CLUSTAL format seed alignment for MF_00088

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

Y1756_CLOAB      ------MKQLLETIAKSLVDCPDEVQVSEVTGEQSIILELKVAPEDMGKVIGKQGRIAKA
Y1711_CLOPE      ------MKELVEIIAKSLVDKPEDVHVNEVLGEESIILELKVSPEDMGKVIGKQGRIAKA
Y1460_CALS4      ------MGELVKTIAKALVDNPDAVEVNEIHGHQSIIIELKVAPEDMGKVIGKQGRIAQA
Y2482_BACHD      ------MKTLVEHIAMALVDHPDDVRVSEHDDGHSLHIELSVHPDDMGKVIGKQGRTAKA
Y124_AQUAE       ---MSALKDIVELTAKELVDNKDKVRVTEIEGEKTVVIELRVDPAELGKVIGKQGRIARA
Y696_BORBU       MKEYGNEIELIEFIVKSLVDKEDEVKLNVIEGEKSTILELRVSQSDVGKIIGRRGRIARA
Y906_TREPA       --MVTMEEELIAYIARALVDRPGEVTVTKSPGEGLEILQLRVASEDVGKVIGKHGRIARA
Y022_CHLCV       ------MKDFLAYIIKNLVDRPEEVHIKEVQGTHTIIYELTVAKPDIGKIIGKEGRTIKA
Y720_CHLPN       ------MKEFLAYIIKNLVDRPEEVRIKEVQGTHTIIYELSVAKPDIGKIIGKEGRTIKA
Y030_CHLMU       ------MKEFLAYIVKNLVDRPEEVHLKEVQGTNTIIYELTVAKGDIGKIIGKEGRTIKA
Y659_CHLTR       ------MKEFLAYIVKNLVDKPEEVHLKEVQGTNTIIYELTVAKGDIGKIIGKEGRTIKA
Y1910_LISIN      ------MEELILSIVKPLVDHPEDVVITPEETDTSLTYKLSVSKEDMGRVIGKQGRIAKA
Y1823_LISMF      ------MEELILSIVKPLVDHPEDVVITPEETDTSLTYKLSVSKEDMGRVIGKQGRIAKA
Y1796_LISMO      ------MEELILSIVKPLVDHPEDVVITPEETDTSLTYKLSVSKEDMGRVIGKQGRIAKA
YLQC_BACSU       -MTDQHLEDLIVHIVTPLVDHPDDIRVIREETDQKIALRLSVHKSDTGKVIGKQGRTAKA
Y1533_OCEIH      ------MKALIESIVASLVDYPEEIVINKTEEESKVVYHLTVHPDDVGKVIGKNGRIAKA
Y1556_LEPIC      ------MEELLKYIVASLVEFPEEIVIREIEGEEQNIIELRVSPKDVGKVIGKNGRIAKS
Y2390_LEPIN      ------MEELLKYIVASLVEFPEEIVIREIEGEEQNIIELRVSPKDVGKVIGKNGRIAKS
Y1567_THEMA      ------MKELLEKILRGIVKHPEEVVVMEFDEEGKKVYEIVVNEEDVGQVIGKDGRTIKS
Y2908_MYCTU      --MSAVVVDAVEHLVRGIVDNPDDVRVDLITSRRGRTVEVHVHPDDLGKVIGRGGRTATA
Y2932_MYCBO      --MSAVVVDAVEHLVRGIVDNPDDVRVDLITSRRGRTVEVHVHPDDLGKVIGRGGRTATA
Y1617_MYCLE      --MSTVVVDAVEHVVRGIVDNPDDVRVDLVISRRGRTVEVHVHPDDLGKVIGRGGRTATA
Y5592_STRCO      -----MLEEALEHLVKGIVDNPDDVQVASRNLRRGRVLEVRVHPDDLGKVIGRNGRTARA
Y5592_STRLI      -----MLEEALEHLVKGIVDNPDDVQVASRNLRRGRVLEVRVHPDDLGKVIGRNGRTARA
Y1489_LEIXX      -----MLAPALTHVVKGIVDHPDDVRVVAKSSPRGEVLEVRVNPEDLGRVIGRSGRTAKA
                           :      :*.    : :           .: *   : *::**: **   :

Y1756_CLOAB      IRTVIKAAAVKENKRVVVEII------
Y1711_CLOPE      IRTVVKAAAIKENKKVVVEII------
Y1460_CALS4      IRTLVKAAALKEKKRVIVEII------
Y2482_BACHD      LRSVVYAAATKQKRRVRLDIID-----
Y124_AQUAE       LRTILTAIGRKIGKRVVLEILE-----
Y696_BORBU       IRTLLGACAAKTNRRVQLEILD-----
Y906_TREPA       LRTLLSASAHASQTRYALEIID-----
Y022_CHLCV       IRTLLVSVASRNNVKVSLEIMEDK---
Y720_CHLPN       IRTLLVSVASRNNVRVSLEIMEEK---
Y030_CHLMU       IRTLLVSVASRDNVKVSLEIMEER---
Y659_CHLTR       IRTLLVSVASRDNVKVSLEIMEER---
Y1910_LISIN      IRTLVYAVGSKNDKKIRLEIIE-----
Y1823_LISMF      IRTLVYAVGSKNDKKIRLEIIE-----
Y1796_LISMO      IRTLVYAVGSKNDKKIRLEIIE-----
YLQC_BACSU       IRTAVFAAGVQSSKKVQFEIFD-----
Y1533_OCEIH      IRTVVYASKTDGNKRIYLDIM------
Y1556_LEPIC      LRAILTAASVKAGKNFSLEIID-----
Y2390_LEPIN      LRAILTAASVKAGKNFSLEIID-----
Y1567_THEMA      LKILLSALMG-DSKEITIKVVR-----
Y2908_MYCTU      LRTLVAGIG---GRGIRVDVVDTDQ--
Y2932_MYCBO      LRTLVAGIG---GRGIRVDVVDTDQ--
Y1617_MYCLE      LRKLVAGIG---GRGIRVDVVDTDQ--
Y5592_STRCO      LRTVVGAIG---GRGVRVDLVDVDHVR
Y5592_STRLI      LRTVVGAIG---GRGVRVDLVDVDHVR
Y1489_LEIXX      LRTLVTALAD--GRRVRVDVVDD----
                 ::  : .          ..:.