRQAFLDWWDGLEAVPTINRMRQQFEEIRKQELLKALSRMGSDFSQ----R
HEM1_PROMP       KEAESLVKDERIIFLEWWASLEAVPVINKLRSDLELIRKEELQKALSRMGPDFSA----R
HEM1_FRASN       EAVRALVTTEVAGFLDRRRAERVAPTVVALRAHAAAVVRDELERLRTRLPDLDNR----E
HEM1_KINRD       RAVRAIVAEEVAAHAASLRAADVAPTVVALRAQARHVVEVEMRRLASRV-DLDDT----T
HEM11_NOCSJ      EAVRQIVTQEVAAFLSARRQASVTPTVVALRSMATSVVEAEMERLTSRVPGLDDD----I
HEM1_THEFY       TAVRDIVAEEVAEYQAVRSAERVAPTVVALRSKAQKVVESELERLNGRLPGIDDR----T
HEM1_MYCA9       GAARQIVNDEVARYLTGERMAEVTPTVTALRQRAAEVVEAELLRLDGRLPGLAGA----E
HEM1_RHOJR       DAARTIVAAELANYLAGQRLAEVTPTVTALRQRAADVVEAELMRLDSRLPGLDDP----E
HEM1_SACEN       ERAAAIVAEEVRGYLAAQRSAEVTPTVTALRKRAAEVVDAELLRLDSKLPALEGD----V
HEM1_SALTO       AAVEQIVAAEVDTFLTWLRGADVAPTVAALRGRADDVVAAELGRLVHRRPDLTDE----Q
HEM1_ACIC1       RHARHILDEEFDAHVARRAAVGVVPTVVALRDKAARVVAAELRRLEKRLPELDPR----Q
HEM1_COREF       ADALAIVREELEAFTSEQRIRDVVPAVSALRKRANELLLDELDRLQARTPDISQE----D
HEM1_CORDI       HAAQRIVAEELEAYTSAQRIRDVAPAVAALRRHASSLIDSELARLSTRVPSMDED----D
HEM1_CORJK       SPARAIVADELQSFLEQQRAQSVVPTVKALRQKAGEVMAEELMALERLTPDMSEA----D
HEM1_CORU7       DAARGIVAEELESFLEQQRAQAVVPTVKALRQQAMDALSNEMLALQRQTPGMSDE----D
HEM1_ROSS1       ERAETIIEGEVAKFMEWWAVQQAVPTIRALRKRAEDIRDAEIRRALARCPELSPQ----Q
HEM1_HERA2       AGAEAIVERELIKWQEWWLTQAVLPTIRALRAHAEAIRLAELERTLARL-DLSEQ----Q
HEM1_CHLAA       EIAQQIVEEQVQEFLSWMRTQEALPVLTMLRQRAEEVRNEELARALRRLHDLSPE----Q
HEM1_RHOBA       PKAKKIIDEEVDGFFQSLQQRATGPVIRRLRERADKVKAEELQRLFGKLNGSTDT----A
HEM11_ANADF      LRAEAIVEAEVMAFAKERDARAALPVLAQLRRHAEQIARAEAERTLSHLGPKLDE----K
HEM1_MYXXD       QKAGVLVAQEVARFVKERALREGTPVLARLRQRAEAIARSEVERTLGALGDGLNE----K
HEM12_ANADF      ADADRIIAEEVGKFVRAEAERRAAPLIQEMRTRASAIAREEVERTLRRLGE--DP----E
HEM1_THET8       PKVEALIEKALGDYMEWYAGHRVREAIR-----ALEAWARVQAAKAQPEAGP--V----E
HEM1_DEIRA       PQAEAIIRELGSDLSRWYLTRETQLARQ-----AELALACD-------------------
HEM1_RUBXD       AAAEEMIGPAVVEFMSWLSTLHVAPLIKELRDGAERIRRHEVSRALRKMDLS--P----E
HEM1_CARHZ       EMAENIIETELKAFIEWHSTQFVVPTIVALKKKAEEIKQKELTKALNKLG-NISE----R
HEM1_HELMO       AEAEIIIEHEINQFMRWLNSLFVIPTIVGLKNKGNQIKEKELDRALCKLK-HLSE----K
HEM1_DESRM       VQAEGIIEEELNEFMRWLSTRFVVPTITALKKMGEEIKQRELVRAYNRLG-DLTE----R
HEM1_PELTS       VKAEEIIEEELDGFMKWLGMQFVVPTISALKKWGDEIKQKELCRALNRLG-NISE----H
HEM1_DESAP       VAAERIIDAEVREFLLALGSRFVIPTVVALKKRGEEIKRNELDRALNRLGGELSE----R
HEM1_MOOTA       RQAEGIIAAEAEAFFQWLGSLYVVPTIVALKEKAEAIKNAEVRRACNRLG-QLTT----R
HEM1_DESHY       LQAGRILEEEMGRFVKWHNSLYVVPTIVALQRRGEEVREIMLKSALNKLG-PIDE----K
HEM1_AKKM8       SRCEAIIRDSISRYF---------------------------------------------
HEM11_KORVE      VAAEEILADEAKGFRRKLMAERVVPTIVALRNRLDEVCRQELESLRQELG-PFTE----D
HEM1_DESAG       AKAKAIVRSETEVFGRWLRSLDLQPTIVDMYSRSTEIAQEELLKTLRRIG-PVDE----S
HEM1_LAWIP       IKAKHIIQDEIDSFCAWLQALILQPTIVDLRKRFSTYAEEELERTLKKIG-PVDR----K
HEM1_DESPS       IKAGCIVEEETRKFDEWYQGLAVKPTVLALREKMSGIIEQELRKTLPRLH-DLGE----H
HEM1_SYNFM       ERAEHIIAGETLKFQEWMATLNVVPTIVALREKAETIRRSELQRTLSHLP-HMSE----K
HEM1_SYNAS       EKAEAIIEEEVGNHTAWLSTLDVVPTIVEFREKIEGIMKAELGKSASWRH-SLSE----I
HEM1_PELPD       SKGEEIVEQEIGQFHCWLSSLESTPTIVALRARFEEIRRAELEKTLCGWK-DLSP----E
HEM1_PELCD       KKAEDIIEQEIVRFYSWLRSLEATPMIVALRRQVEDIRRTETEKTLGSLQ-HLDA----G
HEM1_MAGMM       QAAMQIIEGETPLFIQWLDTLDVVPTIKQMRRKAEAAKDQLLQKHLAGW--DLSD----T
HEM12_KORVE      AHAEAIVNAEVEKFEERLRTLDVVPTIVSLQEHLETVRQAEIDRLRGRLG-ELSP----E
HEM1_SOLUE       DHAELLVTEEVDRMMARMKVAEVTPVIVSLQEQLEQIRSGEMEKVRRRFG-PFTA----Q
HEM1_THEYD       EKALSIVQEETEKFFQWLNSLESVPVIVSIRNKAEQVRQEEIEKFKAKYK-DLPP----E
HEM1_SULSY       QRAEFIIDEEVEKFVKWLNALKVSPIISSVRDYADKLRQQQLEKLFKQMP-YLNE----K
HEM1_AQUAE       QRGEIILWDEVKKFMNWYESLKAEPYILELKASVEGK-----------------------
HEM1_NATTJ       RNAELIISEEVAEFMVWYKTRDVVPLISALREKAEDVRKMELEKYHKKLK-NLSP----K
HEM1_RHOFT       QAEAIVDAGVLSFM-HWVDQRGSVPLIQQLNAQADEWRAAELARARKLLAKGED------
HEM1_METPP       QAEAIIETGVQSFV-HWLGQRGTVPLIQALNAQADSWRENELVRARKLLARGES------
HEM1_RALSO       QAEAIIETRVQNFM-HWLDARSVVPIIRDLHAHAEALRQGELERAQRMLARGDD------
HEM1_POLAQ       QAEAIIEDRVGNFM-HWMQGRNAVPVIQDIQQQGERLRQLELERAMKRLMRGDD------
HEM1_JANMA       QAEAIIETRVRSFM-HWIDARAVVPVIQDLHESSETMRMIELERARKLLAKGED------
HEM1_BORA1       QAEAIIETRVQGFM-HWMQSREVVPVIRGLHQAAEDVQAAELERARRLLARGES------
HEM1_AROAE       EAEEIIDSRVNGFL-HWMQARDAVPTIRALRQHAETVRAVELERATRLLAKGED------
HEM1_DECAR       EAEDIIANRVKDFL-GWLESRDTVPVIRSLRDSAERMRRHEIEHAMKLLAKGEA------
HEM1_NITMU       QAEAIIDSNVVNFM-HWLESRQVVPTIRALRDQAERYRRHELERAKKLLAKGED------
HEM1_THIDA       QAEAIIETSVASFI-HWMEGRELVPVIRGLRDAAERHRRHELDKAHKALARGDD------
HEM1_METFK       EAEAIIDMRVENFM-QWLKTRSAVPTIRALREQAERHRLNELEKARKLLARGHD------
HEM1_NEIM0       AAETLVSEKVAEFV-RQQQGRQSVPLIRALRDEGEKARKQVLENAMKQLAKGAT------
HEM1_CHRVO       EAETIIQARVAEFT-DWLKKRETVPLIRALRDEADRARRHALEGALKQLARGDA------
HEM1_MANSM       EAETIIDAEASDFF-EWMKVHQFSNLIRTYRESAEQIRQDLLEKAVQAIGQNED------
HEM1_PASMU       QAWVIIQQECADFF-EWLKVHQFSNLIRSYRENAEDIRQILLEKALLALRQGED------
HEM1_HISS2       QAEHIIQQESADFF-EWLKVHQFSNLIRNYRESAEIIRQDLLEKALQALQNGEN------
HEM1_ACTP2       QAAQIVDEECKAFF-EWLKQQQSSDLIKRYRQDAEQTRQELLAKALVALTSGQD------
HEM1_AERS4       EAEIIVLEERDEFM-GWYRSQHSVDLIRDYRHQAQQVADEELQRALLSLQQGEN------
HEM1_SHELP       KAELIVEEESHHFM-EWIRSLESVDSIREYRSQSMAIRDELVERAINKLAQGGD------
HEM1_PSYIN       EAEKIIDGCIVDFI-SWIESLKAVESIRTYRQNSEQLRDDLLNRASAALQNGEE------
HEM1_ALISL       QAEAIVSEESAGFM-TWIRSRQAVNSIRQYRENSESIRIELLQKSIQALASGQN------
HEM1_PHOPR       QAEAIISEESAAFM-SWLRSLEAVDSIRQYRCFADDIKNDMLSRSLQAIANGVA------
HEM1_SODGM       LAETIVAQESMDFM-GWLRSQSAVEAIRDYRTQADSLREEFEARALAALRLGAD------
HEM1_PROMH       EAEHIVQQESGQFM-DWLRAQGAVGAIREYRDSAEMLRAEMAEKAIALIQNGAD------
HEM1_COLP3       QAESIVNSQSDNFM-AWLRGLNTQDTVISYRKQCLDNRDVLLEKAFIQLKNGKN------
HEM1_PSEHT       QAEVIITERTKEFL-MWIRSLDSVDLIRHYRNDVQTIKSELVERAVSQLNTGKD------
HEM1_PSEA6       QAQQMIEEQAQQYM-LWRQGQSSIDVLRDFRQQSESQRDTLIAKALNQLADGKE------
HEM1_IDILO       EAQVIIQQQTKEFN-DWLKSLNSVELVREYRTHTKTLADEQLKKALAQIEQGKD------
HEM1_ALCBS       EASELIRDAIVRHR-RQRREQDAVKVLRDYREQRKAMAESELEKALQQLRNGGD------
HEM1_CHRSD       QAESLIEHGIQHWQ-HERRVRGAGDLIRRYREQGEALREEAERQALAQLARGED------
HEM1_HAHCH       EAERLIAAGAADFM-YHLRALDSVSVLRRFRDQAEGVRDAELQKAIRLLNRGDD------
HEM1_MARHV       EAENLISSGVQDFL-DQLRALDAVSTLKVFRQRAELLRDVETEKALRALRNGTD------
HEM1_PSEU5       AAEELVAAGTEDFM-QRLRELAAVDVLKAYRQHAERIRDDELSKAQRLLANGAS------
HEM1_SACD2       IAEEIIVEGLLHYE-REQRALTSVDTIKALRQTMDALREQELEKSRKALEAGAD------
HEM1_MARMS       AAEQMIEEGVDSYR-RVVESRKVSDLIVTFRQSAEAIKNTELEKALKGLEMGQS------
HEM1_ALKEH       QAEEIVQRQVDQFL-SWRRAQQAVASICDFRERGHAHARELLQRANRRLRCGEP------
HEM1_HALHL       QAEAIVEQQVRHYL-EWRRARDAGEAIRSFRSRAESYARATRAQAARQLSRGED------
HEM1_NITOC       QAEEIIDTQVEYFM-DWVRTQDAVPVICAVRQEADQLRKEALEKARRRLAQGHD------
HEM1_METCA       QAEEIIDLEVEHFL-SWLRAQAATETIRDVRRQAELHRDAALQRALRELRRGKS------
HEM1_HYDCU       EAEEIVELQAENFMAQYQATQQISPIIQRYRQQAYTLKEHALQDALHHLENGGD------
HEM1_COXBR       QAEAMVEMQAIHYM-RQLQVHKAGDTIRRFRERVEMLRDQELEKALAHFQRTND------
HEM1_LEGPL       QAEQLIESELDNYI-RWHRSLRAKDVICDYRNQMHTLAQQELQRALKKISAGQN------
HEM1_XYLFT       TAEAIIELQVKRYM-DTLQAQAHQAPLRRLRTFGTTTRDELLTRARRQLANGRP------
HEM1_DICNV       EAETFIRLYSNDFL-NWTQEKPQQHMIRHIRADAHNIRQKLLIMAYRQLAQGAD------
HEM1_VESOH       LAQEIIIKQNQVFN-QWLKVLPNEQLVRSYRSNANLIKNKLLEKAIKQIKHSGD------
HEM1_FRAP2       RAQKIIVKSLEDYL-EKEKAIISNSAIKELFQKADGLVDLSLEKSLAKIRNGKD------
HEM1_WIGBR       LAENIIKKESIKFM-SHIKGYYSSEIIKKYRFQINKLKKIYEKKALLELKLGNN------
HEM1_PSYCK       DAELLVSQLVVEMD-RRFQVRQVGKDIQQYRTRTHEQVNKLLQASIAELHGDSAN-----
HEM1_PSYWF       EAELLVSHLVVEIE-RRFQVRKVGQDIHDYRALAAQKAEAVLNEALHELRTSEAT-----
HEM1_ACIAD       EAEVMVSQLASQLL-THQKIQQAGSTIQMYREFSQQQSQDEIARALTDLNKGHD------
HEM1_METBF       KKAEAIIQEEIKLLNLQYKRQRADKIISDLYKQIYDVRIREREKAVNRLCAYHTI--GKI
HEM1_METBU       KKAEIIIDDELDMVKAQYKRQKADAIISNLYSQSHGLRHNEMEHAINKLSAYHTI--GEI
HEM1_METTP       ERVEAIIEEELELLRAKYKRREAEELLARIYSEAEKIKEQEVRRAMNKLSAYHTL--GEI
HEM1_METAR       RKVEAIIEEELVLLQRDIRRLHADRVIGDLYQRTDHIRATELRRAVARLSTAGSL--TEQ
HEM1_ARCFU       AKVEGIIEEELEQLKLLLKDISARDAIAAMYSLAERFVGEEVEELYAKLNARYGV--SED
HEM1_METKA       PKVEKLIEEELSTVEEELEKLKERRLVADVAKSLHEIKDRELERALRRLKTG-------D
HEM1_METVS       PIVENIIEEEYGILLKQIEKTNVEEVIKDFNTYIEDVRKKELEKAVRLCKN-------KS
HEM1_META3       PRVEKIIEEELSVLTKQLRKLKFENTIKNYDLYIENLRKREMNKALNMIENG------KD
HEM1_METJA       PKVEMIICEELERLKEFLDKMRFETAIKELGQYIENVRKKEVEKAKKILKNKN-----KP
HEM1_METTM       REAEGIVRAELELLLRAMKHREVEPLLAEIRGRMESLRQREAGKAIKKIENS------KD
HEM1_METS3       AEAENIIDEEFSLLKESFKLIGVEDIIANLRVSMENIRERETEKAIAKLSDV------DA
HEM1_METST       IKAEAIIEDETLLLKESLKQMEITPILSSLNIEAEKIRKQELDKTLHMLDLD------KK
HEM1_METMJ       DRARGIIDEEAEHFVRLLRRAAADETLALLYTWAESIRARERDRALARLRERD-----DR
HEM1_METB6       ERAAEYVDDELDLFIRQLHRKSADDCIAALHTWAEAVRVRERDRALARLGNMD-----ER
HEM1_METHJ       EKVREFLDQELVQFIRLFNRKAADELLATLHSWAEQIRIRERDRALSRLSGCD-----DR
HEM1_METLZ       EHADVLVKAALPEFIKAFNRAASGDLTKNLYTWAEEIRQREKNKALSRLRDAD-----PY
HEM1_HALMA       EAVERIVDEEFDRLLTQYKRKRADRVISTMYESAEQVKAAEINSALSAADFDDE------
HEM1_NATPD       ETVETMIDEEFEHLMTQYKRKRADQVIAAMYEGAERIKARELRTAVSKFEAEREDGLSER
HEM1_HALS3       REVEAMIETEFERLLTQYKRKRADEVIARMYESADRLKSREVQTAVHRLEAESGS-LSAD
HEM1_HALWD       REVDAMIDEEFDRLLESYKRQRADEAISEMYEAAEHVKRREVETALEKLEKQGT--LTDN
HEM1_ALKOO       G-IERIIEKYICDYHKWCLFKEGLGCI---------------------------------
HEM1_CLOTH       Q-VKKIIDKYIFDYYRWYEYRKRLVLT---------------------------------
HEM11_LACP7      Q-IDEILKTKMDEFISWYECRGIIKVVQTLSENAAIDVGLRIDKTMKKIEMDSN------
HEM12_LACP7      E-TRELLSEYVNEFKQWYQFRNLVSTVDDISNIVSDITDAKLTKVYKSIDLSRE------
HEM1_CLONN       I-AKDSIDSYVNEFNQWMKSLKVDNTIKDLNNRCRDIKDEYLGYITKKIDLNER------
HEM1_ALKMQ       I-IKQSINEAIEKYEGWYQCLPIYPRIQAIKAYSETLTDQELEKLFKRLDHMAEE-----
HEM1_CLOAB       A-NRHIMSKYIVEFYDWQKVQEIVPDIIKLKLYGESVNKRRYETFKNKKATKDN------
HEM1_CLOTE       N-NLFVIEKYEREFEKWRKTSEISPHIVNLKKKGDEVYKKRLTTFKNKKYTKDV------
HEM1_CLOK5       K-YRYILENHIDKFIKWEKLHQLSPEIQKVKKYGDEICEKRITTFKNKKHTKDN------
HEM1_CLOBB       S-NKFILEKYLNEYYEWKRLRSIAPFIEELKVTSKEIYNKRITTFKNKCTDKDD------
HEM1_CLOB8       D-NRHIMNKYLKEYDEWLKLRSISHVIKNLKTVGNDVYEKRVQTFSHKSKDKND------
HEM1_CLOP1       E-YKHIVEESIDEFLNWLKIREVSSKIRNIKIRENEICSERIKTFSNKGNGEN-------
HEM1_CALS8       E-NYNIIEKYIDEFIEWLGFRQYRNLIIEVKRHAEQLCKAQVKYLKNVD--SRE------
HEM1_CAMC5       T-AYSIVGQSTNEFLKFLKDNISIPLIKTIRKKAEICAEAELEKALKKGYLKHS------
HEM1_CAMFF       I-AYSIVGKSTTSFFKWRLSEGSTPAIKALRLKAKDIACKEIEKAVKKGYLKCS------
HEM1_CAMHC       I-AYSIVGRETTKFYKDLKTLSSTPIIKALRNSAKKVAETELKKAIKRGYLRHS------
HEM1_CAMJD       M-AYGIIGRETSEFFRYLNDLALMPIIKAIRLQAKEYADKQLEIALKKGYLKKS------
HEM1_NITSB       N-AYKIVGHHVNEFFKWLQTLEIDPIIKEIRKRAKDSALAELQKAIKKGYIPKE------
HEM1_WOLSU       R-AYGIIGRFTQEFYKWLQSLSVDPIIKAMREQAKEAALKEITKAISKGYLPKE------
HEM1_HELHP       K-AQKILERYSVEFFKWLQTLGIDPIIKHIRYLAKQSALKELDRAVKKGFLPAS------
HEM1_ARCB4       T-AYGIVSRMSLEFFEWLKSLEIEPIVKNLYLKGNEIIDKKVKNAIKKGFIDSK------
HEM1_SULDN       K-AHGIIGRSTVEFFEWLNTLNIEPMIKEIYEKAFEAARIESQRVIKKGFIPKE------
HEM1_SULNB       R-ANEIVERYTEEFYAWLKALSIEPVIKQMRQHVSAAIEKEMQRALKKGFVPKE------
HEM1_HELAH       K-AYEIVGLATMEFYQWIQSLEVEPLIKDLRELARISAQKELQKAVKKRYVPKE------
HEM1_CHLTB       AHLDSLREVAYRYWNSLNQRLERHDCVGANA-----------------------------
HEM1_CHLMU       LQLDSLREVGYRYWESLNRRLARRRYASV-------------------------------
HEM1_CHLFF       KEKPFLALAARKQWEVYEKKSSNISLSQIRTSR-PKLLIL--------------------
HEM1_CHLPN       KAKLLLTCAAKKQWEIYEKKSSHITQRQISSPRIPSVLSY--------------------
HEM1_SALRD       EAESICEELLEDFVTWVFHQQALQPAIQAIRSTFDTIREQEVDRHAHRTGMDREE-----
HEM1_CYTH3       PHVRKIILDSIVEFNEWSKEMEVSPTINKLKNALEQIRKEELSRFVKQLSDEE-------
HEM1_RHORT       REAHALVADAVAAFERHRAERAAVPAIAALRAHFEGERLRALAEA---------------
HEM1_CUTAK       AAAEHIIATGVRHFAVDLERRRMAPAVVALRDVISDLVTAELERLPEEGSVPVDE-----
HEM1_IGNH4       KRAEDIIEAELNKFVNFAQRVLADKILRELMEKVEQIRINELSKAMAKVPQEYAE-----
HEM1_HYPBU       PKAEAIVEEQVALLRKLWLKRGADEAIAEIMRYANRVMEEEVEELVSRLRGLGVD---GA
HEM1_AERPE       PAAEAIIEEELEALLDALSRRRARESSRSVMRALSILAEREYERTLAGLRNGVDP-----
HEM12_NOCSJ      ELAEQIVAQEVDRFLHWWVDRAAAEPVRRLRADVEACVREEVARATRGLSPDLEP-----
HEM1_CENSY       GKVEQMISGEVPVMEAAMNRLDAEPIAEAAFKEADALRRRELAKALQMLGNIGGN-----
HEM1_THEM4       STIQNLIETRIKKFLTWYKLQTVKDDILYIQNLAEKLVYEEIEKLSKKILLDDNS-----
HEM1_CALMQ       DEASRLIELRLIEYRRLFARRVIEGMIGELTKWGLSIGESEVKRAVKAGLIKNEE-----
HEM1_TROWT       KMAHELAIESSSQFVNDCKQHEATPVIVSFRNYLESLTQTSLRRTDNCKHAQHAL-----
HEM1_PARUW       EAENRVNLATYEHTNRYRQKEDSKITIFAASA----------------------------
                                                                             

HEM1_ARTS2       AAEEVEFALRRMVKQLLHVPTVRARELASNGQQEQYIAALDALYGITVEQPAAAPAAECP
HEM1_RENSM       AAEEVEFALRRMVKQLLHGPTVRARELAAAGQQAEYIAALQSLYGIELESPTPAAQPVES
HEM1_CLAMS       SSEATEKALRHLVSVLVHKPSVRARELARQGEGARVVDAVQALFGLDVEMPAAVSSPVAV
HEM1_LEIXX       SSEQTEAALRHLAGVLLHTPSVRARELARAGDAQRFADAAETLFGLRIEEAPVHPRLIAV
HEM12_PYRAR      ----AQLAAKTTVKRLLLPIVEELKKMAENGR--VEHALEVSQIFTRLVGAPHGEPQNLK
HEM12_PYRCJ      ----AVLAAKTTVKRTLLPLITKLKEMAENGK--AEEAAKLIQLLQEALQS---------
HEM11_PYRAR      ----AKIAARTTVKRTLLPVVNYLKKVAVSD---IDEAYRIISVLRLSYGLKDL------
HEM11_PYRCJ      ----ARLAAMSTVKRTLLPLVNYIKEVAVKD---LAVAEGLLQVLKSAYA----------
HEM1_SULAC       -KDNIKEIIDKMTYSLIKKVFSPILEDLRKDP---NNKKQIVEYLIEVFQNGQFSDTKTQ
HEM1_SULTO       -KEEIKNIIDKMTNSMLKKIFSPLFETVRKN----EDMANYINNIFEILSNGNISNSKTE
HEM1_SACS2       -DQQAKEILDLMTRSIIKKSFQPLFDNIRSLIFNGENSINYINFLIDIFKDGNISGFETE
HEM1_METS5       --EETREVLEAMTRSMIKKIFSPMFQNLRRAVE--NNEINYINLATSLLTHGGISQDKTK
HEM1_THEAC       --SDVEAFAHSMINKVMNIPVMTLKSVARSQS--NQDFSRIFSKFYDNFSDLVSAALQSY
HEM1_THEVO       --NDLEALAHSIINKILNVPVTTLKAVSRSQG--NSDFNRLFESFSSNFNDIVSAALQSY
HEM1_PICTO       -KKDIDAMTSSLINKILAPYTNSVKQFIKE----NKNFDYILNEYKKMLEQFMENIVKKL
HEM1_PROA2       ELRRMERLSDRILKKILHHPIKMLKSP-VDTADNIPSKVNLVRNIFDLEEQNQ-------
HEM1_CHLT3       EYERMEQLSDRIIKKLLHFPITTLK----QQTADTTDPVSFIRNIFDLKEQEEEFPGLTF
HEM12_FLAJ1      DDAQMDLISSRIIQKLTNHFASHLK----NENTSVDQSIEFIEKIFQIGQLAPNKTSSPI
HEM1_GRAFK       NDEQAEIVSNRIIQKIMKHFANHLK----GDAETTDESLELIQKVFQLEEVNK-------
HEM1_BACME       ERKVLNKHTKSIINQLLRDPIPHAKE--LAGEKHAEESLELFMKIFNIEQEVA--LQK--
HEM1_BACP2       EMKLLNKHTKSIINQMLKDPILKAKE--IAAEPNAEEKLLLFKEIFDLQVEDE--EQKVE
HEM1_BACCN       EKKVISKHTKSIINQLLKDPILVAKE--LAAEEKATEKLALFAKIFDLEVQEE--VEHTE
HEM1_LYSSC       ERKILSKHTKSIINQLLKEPILQAKE--MANSPKANEQLRLFQQIFGIEEAVE--AEVQE
HEM1_GEOTN       DRKVLNKHTKSIINQLLRDPILQVKE--LAAGPNADEALQLFMKIFNIEDAVK--AEQRS
HEM1_OCEIH       ERKVLNKHTKSIINQLLKEPVTQAKE--FAGKDNAEDSLQLFINIFGIEEEVK--EELVK
HEM1_BACSK       DIKVLNKHTKSIVNQLLRDPLTRVKE--LAAEPDAKHSLELFKTIFALEAQIELAEKAE-
HEM1_BACHD       EKKVLRKHTKSIVNQLLRDPITRIKE--LANAPEREEALDLFTKIFALEEELAEQEKQEK
HEM1_PAEMA       QRKVIRRLTKSILNQMMHDPINRIKE--MAGGKQGAEALEMFTQIFALEKHLE-------
HEM1_STAS1       ERKIISKHTKSIINQMLKDPIKQAKE--LSSDKKSNEKLELFQSIFDIEAENA-------
HEM1_LISW6       EYIQIGKHMKSIINQMLKQPISELKE--MSVENDAPTSIEHFKRIFGLTELDI-------
HEM1_EXIS2       EKTVIGKHMKSIINQLLREPLSYIKD--AAAKPDAEQRIAQFMDTFALDEELF-------
HEM1_STRSV       EQKQISKHMKSIINQVLKEPILQLKE--LSVGEHSDYDIALIAKIFGLHRERG-------
HEM1_LACRJ       ERKVISKHMKSIVNQMIKGPIKEIKE--LSVTPGATADIDFFCKIFGMDNLKV-------
HEM1_SYNP2       HQEVIETLTRGIVNKILHDPMVQLRA--QQDIEARRVCLQSLQMLFNLETEEAI------
HEM1_ACAM1       HQEVIEALTRGIVNKILHDPMVQLRA--QQDIEVRRKAMQSLNMLFNLNSSQGVAKQRNT
HEM1_SYNP6       HQAVVEALTRGIVNKILHDPMVQLRS--QQDIEARRRAVDALQMLFNLDPQGQLSS----
HEM1_THEEB       HQGVIEAMTRTIINKILHDPTVQLQS--QRDLESRQRAMQTLQDLFNLEPIEA-------
HEM1_CYAPA       HQEIVESLTRGIVNKILHDPMVQLRA--QQDIEIRGRALKILQTLFNLDTIKNGMSPTL-
HEM1_SYNJA       HLEVIEALTRGIVNKILHDPMVQLRA--QRDIEARRRAMQILQELFNLDPMPFQAQQER-
HEM1_GLOVI       HQGIIDSLTRAIVNKILHDPMVQLRA--QRDIEARRRALQTLQTLFNLEAQSNPEPPTL-
HEM1_SYNS3       ERKVVEALTKGMINKILHTPVTQLRS--PQQRSERQQALQVVEKIFDLESGAATQD----
HEM1_SYNR3       EKQVVEALTKGLINKILHGPTTALRA--PQPRQQRLDSMAAAQRLFDLPGDDADRDRSDA
HEM1_PROMP       ERKVVEALTKGIINKILHTPVTKLRS--PQSRDERQASLKIVEKLFSLVDDE--------
HEM1_FRASN       -WDMVSGTVRRVVDKLLHAPTVRVQQLAEA--PGGDSYAEALRELFDLPRDVPAIVSAPD
HEM1_KINRD       -RSEVDRAVHRIVEKLLHTPTVRVKELAEA--PGGVGYAAALRALFDLEVTAQGGALPGD
HEM11_NOCSJ      -RAEVLHTVRRVADKLLHQPTVRVRELANE--TGAVSYAAALAELFALDQEAVDAVTRPE
HEM1_THEFY       -RAEITRTVRRVVDKLLHQPTVRVKQLATG--PEGAVYAEALRELFDLDPAIPSAVVKPG
HEM1_MYCA9       -RDEVAKTVRRVVDKLLHAPTVRVKQLASA--PGGDSYAEALRELFELDPHTVEAVATAG
HEM1_RHOJR       -RDEVARTVRRVVDKLLHAPTVRVKQLASA--PGGDSYAAALRELFELSPGSVEAVAKPT
HEM1_SACEN       -RDELARTVRRVVDKLLHAPTVRVKQLAST--PGGSGYADALRELFELDPQTAAVLGTAQ
HEM1_SALTO       -RADVARTVHRVVQRLLHQPTVRVRQLAAE--PGGDQYTALLRELFDLEVPQTSAVGTVP
HEM1_ACIC1       -FEEIRTTVHRVVDKLLHAPTVRVQELAGL--AGPDSYSEALRTLFDLDPAQPVAISAPQ
HEM1_COREF       -WKEVTRTVRRVMDKFLHEPTVRVKKLAAR--SGSVSYESALQELFGLEAVQTTAPPAIT
HEM1_CORDI       -FSEVQRTVRRVVDKLLHQPTVRVKELAAQ--SGTVSYDTAIQELFGLAVEATPV-----
HEM1_CORJK       -RAAVVKSMKRVVDKLLHTPTVQAKKLSAG--GQQVSYPDALAALFNLPNGMVDSVTQPG
HEM1_CORU7       -REAVNRSMRRLVEKLLHTPTVQAKKLSAA--GQSVSYPDALAALFNLPTGMTQQVSAVK
HEM1_ROSS1       -RETVIALSTAIINKLLHEPIVALRDPEAS--GE---LLTAVRRLFNIDDTAVYTSANMT
HEM1_HERA2       -QQAVSALTSAIINKLLHQPMRAIKDTAAS--PQ---LAHAAQQLFRLDFEAI-------
HEM1_CHLAA       -RAVIEGLSRSIVNKLLHLPTRCLREAAAH--GQGKRYASILAELFNLEH----------
HEM1_RHOBA       MQKEIEKSFDRLTNKLLHPPMASLRDDAAD--GHSRGLLEALRHLFNLGEDS--------
HEM11_ANADF      GKKSVEAMAQAIVNKLLHGPTARLKAAAAT--G-DGD-LPGAAAELFGIDNDPARPEGAP
HEM1_MYXXD       QRKSIEAMGRAIVNKLLHEPTARLRAVGPE--G-EGNRLAGAAAELFGLLEEEVGTAAAA
HEM12_ANADF      VERRLEAMAGSIVSKILHAPSARLRQAVCD--GCSGEALVSAAVEIFELSADIRVHRGNA
HEM1_THET8       LEKAAGRLAHPFILGLKRRALDRVGGPPCP--EDCLLYRLSRT-----------------
HEM1_DEIRA       ------------------------------------------------------------
HEM1_RUBXD       QEEAVERMSRSIVNKLLHGPISEIKARAGA--GDPLDSAEVRRRLLSLRGPGVELHPSRE
HEM1_CARHZ       EKNIVCALAHTILNQLLHTPIVKLKQYALT--PQGHLYTEILQNLFDLQVE-GERPKNFT
HEM1_HELMO       EKKLVGSLASSIVNQLLHDPITQLRHYAAS--PEGHLYSEILQNLFCLDVP-GQRQKHVV
HEM1_DESRM       EKKIIGSLANSIVNQLLHNPVIKLKQYALT--PEGHLYTELTQNIFNLQVE-GQKPQTEI
HEM1_PELTS       DRKVICSMANSIVNQILHVPVAQLKSYALT--TEGHLYTEILQNLFNLDVP-GQKPKKQP
HEM1_DESAP       ELKVISSMANSIVSQLLHEPITRLKKLALT--PEGHFYSDALQKLFNLEPENGGVPTLVG
HEM1_MOOTA       EQKIITSMATTIVNQLLHDAIVNLKAAALT--PRGHLYVEALQELFELRVD------HTL
HEM1_DESHY       QEKIIRSMANSIVTHLLHAPIANLKEAANT--SQGHLYTEILQNLFDLDGN--ELSPHAG
HEM1_AKKM8       --------------------------------PDSALYDQ--------------------
HEM11_KORVE      QDQAMTALTAHITQRIAGSLARELKELPER--SEQDMLTMAVQRLFHLEQP---------
HEM1_DESAG       TQKALEAMLNAVVKKIHHEPICFLKRRYEE-EDSGQRYIDFARRMFNLDNEPEQPEAHKN
HEM1_LAWIP       TREALETMIDALIRKLTHDPISYLKCAHRT-IDTN--HITLARQMFNLDKIPQTNKAVNE
HEM1_DESPS       DQRSIEKMVASISSKFLHDPLHYLKSDSCHGRDKSQAKVDTLRSVFSLKGDI--------
HEM1_SYNFM       DRLAVEALTEAIVKKLLHDPIVFLKKKADR--STKDMYVDYTQQLFNLADGDDGEEAPAV
HEM1_SYNAS       DQRHVESLMASIVNKILHEPTACLREQSRN--RNGKAYAAALRKLFKLER----------
HEM1_PELPD       AEKRLEIMTLSIMNKLLHTPTAVLKRAGQG--GRTDLYTDALRQLFDLQTSRQDD--DEL
HEM1_PELCD       DRRAVEALTRAIVNKVLHSPLSVLKRAGDD--ITGEIYLEAVRRLFDLNPDSQQTGGDSV
HEM1_MAGMM       DRQRVENLARQLVNKLMHDPTERLRSLTNE--HDGDRYIDAARKLYKLDDD---------
HEM12_KORVE      QEMAVDALTKGIINKIMHTPITTLKTAAKE--PESTTVIELVKRIFNLHEKAKDETVKTG
HEM1_SOLUE       QEEALEALTRGIINKVAHGPISELRSQAGK--PDGAPAIAAIRKAFHLQD----------
HEM1_THEYD       LINSIDYLTQSIINKIMHSPTVALKNNCEN--KE--ILIFSARRLFGLDSEEE-------
HEM1_SULSY       ERETIDLAMRSLINKLLHRPTMYIKDKAAK--EGNTEVVKIFEDMFSSKWDFRKK-----
HEM1_AQUAE       -------EVSPYIKKLVHRAIKEIK--------RNPEVADIILRIFKEVEKNEPR-----
HEM1_NATTJ       EQEAVDKLTKSIVNKILKEPVLRIKEFAVE--DKSELYMATLAQLFDLEDEVIPKDGEEH
HEM1_RHOFT       VEAVLEALSKGLTQKMLHGAMTELRASDTAARERASAAIQHFFLRKER------------
HEM1_METPP       VDAVLDALSRGLTQKMLHGTLAELHASDPAQRAQLATTVSRLFLRGAIPPDAVRPSGPRE
HEM1_RALSO       PALVLEALSQALTKKFLHGPTHALNHAQGEGREQLIDLLPGLFRQSSHSER---------
HEM1_POLAQ       PQEVLNAMAQGLTNKFLHGSLHALQHSNGAERDALIKLLPKLFASHSKPEDH--------
HEM1_JANMA       IDAVLEALSKGLTAKFLHGPQQALNNAQGDERARLAALLPQLFRTKR-------------
HEM1_BORA1       PEAVLEQLAHGLTQKYLHGPLAALNRSAGDERKQLLAWMPRLFPGRDSRR----------
HEM1_AROAE       PRKVLDALSHGLINKLMHSPTRYLNQSEGEQQADASRLVQQLFNLSNSPD----------
HEM1_DECAR       PEKVLEHLSHRLTNKFLHAPTQTLNSAEGGERADLQGAAARLFHLHAAD-----------
HEM1_NITMU       PRKIIESLSNGLTNKFLHLPSYALNHAAEDERDDLVDLISRLYHLHPSE-----------
HEM1_THIDA       PHAVLDAMSHGLANKFLHAPTHGLSHATPEERAELVRLISQLYGLHPE------------
HEM1_METFK       PAQVLDALSNALTNKLLHGPSHALNSATGEDREQLEATLRQLYQIHH-------------
HEM1_NEIM0       AEEVLERLSIQLTNKLLHSPTQTLNK-AGEEDKDLVHAVAQIYHLDK-------------
HEM1_CHRVO       PEKVLEALSVQLTNKLMHPPTQALSSGSGAEHDAQVQAIARLYRLHPES-----------
HEM1_MANSM       PETVLQELSYKLMNKLIHSPTQAMQAMMKQGSIQGLRSFSSALGIADKKERNPQK-----
HEM1_PASMU       SEAVLQALSYKLTNKLLHSPTQVMNAMVKTGNSTGLALFSSTLKSDVE------------
HEM1_HISS2       TEQVLQELSHKLTKKLIHQPTQAMQTMVKAGNTEGLQAFSHAVKS---------------
HEM1_ACTP2       SEKVLNELSYKLTNSLLHVPTQALQAMAKSGNSQGLQSFSKALKLEEQ------------
HEM1_AERS4       AEQALKAMAHRLTNKLIHAPTQALRQAAAQGDHHQLSRLRQVLGLPQE------------
HEM1_SHELP       SEQLILELANKLTNKLIHAPTQALTQASRRGDLNSLGQLRAALGLDKD------------
HEM1_PSYIN       AENVLKELAFKLTNKLIHHPSLALNETARSGNDDELILLRNALGLSKKD-----------
HEM1_ALISL       AEKVLAELSNKLTNKLIHAPTLAMQQAAKNGEPDKLAVIRTSIGLDN-------------
HEM1_PHOPR       PEKVLVELSNKLTNKLIHAPTRAMQQAAHNGEPEKLSVIRETLGLDSIKD----------
HEM1_SODGM       PEQVVKDMAYKLTNRLIHTPTKSLQQAAREGDAERLQILRDGLGLDTH------------
HEM1_PROMH       AEKVIQQLSHQLMNRLIHTPTKSLQQAASDGDIERLNLLRESLGITHN------------
HEM1_COLP3       SEAVLAELANKLTNKFMHAPTSALQSAAQGGELDKLIYLRDIFNIDSQE-----------
HEM1_PSEHT       AEKVILELANKLTNRLMHAPTRAIQDAAKKGEVAQLNQLKKMLGIDQE------------
HEM1_PSEA6       AEQVIKELANKLTNSLIHAPTKALKKAAMQQDNKNMSLLQDALGLARANDSSK-------
HEM1_IDILO       PAEVLQRFSHRLVQQLTHKPTSLLKSAGENNDQYTLAVLQQLWSEPSSDSSKGK------
HEM1_ALCBS       AEQVLRRFQHSLVNKWLHSPSVTLRKMAADGRAEALLLARELLLDD-----DQS------
HEM1_CHRSD       PEKVLQRLSRQLTNKLLHGPTLRLREASGEARHDILKAADTLLIDP-----AASTQDSA-
HEM1_HAHCH       PESVLRMLAHGLTNKLIHHPTVQVRRASAEGRQEVTGWLRDLFQLP----DEKVNND---
HEM1_MARHV       PETALRSLARGLTNKLLHQPSVQVRKAMAEGRTEVTECLRELYQLDALEADEPTTTEKL-
HEM1_PSEU5       AEDALAQLARGLTNKLLHAPSVQLKKLSAEGRVEALSMAQELFALH-----EGTEKP---
HEM1_SACD2       PAQVLEQLARSLTNKFLHTPSTQLKQAGADGEQDMLRTVRTLFSLPSAN-ESKSEKE---
HEM1_MARMS       PEQVLNKLAHGLMNKLIHAPTRYLRDAGADADQDALIIASNVLGIYE----EKDN-----
HEM1_ALKEH       PERVLAWLSHTLTNRLLHAPTVGLREAAEAGDRERIELARTLLQIENANED-TRESVDKE
HEM1_HALHL       PFEVIEWLTHTLTRRLVHAPTVGLRAAAATGDRTRIQHALETLAIDQQLVERSSEGDDSQ
HEM1_NITOC       PNEVLTMLAHNLTNKLMHVPTRQLRSLGATGDELALQAALKIFDVDHFKA----------
HEM1_METCA       AEDTLRWLADTLTNKIIHAPSSQIWQAGVNERADIVAAARELFQLKDPDT----------
HEM1_HYDCU       PQELLTKLANQLTNKILHTPTTNLHHAGLNGQKEVIQAAEQILLTQQSDASDSSENENTH
HEM1_COXBR       PKAVIAHFAHNLTNKILHQPTTKLRQAAYEDQVQLLLSAKELFDL---------------
HEM1_LEGPL       QQDVLNEFSMRLVNKLTHNPTIGLRQMAWDNREDLLDLARYLFDTTANQSLYEEIS----
HEM1_XYLFT       AEEVLEQLAHGLTNRLLHPPTAALREAALANNTELVRAAEQLFPEKPGYHHPTLQTTIVK
HEM1_DICNV       PEKVLAEMSYKLTNKLLHQPCALIHAIPPDHKDWLAVVADTFNAELPK------------
HEM1_VESOH       YENIIRKFADQLTNKLLHLPSKNIKQTSTDNLSQCEGCIPNIKK----------------
HEM1_FRAP2       PEEVLKRFAYEIKKKVLHYPVVGMKEASKQGRSDCLVCMKRMFGLNVEK-----------
HEM1_WIGBR       PENIIKKLTYKLTNRLVHKPTKLLYNTSCSKNNKDLYDLYNKLKIDL-------------
HEM1_PSYCK       PEDIMIELTRRLTQNLTHAPSKLMRKAAREGDNELLDFVVSGLQDAHRNH----------
HEM1_PSYWF       AEEVMTELTRRLTQTLVHAPSSLMRRAARDGNNEAIDLIILGLKDAYRKK----------
HEM1_ACIAD       AEDVLKQFAHRLTQKMMHPTSILLREAAQHESPDYFEWMKEQLTDVFEHQRKPKNNLDR-
HEM1_METBF       ETDVLDDLTHSIANKILAEPTKVLRQAAELGNDEFLDVAARIFCLEKDKVKAEKIKSDCG
HEM1_METBU       ERKVLEDLTHAITNKILAEPTKKLRNAAEYDDDKFLDSVSRLFDIR-------PIKKNDG
HEM1_METTP       EQKVLMDMSHSIVNKIFAEPTKALKSAAERGNTEMLRYAMELFRLN-------QEESD--
HEM1_METAR       QISILHDFSMALTNKILAAPTRQLRRAAERCDEDCLRTAEELFDLW--------VEESNG
HEM1_ARCFU       VKEILNDFANSLIKKFLREPTVRLREAARKDEFHVIESIKYVFGDGNG-----RVSEGKD
HEM1_METKA       PENVLQDFAEAYTKRLINVLTSAIMELP--------DEYRRAACRALR-----RASELNG
HEM1_METVS       PDEIMENFSKAFVKRITHDFVSYSLSVSKED---LLNSIWWKK-----------------
HEM1_META3       PTVVLEKFSKVFANKLISDFVNIVNDDTIGDIERVVNKLNKNKI----------------
HEM1_METJA       VEEVLEDFSKALCKRIIYDIIKIFENVEDKEVFECLAKEFKKLGNKNKN-----------
HEM1_METTM       PERVVEGLTRSIVDKIFHDIALKIRDAAERDDREFLRMCSELFDCDES------------
HEM1_METS3       NAKIIDNLTNSIVNKIFFDISKKIKQAAHENDEELIRAIEFMFEEK--------------
HEM1_METST       SSKKVDYLTRSITDKLLYNIINNLKEAAANNDKDTIRNAKKILLEYN-------------
HEM1_METMJ       TAEVIDDLTHALTNKILSDVTTAIRACAECGDITTAEALMRAITRGEPCFQNEE------
HEM1_METB6       TAGVIDDLSRVLTKKILTDATASIRACAEEGDRDAAEALVRALTRGSAADSREGTE----
HEM1_METHJ       VRDVTDDLTRVLTRKLLTDVTLTIRTCAERGEMKIAEDLVGAITRGENICSRTYD-----
HEM1_METLZ       LESVIDDLTSALTKKLLEDAAKSIRASAECTDTQTAEILLKAIISGEVSCIRRSE-----
HEM1_HALMA       QAEVVEAMADAIVSQILAAPTKSLRDAAEEDDWSTIHTALQLFDPDFGG--PDQATPPEF
HEM1_NATPD       EHEIVESMADALVGQLLSAPTQSLRDAAEEDDWATINAALQLFGPGLE---PEPTELPTV
HEM1_HALS3       EREVVESMADALVSQLLAAPTKSLRDAAAEDDWSTIATALELFNPEFE------------
HEM1_HALWD       QRETISSMADTLINQLLAAPTKSLRDAAAEDDWTTIQTAMTLFDPNFGGDTPQPDRPDDI
HEM1_ALKOO       ------------------------------------------------------------
HEM1_CLOTH       ------------------------------------------------------------
HEM11_LACP7      DKELLAATVHSATNKVVSKLMFGLRDHVSAATFQECMVALKNIY----------------
HEM12_LACP7      QQELLQSNVQMAAKKAVSKIIFGLRDVLQIDQCEEVLQALEQSAMNCTDSVK--------
HEM1_CLONN       DKEILEKMLFGALKKVVKEPILNLKELKDEDEINKYIKSVNELFKF--------------
HEM1_ALKMQ       DRQVIEVVVKSLVKKMWKTPILQLKDAGIRGNGEAFAAFVDEFLGLDAGCGK--------
HEM1_CLOAB       -DMLVNMLIKSTSNVYINRAIEVLKEEQLKGRGEDCLRILRRIFQK--------------
HEM1_CLOTE       -DALAEIMLKSTSNAYINKAIEVLKEEQLKGRGEECLRIIEKIFYSAQ------------
HEM1_CLOK5       -DILVKTMIESTARFYINRAIEVMKEEKLNGREEECLRLINKIFCK--------------
HEM1_CLOBB       -VDLANRMIKSTSDYYMNRAIDIMKEETLKGSEEECLRIIKSIFMTKK------------
HEM1_CLOB8       -IALAHKLIKSTSDFYINRAIEVIKEETLKGCGEEWIGIIEKIFMTKE------------
HEM1_CLOP1       -AKLAERMIKSTADAYVNRAIELLKSEALKGSDSYCAEIIEKIFLT--------------
HEM1_CALS8       -REEVERLLIRMANLYIDRAIEVLREAHKEGSGEICSNLIKRIFLK--------------
HEM1_CAMC5       DKEEAAKLIHQVFKAFLHSPTINLKSLASKNDAEQIAGGIKFLFDIKEE----NLENLTK
HEM1_CAMFF       DQDEASKLVHQVFKAFLHTPSVRLKEKNS----DDILKALEYLFDIKIQ----KDENLEG
HEM1_CAMHC       DIDEARKLIHQVFKAFLHTPTVNLKNLDE--NAQNDINAIAEIFGIEED----FDKFCEN
HEM1_CAMJD       DKEEARKLIHQVFKAFLHMPTVNLKHLQGKMQSDTVINAMRYVFDLKNNLEGLNQYKCEF
HEM1_NITSB       YEKSIEKLLHNAFNRFLHDPTKQLKAIADEPRADTIVEAIKFFFEIEEE-VGLNRYKCEY
HEM1_WOLSU       CEKSVEKIIHNSFNTFLHHPTIKLKEISEEPQSDTVVEAVKLLFGIQEDGLMLDRYKCEY
HEM1_HELHP       YQQNVEKILHGAFNTFLHQPTIRLKQASENPQGDPIIEAMKNVFDISDDVVMLNGYKCEK
HEM1_ARCB4       DEENIRKLCLTVITEYLHNPAKQLKDISKNMECDLVVGTVQNMFSLNENSTSKNRYKCDH
HEM1_SULDN       YEDQIHKMSQQVLKRFLHQMSSKMRSVSEESKADMLTSAVQFLIEKDQR-DIPDKYKCEH
HEM1_SULNB       YESNMRKMAEQMFNRFLHDPTQNLRASSTESKNTNCIESVKKMFNIDTEHVDFKQYKNDH
HEM1_HELAH       YESNIEKILHNAFNAFLHHPTIALKKNAQKEESDVLVGTIKNLFNLDKSSTNHAQNLNLY
HEM1_CHLTB       ------------------------------------------------------------
HEM1_CHLMU       ------------------------------------------------------------
HEM1_CHLFF       ------------------------------------------------------------
HEM1_CHLPN       ------------------------------------------------------------
HEM1_SALRD       ----VDRLTESIMQKLLAVPIVRLKNVDPESIDFVQGIELLHALFAPSDESDAGRSLAEA
HEM1_CYTH3       -AKKVDEITKSIMQKIIKLPVLQLKAACKRGEAETLIDVLNDLFNLDKQPEQIRD-----
HEM1_RHORT       -PDDAEKATRLLVGRLLHGPSEALRDLAAGSADKEFMTVRAEMLLRRLFDLPTSIAETGA
HEM1_CUTAK       ----VAASLRRLAASMAHIPSARARMASEQGLGDRWLNSLSDVLGIDVDIAAPVIDMSSF
HEM1_IGNH4       ---VLDKMTSSLVKKVLKDVILKVREAAGKGDLTTLRIVAEVFDLKESLNNIEIIYDYNG
HEM1_HYPBU       ALLVARSFAYSLTKKLLRPLILYAHEAALEGSLSKLEEIAQKYRDELARRQH--------
HEM1_AERPE       -REAVELALNSYTKKVGGALRRLLEEASDRGQLSLEDIEAILVSEFARIAENSGFKNGST
HEM12_NOCSJ      ---LVAEGIRRAVQHLAHGPTRRLLDAAAAGEDEVVALLAGLFAPSAEEDQAVPAYSPQP
HEM1_CENSY       DAKVIDDLTRALVESIMSAPMNNLRRASEEGDADVVDAAARLFDYRRPG-----------
HEM1_THEM4       -LKQIQKSLKSCTKKIVSYHINYIKEKVI-------------------------------
HEM1_CALMQ       --DGAALAVKSTVKKIMLPLLTYLKELAEEDKFDEALIIISGIKAKLNGDGKQS------
HEM1_TROWT       ---------KHFVNSLIHIPLTRCKQLAANGESHKFAESMEILFDVKTDCTEGTQYQSSC
HEM1_PARUW       ------------------------------------------------------------
                                                                             

HEM1_ARTS2       VDHGRAGQAPADV----RRETA--------------------------------
HEM1_RENSM       IPAVEPASCPVNHNAVDRSQSA--------------------------------
HEM1_CLAMS       ALPRTAEAGQAS------------------------------------------
HEM1_LEIXX       DRVTAS------------------------------------------------
HEM12_PYRAR      TVK---------------------------------------------------
HEM12_PYRCJ      ------------------------------------------------------
HEM11_PYRAR      ------------------------------------------------------
HEM11_PYRCJ      ------------------------------------------------------
HEM1_SULAC       KIEKQ-------------------------------------------------
HEM1_SULTO       EAKEK-------------------------------------------------
HEM1_SACS2       KIKEKQVSERSSI-----------------------------------------
HEM1_METS5       EIKTEQEYKGRSSGDETDS-----------------------------------
HEM1_THEAC       EGRQDTQSLRDRTRRLLQRS----------------------------------
HEM1_THEVO       EGLRDTQSLRDRTRQLLQKS----------------------------------
HEM1_PICTO       ------------------------------------------------------
HEM1_PROA2       ---LKQ------------------------------------------------
HEM1_CHLT3       PINLKEQNNN--------------------------------------------
HEM12_FLAJ1      ADKYKINLS---------------------------------------------
HEM1_GRAFK       ------------------------------------------------------
HEM1_BACME       --EKEE---QLHTSITSHSVAYQS------------------------------
HEM1_BACP2       PVQVEQGSFQLFKPNMAQGFATVASE----------------------------
HEM1_BACCN       ----ELEHKRAWTPSVSSL-----------------------------------
HEM1_LYSSC       MTKQELERKERAQATQTSAEPKYSF-----------------------------
HEM1_GEOTN       AQRAEVQLRDEQQAEAVRAARPSWQL----------------------------
HEM1_OCEIH       HAKKNETLMKIAKEEPSSFPIIEKITTA--------------------------
HEM1_BACSK       ADHAEQSWKEGQRPSLNQGMALRT------------------------------
HEM1_BACHD       VKQAEQEWLAKKRPITCMEKQSHVMVKS--------------------------
HEM1_PAEMA       -----------AGAPVGRGKRRLP------------------------------
HEM1_STAS1       ----YEAKKQKNNMKTGQILSFE-------------------------------
HEM1_LISW6       ----TLSEKTQEQAETRS------------------------------------
HEM1_EXIS2       ----DSAAEEMVLQEETTAERKAVNR----------------------------
HEM1_STRSV       -------------KDEGH------------------------------------
HEM1_LACRJ       -------------ENQNNDK----------------------------------
HEM1_SYNP2       ------------------------------------------------------
HEM1_ACAM1       ------------------------------------------------------
HEM1_SYNP6       ------------------------------------------------------
HEM1_THEEB       ------------------------------------------------------
HEM1_CYAPA       ------------------------------------------------------
HEM1_SYNJA       ------------------------------------------------------
HEM1_GLOVI       ------------------------------------------------------
HEM1_SYNS3       ------------------------------------------------------
HEM1_SYNR3       K-----------------------------------------------------
HEM1_PROMP       ------------------------------------------------------
HEM1_FRASN       LDLVERT-----------------------------------------------
HEM1_KINRD       APLSGTVADAVGHVS---------------------------------------
HEM11_NOCSJ      GLT---------------------------------------------------
HEM1_THEFY       TALGEER-----------------------------------------------
HEM1_MYCA9       ELPLATKELHE-------------------------------------------
HEM1_RHOJR       DLGGATDLSAIDITDGFIAGQDPRLRRFVTDDNHGKESQA--------------
HEM1_SACEN       ADDGRARGSASVAEARRAGAPGARDELRDLPAQDGDDR----------------
HEM1_SALTO       DVVVPDVDPQLGGDAEAPPTGGE-------------------------------
HEM1_ACIC1       PSTDSPARAAYQPTDEAATDAEPRRDDAEPPSAAAAQDAGRESRP---------
HEM1_COREF       SVNASDLPDAGIVAIVNSPSTTGQSVSVDGS-----------------------
HEM1_CORDI       AVNVDELPERINKR----------------------------------------
HEM1_CORJK       QADSSAAQTAGTSARADQIPSAARVGRVVREA----------------------
HEM1_CORU7       GANAGSGQRKKQKPQENRVSTARAVYRSTYQDLTQASTPGGKDDDQ--------
HEM1_ROSS1       ------------------------------------------------------
HEM1_HERA2       ------------------------------------------------------
HEM1_CHLAA       ------------------------------------------------------
HEM1_RHOBA       ------------------------------------------------------
HEM11_ANADF      AQPAEGRAAASSERS---------------------------------------
HEM1_MYXXD       PSVMAAPVQVATGGK---------------------------------------
HEM12_ANADF      A-----------------------------------------------------
HEM1_THET8       ------------------------------------------------------
HEM1_DEIRA       ------------------------------------------------------
HEM1_RUBXD       P-----------------------------------------------------
HEM1_CARHZ       HPREEMEESDEKRSYCGESR----------------------------------
HEM1_HELMO       VHYPAVEQRQNRA-----------------------------------------
HEM1_DESRM       IPPEKKKKVAGGSTLNSGWDKGIAAMVADSRSRE--------------------
HEM1_PELTS       APAGIKEPVLAKKG----------------------------------------
HEM1_DESAP       RTESCPVSCLKGKGC---------------------------------------
HEM1_MOOTA       PGPDMAVSVEGGRKY---------------------------------------
HEM1_DESHY       WSVHHAASHHSNQG----------------------------------------
HEM1_AKKM8       ------------------------------------------------------
HEM11_KORVE      ------QKAAAGTN----------------------------------------
HEM1_DESAG       RKRPQPDLPAGCPGKTIL------------------------------------
HEM1_LAWIP       D-----------------------------------------------------
HEM1_DESPS       ------------------------------------------------------
HEM1_SYNFM       TVQMASAGNDGTLLKTFEPDKESPWRKS--------------------------
HEM1_SYNAS       ------------------------------------------------------
HEM1_PELPD       ELELEEE-----------------------------------------------
HEM1_PELCD       EKDADSKQDLTS------------------------------------------
HEM1_MAGMM       ------------------------------------------------------
HEM12_KORVE      PPQSGPGK----------------------------------------------
HEM1_SOLUE       ------------------------------------------------------
HEM1_THEYD       ------------------------------------------------------
HEM1_SULSY       --GKNLEEIEDIVREEQ-------------------------------------
HEM1_AQUAE       --RKELSNVYNGTHGA--------------------------------------
HEM1_NATTJ       SSSKEVESVTQSSTERGHHESDFHN-----------------------------
HEM1_RHOFT       ------------------------------------------------------
HEM1_METPP       DDHLDGV-----------------------------------------------
HEM1_RALSO       ------------------------------------------------------
HEM1_POLAQ       ------------------------------------------------------
HEM1_JANMA       ------------------------------------------------------
HEM1_BORA1       ------------------------------------------------------
HEM1_AROAE       ------------------------------------------------------
HEM1_DECAR       ------------------------------------------------------
HEM1_NITMU       ------------------------------------------------------
HEM1_THIDA       ------------------------------------------------------
HEM1_METFK       ------------------------------------------------------
HEM1_NEIM0       ------------------------------------------------------
HEM1_CHRVO       ------------------------------------------------------
HEM1_MANSM       ------------------------------------------------------
HEM1_PASMU       ------------------------------------------------------
HEM1_HISS2       ------------------------------------------------------
HEM1_ACTP2       ------------------------------------------------------
HEM1_AERS4       ------------------------------------------------------
HEM1_SHELP       ------------------------------------------------------
HEM1_PSYIN       ------------------------------------------------------
HEM1_ALISL       ------------------------------------------------------
HEM1_PHOPR       ------------------------------------------------------
HEM1_SODGM       ------------------------------------------------------
HEM1_PROMH       ------------------------------------------------------
HEM1_COLP3       ------------------------------------------------------
HEM1_PSEHT       ------------------------------------------------------
HEM1_PSEA6       ------------------------------------------------------
HEM1_IDILO       ------------------------------------------------------
HEM1_ALCBS       ------------------------------------------------------
HEM1_CHRSD       ------------------------------------------------------
HEM1_HAHCH       ------------------------------------------------------
HEM1_MARHV       ------------------------------------------------------
HEM1_PSEU5       ------------------------------------------------------
HEM1_SACD2       ------------------------------------------------------
HEM1_MARMS       ------------------------------------------------------
HEM1_ALKEH       QTGTTQGAARGDQRSTG-------------------------------------
HEM1_HALHL       QAGADGGAARGDRRAAGGS-----------------------------------
HEM1_NITOC       ------------------------------------------------------
HEM1_METCA       ------------------------------------------------------
HEM1_HYDCU       ATS---------------------------------------------------
HEM1_COXBR       ------------------------------------------------------
HEM1_LEGPL       ------------------------------------------------------
HEM1_XYLFT       TDETDPAS----------------------------------------------
HEM1_DICNV       ------------------------------------------------------
HEM1_VESOH       ------------------------------------------------------
HEM1_FRAP2       ------------------------------------------------------
HEM1_WIGBR       ------------------------------------------------------
HEM1_PSYCK       ------------------------------------------------------
HEM1_PSYWF       ------------------------------------------------------
HEM1_ACIAD       ------------------------------------------------------
HEM1_METBF       IKVEKMKPDCESATDRVSEKGN--------------------------------
HEM1_METBU       ITK---------------------------------------------------
HEM1_METTP       ------------------------------------------------------
HEM1_METAR       IPGNKTKASKTD------------------------------------------
HEM1_ARCFU       AKVEEGKPEVDVQRSKAES-----------------------------------
HEM1_METKA       ------------------------------------------------------
HEM1_METVS       ------------------------------------------------------
HEM1_META3       ------------------------------------------------------
HEM1_METJA       ------------------------------------------------------
HEM1_METTM       ------------------------------------------------------
HEM1_METS3       ------------------------------------------------------
HEM1_METST       ------------------------------------------------------
HEM1_METMJ       ------------------------------------------------------
HEM1_METB6       ------------------------------------------------------
HEM1_METHJ       ------------------------------------------------------
HEM1_METLZ       ------------------------------------------------------
HEM1_HALMA       TKGMSVEDIPDG-MRDEIPNAMLDRLSDD-------------------------
HEM1_NATPD       PDG--PEGVPEE-LRERMSSGMLEQFSTNDD-----------------------
HEM1_HALS3       ------DGMPFD-ASRGGDAASAE--SED-------------------------
HEM1_HALWD       PRAAERGDISGDDLPDDVPNHIAEKVSDG-------------------------
HEM1_ALKOO       ------------------------------------------------------
HEM1_CLOTH       ------------------------------------------------------
HEM11_LACP7      ------------------------------------------------------
HEM12_LACP7      ------------------------------------------------------
HEM1_CLONN       ------------------------------------------------------
HEM1_ALKMQ       ------------------------------------------------------
HEM1_CLOAB       ------------------------------------------------------
HEM1_CLOTE       ------------------------------------------------------
HEM1_CLOK5       ------------------------------------------------------
HEM1_CLOBB       ------------------------------------------------------
HEM1_CLOB8       ------------------------------------------------------
HEM1_CLOP1       ------------------------------------------------------
HEM1_CALS8       ------------------------------------------------------
HEM1_CAMC5       DIDEI-------------------------------------------------
HEM1_CAMFF       NLK---------------------------------------------------
HEM1_CAMHC       SLENKNEI----------------------------------------------
HEM1_CAMJD       DMENNDEIY---------------------------------------------
HEM1_NITSB       YMNLRS------------------------------------------------
HEM1_WOLSU       DTTSKEREE---------------------------------------------
HEM1_HELHP       DTIF--------------------------------------------------
HEM1_ARCB4       LSKN--------------------------------------------------
HEM1_SULDN       ALNIIEGR----------------------------------------------
HEM1_SULNB       HTKGYSA-----------------------------------------------
HEM1_HELAH       KCEYYEE-----------------------------------------------
HEM1_CHLTB       ------------------------------------------------------
HEM1_CHLMU       ------------------------------------------------------
HEM1_CHLFF       ------------------------------------------------------
HEM1_CHLPN       ------------------------------------------------------
HEM1_SALRD       PDADTPDLGEAPSRCPYMTHDPGGDGTETEEVQKALRLSAAHQAASHSEEVRGG
HEM1_CYTH3       ------------------------------------------------------
HEM1_RHORT       TDREDGSKG---------------------------------------------
HEM1_CUTAK       ANADCMTCPVTGLRVEDLATDAAPRGEERTS-----------------------
HEM1_IGNH4       VEQELKRKLEL-------------------------------------------
HEM1_HYPBU       ------------------------------------------------------
HEM1_AERPE       G-----------------------------------------------------
HEM12_NOCSJ      IGNTSNAAASATPRR---------------------------------------
HEM1_CENSY       ------------------------------------------------------
HEM1_THEM4       ------------------------------------------------------
HEM1_CALMQ       ------------------------------------------------------
HEM1_TROWT       GKSFD-------------------------------------------------
HEM1_PARUW       ------------------------------------------------------