CLUSTAL format seed alignment for MF_00092

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

F8E638_FLESM      --------------------MKYS--DSLEFEKFKEIADSEFTSLFAKEKLSSLHPVNNL
D3P8K4_DEFDS      --------------------MINT--QQLEFEIYKDLIKKKFISSFSIKYLENLKPYQVS
E4TIY8_CALNY      --------------------MIDSSFQQIDFLQFKEHLKKHSISQFSSDFIDELTPFNST
D4H7D0_DENA2      --------------------MIHL--ETLEFGLFKEYMMRGFTSSFSKKRLEALKPYYAL
MUTS2_AQUAE       --------------------MREKDLIKLEFDKVKEVLASYAHSPATKEKIQNLKPYTNK
MUTS2_THEMA       ----------------------MDYLESLDFPKVVEIVKKYALSDLGRKHLDT---LKPT
MUTS2_THEP1       ----------------------MDYLESLDFPKVVEIVKKYALSDLGRKHLDT---LKPT
G8QVG0_SPHPG      --------------------MKEKSIKELGFPLVLKKIEGCALGNDGVKALQGFSFLTEK
F4GIH5_SPHCD      --------------------MHTRTLEDLGFTTVTTSIATHALSSEGKEELSRDRFVRTA
MUTS2_BACSU       --------------------MQQKVLSALEFHKVKEQVIGHAASSLGKEMLLELKPSASI
MUTS2_BACVZ       --------------------MQQKVLSSLEFHKVKEQITAHAASSLGREKLLQLKPLTDL
MUTS2_BACLD       --------------------MQQKALSALEFHKVKEQLTEHAASSLGKEMLLELKPSRSL
MUTS2_BACCZ       --------------------MLERTLRVLEYNKVKEQLLEHTASSLGRDKVKHLVPSTDF
MUTS2_BACAH       --------------------MLERTLRVLEYNKVKEQLLEHTASSLGRDKVKHLVPSTDF
MUTS2_BACAN       --------------------MLERTLRVLEYNKVKEQLLEHTASSLGRDKVKHLVPSTDF
MUTS2_BACHK       --------------------MLERTLRVLEYNKVKEQLLEHTASSLGRDKVKNLVPSTDF
MUTS2_BACC1       --------------------MLERTLRVLEYNKVKEQLLEHTASSLGRDKVKHLVPSTDF
MUTS2_BACCN       --------------------MLERTLRVLEYDKVKEQLLEHTASSLGRDKVKRLMPSTDF
MUTS2_GEOKA       --------------------MQPKVLHTLEFDKVKEQLAEHASSPLGLEKIDALMPSSDL
MUTS2_GEOTN       --------------------MQQKMLRILEFDKVKEQLAEHASSALGLEKIAALVPSSDL
MUTS2_BACHD       ---------------------MERVLRVLEYEKMKKQLLEHVSSSLGRKKVEQLTPSTDF
MUTS2_BACSK       ---------------------MERVQRVLEYNKMKQQLLEHVASSLGRQKVNELVPSTSL
MUTS2_OCEIH       --------------------MNERVLRVLDFKSVTEMLKGQAETALGKERAKITKPLSSL
MUTS2_LISMO       --------------------MEKKVEAILEFDKIKKQLTEFASSSLGEQAILELAPATDF
MUTS2_LISMF       --------------------MEKKVEAILEFDKIKKQLTEFASSSLGEQAILELAPATDF
MUTS2_LISW6       --------------------MEKKVEAILEFDKIKKQLTEFASSSLGEQAILELAPATNF
MUTS2_LISIN       --------------------MEKKVEAILEFDKIKKQLAEFASSSLGEQAIYELAPATDF
MUTS2_ENTFA       --------------------MNQRILSTLGFDKVKQQLLQFIVTAQGTNEVSELLPIADE
MUTS2_STAEQ       --------------------MRQKTLDVLEFEKIKSFVADETISDLGREKVQEMAPASNF
MUTS2_STAES       --------------------MRQKTLDVLEFEKIKSFVADETISDLGREKVQEMAPASNF
MUTS2_STAHJ       --------------------MRQKTLDVLEFDKIKSFVASETISDLGREKVSKMSPATDF
MUTS2_STAAS       --------------------MRQKTLDVLEFEKIKSLVANETISDLGLEKVNQMMPATNF
MUTS2_STAAW       --------------------MRQKTLDVLEFEKIKSLVANETISDLGLEKVNQMMPATNF
MUTS2_STAAM       --------------------MRQKTLDVLEFEKIKSLVANETISDLGLEKVNQMMPATNF
MUTS2_STAAN       --------------------MRQKTLDVLEFEKIKSLVANETISDLGLEKVNQMMPATNF
MUTS2_STAAC       --------------------MRQKTLDVLEFEKIKSLVANETISDLGLEKVNQMMPATNF
MUTS2_STAAR       --------------------MRQKTLDVLEFDKIKSLVANETISDLGLEKVNQMMPATNF
MUTS2_CLOBL       --------------------MKDKSIKVLEFNKIQEILKNYTCTKAAKDIIEDLKPYDSV
MUTS2_CLOAB       --------------------MNEKSLRVLEYFKIKDGIKKYISTSAAKKLIDELEPYGSL
MUTS2_CLOPE       --------------------MNDRVLRVLEFNKIKELVKGYAITKSAKEMVLDLKPYDSV
MUTS2_CLOTE       --------------------MNERALKVLEFYKIKEKLKGFVKTNAAKDIVDNLKPYTNL
MUTS2_CALS4       -----------------MKGMREKTLKSLEFDKIVKLIANECDSELGREKVFDIEIKKDL
MUTS2_SYNY3       ------------MSDSTNLTIAEETLALLEWPRLCQHLSTFTQTPLGAIAARYLLPPSQW
Q31CW4_PROM9      -----MQEKSFSKKSYSENTLEDESISLLEWDSIKTHLSSFASTEMGKRAILSFKIPSEY
E6VWL5_PSEA9      --------------------MESRSFQVLEFPKILGALAGFAVSGAGTSACLKLHPFKEL
Q30ZP5_DESAG      --------------------MQSRSAHVLEFDKVLRHLAGYAVSEAGAQACLLLAPAADC
B8IZR6_DESDA      -------------------MIHARTLQALEYNNVTDYLASLCISGVGRDRALALAPLPQA
MUTS2_HELPY       MSDAPKRSLNPTLMMNNNNTPPKPLEESLDLKEFIALFKTFFAKERDT---------IAL
MUTS2_HELPJ       MSDASKRSLNPTLMMNNNNTLPKPLEESLDLKEFIALFKTFFAKERGS---------IAL
D3UIQ5_HELM1      --------------------MQQSLLKVLDLQDFIDKLTALFARPKD----------FLL
F8KP97_HELBC      ----------------------MSLIAQLDLTRFIEHFSTFLARPKD----------FAP
D1AZR4_SULD5      ---------------------MEKLFSKLDLVDYATSFKHFLAREKP----------LFM
A6Q4G0_NITSB      ----------------------MDLEKKLDLTDFLDQLRDFFARPKP----------LAM
Q7M8Q5_WOLSU      ----------------MNDPHYFELAKKLDLESFLELFASFLSRPKP----------PHM
D5V647_ARCNC      ---------------------MQEIFKKLDLEEYLLKFSKLLAREKP----------IVL
E4U1V6_SULKY      --------------MTRLSSNLAELFGKLDLLPHIASLEQFFSREQN----------IAI
E6X2W5_NITSE      ---------------------MRSLPEKLDLGDYLQSFQSFLARPKP----------VAM
B9LA77_NAUPA      ------------------------MINKLDLVEYINKLTSLFAREKD----------YKI
MUTS2_THET8       ---------------------MRDVLEVLEFPRVRALLAERAKTPLGRELALALAPLPRE
B7J6A5_ACIF2      ------------MAVAGVAPWQDSFWRALDASDVQSAWSQHCGHIYGRRHVAATTPWVPL
MUTS2_BORBU       -----------------MQDEQDKYLKNIDFYEILSLVSKYVSNPDTVNLLSNQKILKTK
Q6MNH7_BDEBA      ----------------------MQDLVVLDWIEILEKIKAHATSDMGREAIMQTEPLKTP
F2LUE2_HIPMA      ---------------------MKDTLEILQYNKLKDLIQKHIQTEYGKEQLKKLKPIFDI
E1X288_HALMS      -------------MALNLLDNNSSFLEYLDWDEILIKLSSHSYFQHTKDVVPRLLNYKPN
                                              :                               

F8E638_FLESM      RKIDEKQKLLGETLTIREI--------LKIALPDDSGYHEFYYRLKDPYASFMVEDIGKF
D3P8K4_DEFDS      NKIIETQQYINEILNFLAA--------ESIKIENDSDYFSFYNKLMDPYESFTSKDLVIF
E4TIY8_CALNY      SKIIEEQNQIREALDLFGD--------FGGELPDSRNYYQFYKKLLDPYSSWLVVDFIVF
D4H7D0_DENA2      EKIEKYKNELSEAIGYVRN--------SDMHIPADYEFIALYPRFDDPLLFLEPEELIVF
MUTS2_AQUAE       EKVKEEIELSKAFFDIAE----------NVRLFEFEDIRELLKKAKLQGAILGVEDILKI
MUTS2_THEMA       VNPWDELELVEELLNYFNR-------WGEPPIKGLNDISQEVEKVKSG-SPLEPWELLRV
MUTS2_THEP1       VNPWDELELVEELLNYFAR-------WGEPPIKGLNDISQEVERVKSG-SALEPWELLRV
G8QVG0_SPHPG      ADLAERQGKVGAFCRLLGS-------PTIELPVSFDDISPVFDILDNPLRSLDGSLMYSV
F4GIH5_SPHCD      DEWEERQLLVGDIMRLRQD-------SLRPAPSGFPDISGILNLLDRPAAVLAGEDIYTV
MUTS2_BACSU       DEIKKQLDEVDEASDIIRL-------RGQAPFGGLVDIRGALRRAEIG-SVLSPSEFTEI
MUTS2_BACVZ       SDIQKQLDEVEEASAVMRL-------RGHAPFGGLTDIRSALRRAEIG-SVLTPAEFTEL
MUTS2_BACLD       EEVKKLQEEVDEAGTVLRL-------KGSAPFGGLTDIRKALRRAEIG-SILSPAELTEI
MUTS2_BACCZ       EEIVEMQDTTDEAAKVIRL-------KGSAPLGGITDIRSNVKRAKIG-SMLSPNELLDI
MUTS2_BACAH       EEIVEMQDTTDEAAKVIRL-------KGSAPLGGITDIRSNVKRAKIG-SMLSPNELLDI
MUTS2_BACAN       EEIVEMQDTTDEAAKVIRL-------KGSAPLGGITDIRSNVKRAKIG-SMLSPNELLDI
MUTS2_BACHK       EEIVEMQDTTDEAAKVIRL-------KGSAPLGGITDIRSNVKRAKIG-SMLSPNELLDI
MUTS2_BACC1       EEIVEMQDTTDEAAKVIRL-------KGSAPLGGITDIRSNVKRAKIG-SMLSPNELLDI
MUTS2_BACCN       EEIVEMQDTTDEAAKVIRL-------KGHAPLGGIFDIRSNVKRAKIG-SMLSPHELLDI
MUTS2_GEOKA       EEVAAWLDETDEAAAVLRL-------AGYVPLDGVVDIRPHLKRAAIG-GTLSPQELLEV
MUTS2_GEOTN       DEVAVWLEETDEAAAVLRL-------RGYVPLDGVVDIRSHLKRAAIG-GVLSPIELLEV
MUTS2_BACHD       NKVKLWQAQTQEGANMLRL-------KGHVPLGGIFDIKPHLKRAKIG-GLLHASELLEV
MUTS2_BACSK       EEVRHLQDETAEAANVLRL-------KGHVPLGGISDVRPHIKRAAIG-GVLSATELIEI
MUTS2_OCEIH       DKINMLQDETDEAAKIIRL-------NQAIPLGGITDIRASVKRSSIG-GILSTDECLDV
MUTS2_LISMO       QVVQKTQLETEEGAKIIRL-------RGSAPITGLTDVFAHLKRLEIG-GDLNGLEIYQI
MUTS2_LISMF       QVVQKTQLETEEGAKIIRL-------RGSAPITGLTDVFAHLKRLEIG-GDLNGLEIYQI
MUTS2_LISW6       QVVQKSQLETEEGAKIIRL-------RGSAPITGLTDVFAHLKRLEIG-GDLNGLEIYQI
MUTS2_LISIN       QVVQKAQLETEEGAKIIRL-------RGSAPITGLTDVFAHLKRLEIG-GDLNGLEIYQI
MUTS2_ENTFA       NKIQSWLNETQDGLKVQRL-------RGGIPIPKLENIQPHMKRIEIG-ADLNGIELAQV
MUTS2_STAEQ       DTVEFQMNETDEISQIYNK-------HRLPSLSGLAKVSPLVHRASIG-GVLNVAELNRI
MUTS2_STAES       DTVEFQMNETDEISQIYNK-------HRLPSLSGLAKVSPLVHRASIG-GVLNVGELNRI
MUTS2_STAHJ       ETVEFQMNETDEISQIYNK-------HRLPSLSGLAKISPLIHRANIG-GVLNVTELNLV
MUTS2_STAAS       ETVVFQMEETDEIAQIYNK-------HRLPSLSGLSKVSAFIHRADIG-GVLNVSELNLI
MUTS2_STAAW       ETVVFQMEETDEIAQIYNK-------HRLPSLSGLSKVSAFIHRADIG-GVLNVSELNLI
MUTS2_STAAM       ETVVFQMEETDEIAQIYNK-------HRLPSLSGLSKVSAFIHRADIG-GVLNVSELNLI
MUTS2_STAAN       ETVVFQMEETDEIAQIYNK-------HRLPSLSGLSKVSAFIHRADIG-GVLNVSELNLI
MUTS2_STAAC       ETVVFQMEETDEIAQIYNK-------HRLPSLSGLSKVSAFIHRADIG-GVLNVSELNLI
MUTS2_STAAR       ETVVFQMEETDEIAQIYNK-------HRLPSLSGLSKVSAFIHRADIG-GVLNVSELNLI
MUTS2_CLOBL       YEVREHLEEAKEAFKLLIT-------KGAPPFEGVYDIRNGIYLAEKG-SALLPGQLLKI
MUTS2_CLOAB       YEVKEHIEETKEAFELLMK-------KGAPPFEGAYDVTEAVSMAEKG-FSLAPGQLLKV
MUTS2_CLOPE       YDVKEHLEETKEALDILMR-------KGNPPFEGLYDVKEAITRAEKG-GVLSIEGLLRI
MUTS2_CLOTE       YEVEMHLEETMEALDLLQT-------KGEPPFEGVYDIRDILIRVEKA-MVLLPGQLLKV
MUTS2_CALS4       KAIEFELDLLNEAVKFIYS-------YGDISF-SFQDIREHVKKAQID-YILYNRELLGI
MUTS2_SYNY3       EESRELLAQTQAVESIENSP------ESNWHFKGIADITEPLARVERG-GLVTGLELLAI
Q31CW4_PROM9      EVAKRLLNETVEITELENNL------EKSISFSGVCDISRNIEICSKG-GVILSSELLEI
E6VWL5_PSEA9      DEIREALVLYGQAAAWVVE-----SSFVMRAFPELGGLFAYLE---GPGNALDQDDLFAL
Q30ZP5_DESAG      DSARMRCAFFRQGQLWAER-----TGFSLAPFPDLSGVFRFLE---SPAAVLDIDALWAV
B8IZR6_DESDA      EDVNLAARVYEEAADWSSRPAAGGSIFILNAFPDVTGFLHAAQTSRGHAFQPDVDAFWAL
MUTS2_HELPY       ENDLKQTFTYLNEVDAIG-----------------LPTPKSVKESDLIIIKLTKLGTLHL
MUTS2_HELPJ       ENDLKQAFTYLNEVDAIG-----------------LPAPKSVKESDLIVVKLTKLGTLHL
D3UIQ5_HELM1      TGDRHLIFHYIEELDGLN-----------------FHAPSAVKNLDSALQILKKFGTLKL
F8KP97_HELBC      SHTPPNIWEHLQELEHLD-----------------CTPPPALICLKDALKAFKKGGVWRL
D1AZR4_SULD5      EGDANLHYKLIHELLMRDR----------------LKPLPEVPNLDVALMHLSKLGVLRL
A6Q4G0_NITSB      EGDVHIHYEFLMQLWSCT-----------------FKEPPKVQCLDEALMRLKKQGVLTL
Q7M8Q5_WOLSU      EGDIHRHRQFIEALDKIQ-----------------FNPPPPIAPLERDIIHLKKFGFLRR
D5V647_ARCNC      EGDINLHYKLINELSKYE-----------------LKEPEKVENLDEKLIHIQKQGILRV
E4U1V6_SULKY      PGDQERHFRYIQALDALE-----------------FKAPPKSVGFESIINHLKKQGVLRF
E6X2W5_NITSE      EGDVHLHHRFIKALSSVE-----------------IPEPPQMPSMEDRLMRLSKQAVLGL
B9LA77_NAUPA      QGSIESLYKYLQKLQNRD-----------------FNAPPSVKNLDTEIMHLKKFGVLKH
MUTS2_THET8       EAEKRHELTGEALSYPYAL--------------PEAGTLREAYGRALAGARLSGPELLKA
B7J6A5_ACIF2      AEIHDRLNWLAWLSQRFSA-------GFLLPVSDLPDIDALLVLAQRPGAVLSGRDLRAV
MUTS2_BORBU       ESLEKIFSFVSLIRMLFES-------CKGYPNSFINSLKYPISLLLKENSRVSIENLRDI
Q6MNH7_BDEBA      QEAHASFQEINNATEVLNQ--------GVRPFMTSLDLYSTWILRLKKNAVLKTLEMKDV
F2LUE2_HIPMA      ELAKSNFQMLNEFFEHFTK----------WGALVLDDVFIKSIIEDSFNGMLDEKELKSI
E1X288_HALMS      QIINRDLTYLDLYNDDFES--------FNTSLGDIFSTLPRTDELEKHLASIEKDLVLDL
                                                                              

F8E638_FLESM      RDFHKDVSELKKTLIESD-------NVVSLRDILKNMFSLSGLIETIDKKVTYDC-KVKD
D3P8K4_DEFDS      KNFHTYLRDIKKILTESK-------QINKLKNILKEIYTFSNLTQEINEKIGNDG-TVKS
E4TIY8_CALNY      AEFHKKLGEFKKSVFGDF-------DVNHLKTLFSNIYVLPDIVDDIFSKITNDG-HVKD
D4H7D0_DENA2      SHFFKNVKEIKKSLIDA--------GVSALKVYLSDIYTLSEITDDIDDTVNDKG-EIKD
MUTS2_AQUAE       LNVINLTKEIRRVLSSHVQ------RLEPLRKVYKKLYTFSPLENLIIGSIDPRG-FVKD
MUTS2_THEMA       SVFLEGCDILKKEFE--------KREYSRLKETFSRLSSFREFVEEVNRCIEQDG-EISD
MUTS2_THEP1       SVFLEGCDILKKDFE--------KREYSRLKETFSRLSSFRDFVEEVNRCIEQDG-EISD
G8QVG0_SPHPG      ANYIESAKVLHTFCTSTLENN--EQLPPIKDLLGDQIDPLLISLSMEIQAVLENS-GQVK
F4GIH5_SPHCD      GGYIAAAREFKAFCEEQDEG---KAVNPAAGLF-TAFPVTLAPVEKEIFSIMESP-GTVK
MUTS2_BACSU       SGLLYAVKQMKHFITQMAEDG---VDIPLIHQHAEQLITLSDLERDINSCIDDHG-EVLD
MUTS2_BACVZ       SGLLYAVKQMKHFISQMTEDG---VGIPLIQAHAEELITLGDLEREINSCIDDHG-EVLD
MUTS2_BACLD       SGLLYAAKQMKHFLEGLFEDG---VEIPYLHQYAEKLIPLSELERDINSCIDDHG-EVLD
MUTS2_BACCZ       ANTMYGSRNMKRFIEDMVDNG---VELPILETHVAQIVSLYDLEKKITNCIGDGG-EVVD
MUTS2_BACAH       ANTMYGSRNMKRFIEDMVDNG---VELPILETHVAQIVSLYDLEKKITNCIGDGG-EVVD
MUTS2_BACAN       ANTMYGSRNMKRFIEDMVDNG---VELPILETHVAQIVSLYDLEKKITNCIGDGG-EVVD
MUTS2_BACHK       ANTMYGSRNMKRFIEDMVDNG---VELPILETHVAQIVSLYDLEKKITNCIGDGG-EVVD
MUTS2_BACC1       ANTMYGSRNMKRFIEDMVDNG---VDLPILETHVAQIVSLYDLEKKITNCIGDGG-EVVD
MUTS2_BACCN       ASTMYGSRQMKRFIEDIVDNG---AQLPILETHVAQIVSLYDLEKKITGCIGDGG-EVLD
MUTS2_GEOKA       AATSAASRQMKRLIAGLYDEH---GGLERLFRYADTLAEAPELEHDVRRSIDDHG-EVLD
MUTS2_GEOTN       AATAAASRQMKQLIMSLHDEH---GGLARLADYADELAEVPALEEDIRRSIDDHG-EVLD
MUTS2_BACHD       ASTIYGGRQLKKFIETMIEEEE--ADLPLLGEFARQIVPLTDLERAIKQCIDDNG-HVLD
MUTS2_BACSK       ASTLYGGKRVKQFIETIIEDGH--IEVPILAGHVEQIEPLSPIEKAIKQCIDDNG-YVLD
MUTS2_OCEIH       ANTLYGSRNVKNTIENMEELD-----IPILKELVEHITPIRELEQAIKSCIDDHG-HIMD
MUTS2_LISMO       GSNLRVSRQMKNFMNDLLEIG---VELPILGALSDELLVLKEVEEDIAISVDESG-KVLD
MUTS2_LISMF       GSNLRVSRQMKNFMNDLLEIG---VELPLLGALSDELLVLKEVEEDIAISVDESG-KVLD
MUTS2_LISW6       GSNLRVSRQMKNFMTDLLEMG---VELPLLGALSDELLVLKEVEEDIAISVDESG-KILD
MUTS2_LISIN       GSNLRVSRQMKNFMNDLLEIG---VEIPLLGALSDELLVLKDVEEDIAISIDESG-KILD
MUTS2_ENTFA       GRVLSTTSELTRFFDELSENE---VDFERLYMWREQLEVLPELNRQLKQAIDDDG-YVTD
MUTS2_STAEQ       KRLVQVQNQFKTFYNQMLEEDE-EVKYPILHDKMNHLPILTDLFKEINETCDAH--DLFD
MUTS2_STAES       KRLVQVQNQFKTFYNQMLEEDE-EVKYPILHDKMNHLPILTDLFKEINEKCDAH--DLFD
MUTS2_STAHJ       KRLIQVQNQFKTFYNQLLEEDEQVVKYPILNDKMNQLPILSDLFQEINEKCDTH--DLYD
MUTS2_STAAS       KRLIQVQNQFKTFYNQLVEEDE-GVKYPILDDKMNQLPVLTDLFHQINETCDTY--DLYD
MUTS2_STAAW       KRLIQVQNQFKTFYNQLVEEDE-GVKYPILDDKMNQLPVLTDLFHQINETCDTY--DLYD
MUTS2_STAAM       KRLIQVQNQFKTFYNQLVEEDE-GVKYPILDDKMNQLPVLTDLFHQINETCDTY--DLYD
MUTS2_STAAN       KRLIQVQNQFKTFYNQLVEEDE-GVKYPILDDKMNQLPVLTDLFHQINETCDTY--DLYD
MUTS2_STAAC       KRLIQVQNQFKTFYNQLVEEDE-GVKYPILDDKMNQLPVLTDLFQQINETCDTY--DLYD
MUTS2_STAAR       KRLIQVQNQFKTFYNQLVEEDE-GVKYPILDDKMNQLPVLTDLFQQINETCDTY--DLYD
MUTS2_CLOBL       AAVLRCARRFKEYINHKEEEES----YRVLENICEGIFSLPKIEEEIFNAIEGED-EIAD
MUTS2_CLOAB       GSMLRCARKFKEYISHKEEEES----YRIIEDICSGIIPLKNIEDNIFNAIIGEE-EISD
MUTS2_CLOPE       GNMLAVTRKLSDFLARKEEEEE----HRILEGMREGLIVLRGVESAISKAIVSED-EIAD
MUTS2_CLOTE       ASILKSSRRFKDYVGRKHEETP----HKNIEDICEGIELLKGLEESIFNIVISDD-EIAD
MUTS2_CALS4       KNFLSLVEEVKAHFKSLYDRED----FLLLKEFDKRLVPLKSLKEKIENTVISED-EISD
MUTS2_SYNY3       AGTLAGVRRLRRVIEERDDLE-------ILQTLVAEVRTLPELEQAIHHCLGEDG-KVAE
Q31CW4_PROM9      AITISAARNLKKILLDFEKRP-------FISSFTKNLIDHHNIETILKNGIESNG-RISD
E6VWL5_PSEA9      KQVLDVAGEARQSLEK-FQDRG----WDILGRTLFAYAWPSRTVSGIGRCLDPEG-SIRD
Q30ZP5_DESAG      RQVLAQSRELAVAIGSGNTAEN----WPLLAQMLERYRMPEKALSGLMRCLGEDG-LLRD
B8IZR6_DESDA      REVLRLARDAHAAIAVPEAPRQ----WPHLLALADGTPLPVQLTAALLRCLSDDG-LLKD
MUTS2_HELPY       DEIFEIVKRLHYIVVLQNAFKT---FTHLKFHERLNAIVLPPFFNDLIALFDDEG-KIKQ
MUTS2_HELPJ       DEIYEIVKRLRYIVVLQNAFKP---FTHLKFHERLNAIILPPFFNDLILLLDDEG-QIKQ
D3UIQ5_HELM1      YEIFEFVKILRYFLYLKNQKEM---QNTLHFSKYLQKIQIPAPILEICSYFHAHL-QIKE
F8KP97_HELBC      DTLFAFVQITRYFAYLKALASP---KQHPHLYAYLDNIHFPPALLELSTHMQDTP-TLKS
D1AZR4_SULD5      SEIFAFVQIIRYFSYLKSI------LREQSLGEWMERIVIPLDVRSICDYFDEKG-ELRA
A6Q4G0_NITSB      SEIFEFVKIVRYFTYLKSL------AFEGNMGEWLQSIEIPEEITQIDGYFDEKG-NIKS
Q7M8Q5_WOLSU      DEIFEWVKLWRYMLYLKNL------RIEGILFDWFAQIRFPETILEIEHRFDKEG-NLKE
D5V647_ARCNC      EDVYEFIKIIKYFLYLKRF------TFEGKLAEWIDKVSVPSDIEKVVDFFDTKG-NFKE
E4U1V6_SULKY      EEIHELLKVVRYFRLMRNH------NFAGLIGEWMETIIIPEPFGEIDEYFDHEG-NFIE
E6X2W5_NITSE      DEIFDFIRMVRYFNRLRAL------GLPEPAGSWIAEIEIPEAVVEIGTFFTDEG-ELNP
B9LA77_NAUPA      DQIFEFLKIIRYFIYLKTR------NWQD-LSEWFDKIEIPQDILEIDKHYDKKG-EVIG
MUTS2_THET8       AKALEEAMALKEELLPLKN---------ALSQVAEGIGDHTPFLERVRKALDEEG-AVKD
B7J6A5_ACIF2      LDVLTAQKGYAAALRETRD---------ALTGLAGELDPPVTLLRRLGVALDEEG-ELLD
MUTS2_BORBU       IVFLDEVLRINLFLHKNSDIKH--LNVQILSDLLFLNPELKNLLNELKEHIDVDALELKS
Q6MNH7_BDEBA      RSFCLEALALKEALHPVQNDWA--------QRIHQSLMKAEEPVSAIDQILTPSG-DIRS
F2LUE2_HIPMA      GNFISLLLYIKEEIEQNN---------PELYEEYINFDIPLSLLDEINKTIDDYG-FLKD
E1X288_HALMS      SELNTICKLLEGYPSVERLFEH-FNIDHNYPDQSIKSKIRNKFINKFRNLVSKDG-SESL
                                                                              

F8E638_FLESM      SATPELKKIRSSLKTTRQRLIDSLNKLMFGRNSDKFVQEQVIKEIKGRFVIPVKSNFRQY
D3P8K4_DEFDS      NATAELAKIRKDIQSVSKQLDTILKKILYGKNSDKFIQERTIVIRNDRFVIPCKPNFRQF
E4TIY8_CALNY      DASDRLREIRKEKKNVKEKIYETLNSLINGKDSEKFVQERVIKEYSNRLMLLLRPNFRQF
D4H7D0_DENA2      SASVKLLNVRTELKTVRKQIQKELSGVFAHSSSTKFIQENVITERSGRFTIPCKTNFKQY
MUTS2_AQUAE       EASEELLRVRKSIRAVEEEIKKRLDNLINRPDSAKFLSDRIVTIRNGRYVIPVKTSHVKK
MUTS2_THEMA       RASPRLREIRTEKKRLSSEIKRKADDFVRTHS--QILQEQMYVYRDGRYLFPVKASMKNA
MUTS2_THEP1       RASPRLREIRTEKKRLSSEIKRKADDFVRTHS--QILQEQMYVYRDGRYLFPVKASMRNA
G8QVG0_SPHPG      ESHPAIRALKQKVEGAKQDRSRFSHEFITTNN--ALVQSDQGAFRDGRLVIPVRNDRRTE
F4GIH5_SPHCD      KSHPELAKLLRDVERIRGERQAYSREFLLKNS--QSVRNDQPVLRDGRLVIPMRSDQSST
MUTS2_BACSU       HASETLRGIRTQLRTLESRVRDRLESMLRSSSASKMLSDTIVTIRNDRFVIPVKQEYRSS
MUTS2_BACVZ       HASPALRGIRTQLRTLESRVRDRLESMLRSSSASKMLSDTIVTIRNDRFVIPVKQEYRSS
MUTS2_BACLD       HASETLRGIRTQLRTLESRIRDRLESMLRSSSAQKMLSDTIITIRNDRFVIPVKQEYRSS
MUTS2_BACCZ       SASDKLRGIRTQIRTAESRIREKLENMTRSSNAQKMLSDSIVTIRNERYVIPVKQEYRGV
MUTS2_BACAH       SASDKLRGIRTQIRTAESRIREKLENMTRSSNAQKMLSDSIVTIRNERYVIPVKQEYRGV
MUTS2_BACAN       SASDKLRGIRTQIRTAESRIREKLENMTRSSNAQKMLSDSIVTIRNERYVIPVKQEYRGV
MUTS2_BACHK       SASDKLRGIRTQIRTAESRIREKLENMTRSSNSQKMLSDSIVTIRNERYVIPVKQEYRGV
MUTS2_BACC1       SASDKLRGIRTQIRTAESRIREKLENMTRSSNAQKMLSDSIVTIRNERYVIPVKQEYRGV
MUTS2_BACCN       SASDKLRGIRNQIRTAESRIREKLENMTRSSNAQKMLSDAIVTIRNDRYVIPVKQEYRGV
MUTS2_GEOKA       AASDRLRSLRGQIRSVEARIREKLESIIRSPSAQKRLSDAIITIRNDRYVIPVKQEYRGA
MUTS2_GEOTN       TASDRLRSLRGQIRAAEARIREKLESIIRSPSAQKRLSDAIITIRNDRYVIPVKQEYRSA
MUTS2_BACHD       SASPTLRTLRHQIRSFEANVRSKLEGITRSSNTAKMLSDAIVTIRNDRYVIPVKQEYRGA
MUTS2_BACSK       SASTSLRTVRHQIRSYESGIKSKLDQLTRSSNTRKMLSDAIVTIRSDRYVLPVKQEYRGT
MUTS2_OCEIH       GASSQLRSIRSSIRTLESRIREKLENYTRSNS--KMLSDAIITIRNDRYVLPVKQEYRGA
MUTS2_LISMO       TASEALSTIRRTLRRTEDRVREKLESYLRDRNASKMLSDAVITIRNDRYVIPVKQEYKGH
MUTS2_LISMF       TASEALSTIRRTLRRTEDRVREKLESYLRDRNASKMLSDAVITIRNDRYVIPVKQEYKGH
MUTS2_LISW6       TASEALSTIRRTLRRTEDRVREKLESYLRDRNASKMLSDAVITIRNDRYVIPVKQEYKGH
MUTS2_LISIN       TASEALSSIRRTLRRTEDRVREKLESYLRDRNASKMLSDAVITIRNDRYVIPVKQEYKGH
MUTS2_ENTFA       EASPALKAIRQNIRRSEQTIREELDSIIRGKN-ARYLSDALVTMRNERYVIPVKQEYKNI
MUTS2_STAEQ       HASYTLQSIRSKISRTNQRIRQNLDRIVKNQGNQKKLSDAIVTVRNDRNVIPVKAEYRQD
MUTS2_STAES       HASYTLQSIRSKISRTNQRIRQNLDRIVKNQGNQKKLSDAIVTVRNDRNVIPVKAEYRQD
MUTS2_STAHJ       SASYELQGIRSKISSTNQRIRQNLDRIVKSQANQKKLSDAIITVRNDRNVIPVKAEYRQD
MUTS2_STAAS       NASYELQGIRSKISSTNQRIRQNLDRIVKSQANQKKLSDAIVTVRNERNVIPVKAEYRQD
MUTS2_STAAW       NASYELQGIRSKISSTNQRIRQNLDRIVKSQANQKKLSDAIVTVRNERNVIPVKAEYRQD
MUTS2_STAAM       NASYELQGIRSKISSTNQRIRQNLDRIVKSQANQKKLSDAIVTVRNERNVIPVKAEYRQD
MUTS2_STAAN       NASYELQGIRSKISSTNQRIRQNLDRIVKSQANQKKLSDAIVTVRNERNVIPVKAEYRQD
MUTS2_STAAC       NASYELQGIRSKISSTNQRIRQNLDRIVKSQANQKKLSDAIVTVRNERNVIPVKAEYRQD
MUTS2_STAAR       NASYELQGIRSKISSTNQRIRQNLDRIVKSQANQKKLSDAIVTVRNERNVIPVKAEYRQD
MUTS2_CLOBL       RASSTLYNIRRSLKEKNYSVRDKINSLVRSYS--SYLQENIYTVRGDRYVLPVKAEHKGA
MUTS2_CLOAB       KASTALYSIRRSLKDKNASIKDKVNAMMRSYS--KYLQENLYTIRGERYVIPVKAEYKAQ
MUTS2_CLOPE       SASDKLYSIRRSLKEKNSSIRDKVNSIVRSNT--QYLQDSLYTVRGDRYVIPVKAEYKSQ
MUTS2_CLOTE       RASLKLYGIRRSLRDKNDSLRDRVNSLVRKYS--PYLQESIYTIRGDRYVLPVRAEHKGS
MUTS2_CALS4       EASPVLKAIRRQKASINEKIKSTLNSIISTRQ--KELQEPIITMRQGRYVVPVKQEYRNV
MUTS2_SYNY3       RASPKLGEIRQKLKAVREQIQQKLQKIIQRQS--NALQEAVITQRGDRFVLPIKAGYKEQ
Q31CW4_PROM9      DASSKLSILRKELLSKKLERKILVDKFIQKNL--AYLQDTIIGDRYGRPVLAVKVNYIDK
E6VWL5_PSEA9      ASSPELLAVRQEIRAIHQRCTKRVKDFILAENLGQALQDEFMTISSDRYVLPFKANYKNK
Q30ZP5_DESAG      ESSPELLLVREEIRRIHRLCTRKVKELANTYNLSHYMQDEFLTLSSDRYVLPLKANFKGR
B8IZR6_DESDA      ESSPELYRLRGELRRLHQGCMRKVKDYALQYNMLAYLQDEFMTLSSDRYVLPLKANFKGR
MUTS2_HELPY       GANATLDALNESLNRLKKESVKIIHHYARSKELAPYLVDTQSHLKHGYECLLLKSGFSGA
MUTS2_HELPJ       GANATLDALNESLNRLKKESTKIIHHYAHSKELAPYLVDTQSHLKHGYECLLLKSGFSSA
D3UIQ5_HELM1      GIFEELDSLEQSLKRQKKNMQQSLELLLQSAKIRPYLADTQIHFINQTQTLLLKPGFQHV
F8KP97_HELBC      GFYPDLDALSESLARLQAQQKKLLNQILNKSGLQSYLVDRQVHFVNGIESLLVKPGFSVA
D1AZR4_SULD5      SVDEQFAHIAKSLKMIKEEMNSTLRRLISTEKIALYLADKQIHYINNQEALLVRGGFNHV
A6Q4G0_NITSB      EIDERLVVLENALSHTKTQIRQKLQALINAKKLQSYLVDRQIHFVGGEEALLVRGGFNHV
Q7M8Q5_WOLSU      GIYPELDSVNVSLKRTKQEIKEALLRLLSNASLLPYLIDRQIHLINGEESLLVRGGFNHA
D5V647_ARCNC      GIDKDLDMIKDALYRNKESIKQALHKSINNSKLRPYLIDSQVHYVNSEETLLVRGGFNNI
E4U1V6_SULKY      SRDEELHKIAQRIKAIKTEINDSIKRLFHTQKLTPYLVDTQIHYINDEETLLVRGGFNHV
E6X2W5_NITSE      EKEPELADIGEALRRNREAIRETLYSLARSERLRDYLVDQQIHLQNGEETLLVRGGFSSV
B9LA77_NAUPA      --FEELDMINERIKELKAQIRQQLYKYINSKKLEPFLVDKQIHVQGGEETLLVRGGYNKV
MUTS2_THET8       EASPRLAQIRRELRPLRQQILDRLYALMDRHR--EAFQDRFVTLRRERYCVPVRAGMAQK
B7J6A5_ACIF2      TASADLALLRQRLRISRNELQRFLQGFLRNRDWQEYWQDQVIVQRNERYVLPLKASHKGR
MUTS2_BORBU       GVVKEYDSIEFEIKNLNRRVENQIKKIISLNA--EYLTSNFVCYKSNKYTLALKSNFKGK
Q6MNH7_BDEBA      DASETLFRLFREKERLAREVQSTLDRLVKDHQMENVLQDKYVTTRDGRWVLPVRSGMQHH
F2LUE2_HIPMA      SATAHLFEIRQQKQQISQNITRILKNLM-HGRLRDILLDTAIFLKRSRYTLLLKPNYKEY
E1X288_HALMS      ENHPQLSPLYRELRELEKGLRNSINISARKETYKKVLQHSEYDVINDRYVLAIRSDSYNS
                          :                                         .  :      

F8E638_FLESM      FSGVVYSSSNTGQTLYVEPTAVIDLNNDFENLKSRESDEVYKILRMLLDAIKSHIYEVTT
D3P8K4_DEFDS      LNGIIHDLSKTAQTVFVEPSETVELNNKYQSLKIAEDEEIRKIINESITKIKSHRLELSN
E4TIY8_CALNY      INGIVHSISGTGMTLYVEPSNVVEMNNRYQELISLEEIEVNRILQKLLDCIKSKSYEITE
D4H7D0_DENA2      IQGIVHDRSASGQTLFVEPSNTVGMNNTQQELLAAEREESVRILKELSVRIFESLYEINT
MUTS2_AQUAE       IFGIVHGTSSSGYTTYVEPQFVIHLNNKLTELKQKEEEEVRKVLQRITEYIGDYAKELLE
MUTS2_THEMA       VRGIVHHLSSSGATVFLEPDEFVELNNRVRLLEEEERLEISRILRQLTNILLSRLNDLER
MUTS2_THEP1       VRGIVHHLSSSGATVFLEPDEFVELNNRVRLLEEEERLEISRILRQLTNILLSRLNDLER
G8QVG0_SPHPG      VKGFINSASTSGNTVFMEPYRLVEMNNAVVMAENQILVEIAKILSELNGKIKCRAYELRK
F4GIH5_SPHCD      VTGFVHGSSASGATTFMEPFPLVGLNNNVVLAEQKVQMCIARILSALSATVKAVLDDVKV
MUTS2_BACSU       YGGIVHDTSSSGATLFIEPQAIVDMNNSLQQAKVKEKQEIERILRVLTEKTAEYTEELFL
MUTS2_BACVZ       YGGIVHDTSSSGATLFIEPQAIVDMNNSLQQAKVKEKQEIERILRMLTEHTAEHTQEIAQ
MUTS2_BACLD       YGGIVHDQSSSGATLFIEPQAIVDMNNALRQAKVNEKQEIERILRVLTEKTAEHTNELFH
MUTS2_BACCZ       YGGIVHDQSASGQTLFIEPQVIVELNNALQEARVKEKQEIERILLMLTEEVAVEADIVLS
MUTS2_BACAH       YGGIVHDQSASGQTLFIEPQVIVELNNALQEARVKEKQEIERILLMLTEEVAVEADIVLS
MUTS2_BACAN       YGGIVHDQSASGQTLFIEPQVIVELNNALQEARVKEKQEIERILLMLTEEVAVEADIVLS
MUTS2_BACHK       YGGIVHDQSASGQTLFIEPQVIVELNNALQEARVKEKQEIERILLMLTEEVAVEADIVLS
MUTS2_BACC1       YGGIVHDQSASGQTLFIEPQVIVELNNALQEARVKEKQEIERILLMLTEEVAVEADIVLS
MUTS2_BACCN       YGGIVHDQSASGQTLFIEPQVIVELNNALQEARVKEKQEVERILMMLTEEVAAEADIVLA
MUTS2_GEOKA       YGGIVHDQSASGATLFIEPQAVVELNNALREARAKEKQEIERILRELSAKVAEQAEPLAR
MUTS2_GEOTN       YGGIVHDQSASGATLFIEPQVVVELNNALREARAKEKQEIERILRELSAKVAEHDEPLKR
MUTS2_BACHD       FGGIVHDQSASGATLFVEPQAVVEINNQLREAKAKEQREIERILSELSMQVSEHVDDLFV
MUTS2_BACSK       FGGIVHDQSSSGATLFIEPAAIVTLNNQLTEAKAKEKREIERILRELSAKVAEESEQLLL
MUTS2_OCEIH       IGGIVHDQSASGQTLFMEPKAVVDINNSLHESKSKEQLEIERILKDLSNQVASYEQDLLE
MUTS2_LISMO       YGGIVHDQSASGQTLFIEPQSVVDLNNERKALQAKEKQEIERILAEISASLAAWINEIHH
MUTS2_LISMF       YGGIVHDQSASGQTLFIEPQSVVDLNNERKALQAKEKQEIERILAEISASLAAWINEIHH
MUTS2_LISW6       YGGIVHDQSASGQTLFIEPQSVVDLNNERKALQAKEKQEIERILAEISASLAGWINEIHH
MUTS2_LISIN       YGGIVHDQSASGQTLFIEPQSVVDLNNERKALQAKEKQEIERILAEISASLAGWINEIHH
MUTS2_ENTFA       FGGVVHDQSASGQTLFIEPKQILEMNNRLRQQQIAERNEITRILAELSAELVPYRREITH
MUTS2_STAEQ       FNGIVHDQSASGQTLYIEPNSVVEMNNQISRLRNDEAVERERILTELTGFVSAEADALLI
MUTS2_STAES       FNGIVHDQSASGQTLYIEPNSVVEMNNQISRLRNDEAVERERILTELTGLVSAESDALLV
MUTS2_STAHJ       FKGIVHDQSASGQTLYIEPSSIVEMNNQISRLRNDEAVERERILTELTGMVAAEADGCLI
MUTS2_STAAS       FNGIVHDQSASGQTLYIEPSSVVEMNNQISRLRHDEAIEKERILTQLTGYVAADKDALLV
MUTS2_STAAW       FNGIVHDQSASGQTLYIEPSSVVEMNNQISRLRHDEAIEKERILTQLTGYVAADKDALLV
MUTS2_STAAM       FNGIVHDQSASGQTLYIEPSSVVEMNNQISRLRHDEAIEKERVLTQLTGYVAADKDALLV
MUTS2_STAAN       FNGIVHDQSASGQTLYIEPSSVVEMNNQISRLRHDEAIEKERVLTQLTGYVAADKDALLV
MUTS2_STAAC       FNGIVHDQSASGQTLYIEPSSVVEMNNQISRLRHDEAIEKERILTQLTGYVAADKDALLV
MUTS2_STAAR       FNGIVHDQSASGQTLYIEPSSVVEMNNQISRLRHDEAIEKERILTQLTGYVAADKDALLV
MUTS2_CLOBL       VPGLVHDQSSTGATLFIEPMSLVNLNNEIKELMLKEKAEIERILTVLSAKINANITGVKT
MUTS2_CLOAB       VPGLVHDQSSTGATLFIEPMGLVNLNNEIKELMLKEKAEIERILRELSALIYKSIVAVKN
MUTS2_CLOPE       VPGLVHDQSSTGATLFIEPTALVNLNNEIKELMLKERAEIERILAELSVLVYKNIDVIKV
MUTS2_CLOTE       VPGLVHDQSSSGATLFIEPMSLVNLNNEIKELLLKEREEIERILEELSLKVYNNLDVVNV
MUTS2_CALS4       FKGIIHDQSSTGATLFIEPIQVVDLNNELRELELKEQKEIERILFELSQEVKKNAEAIFK
MUTS2_SYNY3       MPGIVHDSSASGNTLYVEPQAIVELGNKLRQARRQEQTEEERILRQLSDQVLEVLLDLEH
Q31CW4_PROM9      FKGIIHDSSSSGNTVYFEPDSVVTKGNKIASLEARIAAEEFKLLQKWSQVISDNSENLIA
E6VWL5_PSEA9      TKGIIHDYSQTGETCYFEPMFLVETNNRLQELKREEREEEYKILKYLTELVRQEQEGVLG
Q30ZP5_DESAG      LQGIIHEYSQTGETCYFEPMFLVEINNDLQNLKRQERAEERKIFEYLTGLLRAEMEGVNA
B8IZR6_DESDA      MQGIIHDWSQTGETCYFEPMFLVEINNRLQELKREEREEERKVLLYLRTLLEAELPGAQA
MUTS2_HELPY       IKGVVLERSANG-YFYLLPESAQKIAQKIAQIGNEIDCCIVEMCQTLSHSLQKHLLFLKF
MUTS2_HELPJ       IKGVVLERSANG-YFYLLPESAQKIAQKIAQIGNEIDCCIVEMCQTLSRSLQKHLLFLKF
D3UIQ5_HELM1      LKGVVLQRSQNG-YFYLLPDEIKAIYQKIQEIENLIEQTLYEICKKICITFNKHLSFLQF
F8KP97_HELBC      IKGQVILRSHMG-YFYIEPLEARDLSRKIQEVQTKIEENLARICTHWSGLLRPHFLFLRF
D1AZR4_SULD5      LKGNVIGRSSSG-FFYVVPEALSKLVSRESELLDKKEELVYMYAKQISSLFSKQLKFLSF
A6Q4G0_NITSB      LKATVIGRSSGG-FFYVLPQDIKELKSKEADLLSQVEEIHYEIQKSISTKFHKYLKFLHF
Q7M8Q5_WOLSU      IKAQVIGRSAAG-FFYVLPESVSRLKEREGALLSQITEMEFLICKELSAMMGKQLPFLGY
D5V647_ARCNC      IKATVVHRSSSG-FFYILPHSISELKQKESDLKNKQEEVLLKVCKSISSTFEKNLLFLRF
E4U1V6_SULKY      LKGSVVGRTGAG-FFYVAPDAVLRSKEQLRYVMQERETKLYEYAKRFSAKLSNLVPFIGF
E6X2W5_NITSE      LKATVVGRSSGG-FFYVIPERVRHLKERELELLSRREAIHWRYAREFSERLRGWERFLRY
B9LA77_NAUPA      INAEILGRSQSG-FFYIFPKTIEKLKEKEDNLKSQKEEILYEIAKEFSNRLRKWTKFLEF
MUTS2_THET8       VPGILLDESESGATLFIEPFSVVKLNNRLQALRLKEEEEVNRILRDLSERLAKD-EGVPK
B7J6A5_ACIF2      IKAIVHDRSASGETLFVEPLAAVDLNNQLVQDRRAEIQEQERILRALSAAVGLEVPGIVA
MUTS2_BORBU       IKGNIISISSSGETFYIEPNDIVNANNRLNYLSLEKERIILKILRNLSAKVHSNIVLLDN
Q6MNH7_BDEBA      LPGVIHGSSQTKQTVFIEPEKVIPSNNRLRQIEVEIEDEIERLLTELSRYLSSKSLDIES
F2LUE2_HIPMA      ISGRIIDIGKSG-GFFVEPDAVFKENSHLEDITAQEEAERRRILTNLTHQVRENANRLRH
E1X288_HALMS      KLGVIIAKSSTGMTLFVEPYELREKSNQRIQIMAQIDAIINEICRNFCTTLLEFERAPLN
                    . :          :. *                                         

F8E638_FLESM      TVNAYTDFAYYFEMAKFYKNKMYTFPEFGE-----DVIFDSVHHPLIYLLKG--------
D3P8K4_DEFDS      TISNYEKLIFFLEYALFVKDFDITFPEIND-----NIKFKKIHHPIIFLHKK--------
E4TIY8_CALNY      TVNSMKKLYYFHAIFSYVGERDYVFPNFSN-----KIYVEKLHHPLIYDLKK--------
D4H7D0_DENA2      TIEAYTELAFHLETAKFYKGKPYVFPEFTD-----SIEFRNIHHPVIYLEKG--------
MUTS2_AQUAE       SFEACVEVDFQQCKYRFSKLVEGSFPDFGE-----WVELYEARHPVLVLVK---------
MUTS2_THEMA       NVELIARFDSLYARVKFAREFNGTVVKPSS-----RIRLVNARHPLIPKER---------
MUTS2_THEP1       NVELIARFDSLYARVKFAREFNGTVVKPSS-----RIRLVNARHPLIPKER---------
G8QVG0_SPHPG      LQKQVSFADALYAIARYAVLTQASATDLSS----NKCNLLGARHPLL-GSK---------
F4GIH5_SPHCD      LQCIIGEADALYACASWAGRNRCVVVHRSDD---IPCRLVGARHPLL-GSK---------
MUTS2_BACSU       DLQVLQTLDFIFAKARYAKAVKATKPIMND---TGFIRLKKARHPLLPPDQ---------
MUTS2_BACVZ       DVEVLQTLDFIFAKARYAKAMKATKPLMNG---DGFIRLKKARHPLLPQDQ---------
MUTS2_BACLD       DVKVLQTLDFIFAKAKYAKATKAVKPAVNA---DGYVRLIQARHPLLPLDE---------
MUTS2_BACCZ       NVEVVANLDFIFAKAFYAKRIKATKPIVNN---ERYMDLRQARHPLIDPEV---------
MUTS2_BACAH       NVEVVANLDFIFAKAFYAKRIKATKPIVNN---ERYMDLRQARHPLIDPEI---------
MUTS2_BACAN       NVEVVANLDFIFAKAFYAKRIKATKPIVNN---ERYMDLRQARHPLIDPEV---------
MUTS2_BACHK       NVEVVANLDFIFAKAFYAKRIKATKPIVNN---ERYMDLRQARHPLIDPEV---------
MUTS2_BACC1       NVEVVANLDFIFAKAFYAKRIKATKPIVNN---ERYMDLRQARHPLIDPEV---------
MUTS2_BACCN       NVEVIANLDFIFAKALYAKRMKATKPIVNN---ERYMELRQARHPLIDPKV---------
MUTS2_GEOKA       TVEALAALDFAFAKAKYARRLQAAKPAVNS---RGYLRFLQARHPLLDQEK---------
MUTS2_GEOTN       AVEALAHFDFLFAKAKYARRLQAAKPAVNN---RGYLRFLQARHPLIDQDK---------
MUTS2_BACHD       NVDVLAELDFIMARAHYGKAIRATQPILNN---RGYLLIKQGRHPLIPDDE---------
MUTS2_BACSK       NVDKLAQLDFICAKAYYAKAVKAVKPTLND---RGYLDLRQARHPLLPPDK---------
MUTS2_OCEIH       NVKVLTNIDFIYARGKLAQAMKASRPKMND---EGYMKMQQARHPMIPIDE---------
MUTS2_LISMO       NTFILGRFDFIFAKARFGKAMKAVTPHLSD---AGVVHLIAARHPLLDAAK---------
MUTS2_LISMF       NTFILGRFDFIFAKARFGKAMKAVTPHLSD---AGVVHLIAARHPLLDAAK---------
MUTS2_LISW6       NTFILGRYDFIFAKARFGKAMKAVTPHLSD---AGIVHLIAARHPLLDAAN---------
MUTS2_LISIN       NTFILGRFDFILAKARFGKALKAVTPHLSD---TGIVHLIAARHPLLDAEK---------
MUTS2_ENTFA       NAYVIGKLDFINAKARLGKELKAVVPEISQ---ANHVVFKQARHPLLNPEK---------
MUTS2_STAEQ       AESVMGQIDFLIAKARYARTIKGTKPTFKE---DRTIYLPNAFHPLLDKDT---------
MUTS2_STAES       AESVMGQIDFLIAKARYARTIKGTKPTFKE---ERTIYLPNAFHPLLDKDT---------
MUTS2_STAHJ       AESVMGQIDFLTAKARYARSIKGTKPTFYK---DRTVYLPNAYHPLLNKDT---------
MUTS2_STAAS       AEQVMGQLDFLIAKARYSRSVKGTKPIFKE---DRTVYLPKAYHPLLNRET---------
MUTS2_STAAW       AEQVMGQLDFLIAKARYSRSVKGTKPIFKE---DRTVYLPKAYHPLLNRET---------
MUTS2_STAAM       AEQVMGQLDFLIAKARYSRSIKGTKPIFKE---ERTVYLPKAYHPLLNRET---------
MUTS2_STAAN       AEQVMGQLDFLIAKARYSRSIKGTKPIFKE---ERTVYLPKAYHPLLNRET---------
MUTS2_STAAC       AEQVMGQLDFLIAKARYSRSIKGTKPIFKE---DRTVYLPKAYHPLLNRET---------
MUTS2_STAAR       AEQVMGQLDFLIAKARCSRSIKGTKPIFKE---ERTVYLPKAYHPLLNRET---------
MUTS2_CLOBL       DANIVWELDFIFAKAKFASEYNCTCPTINN---EGIVDIIEGRHPLIDRRE---------
MUTS2_CLOAB       NEKIVTELDFIFAKAKYASSINATAPHVND---KGVIDIVMGRHPLIDPAK---------
MUTS2_CLOPE       NFNIIVELDFIFAKAKYGSDLGGTLPIVNE---EGVIDLMDARHPLIPKDK---------
MUTS2_CLOTE       NAKVIWELDFIFAKAKFASHNNCTLPKVSE---DGIVDIIEGKHPLIDTEK---------
MUTS2_CALS4       DVEVVSELDFLFAKARYSIKIKASRPELNT---SGYVNLKKARHPLIDPEK---------
MUTS2_SYNY3       LLAIATRLDLATARVRYSFWLGAHPPQWLTPGDEKPITLRQLRHPLLHWQAEK-------
Q31CW4_PROM9      MASILLRLENALTRSRYSKWIGGKTPIFEE---NPIISLIGFSHPLLIWENKK-------
E6VWL5_PSEA9      AYSGLVTLDVLMAKVALGRAIQGRAIEVER--EGE-PRLVRARHPLLAL-----------
Q30ZP5_DESAG      CWNLLVEADVLLARCALAGAFGGIAIDFDD--TRP-FSLRGVKHPLLAL-----------
B8IZR6_DESDA      ALELLAQLDLLQAKRRLAALLDGRCLPLTP--VAEGIQLLDARHPLLLLNRVKSADSSAT
MUTS2_HELPY       LFKEFDFLDSLQARLNFAKAYNLEFVMPSFTQ--KKMILENFSHPILKEPK---------
MUTS2_HELPJ       LFKEFDFLDSLQARLNFAKAYNLEFVMPSFTQ--KKMILENFSHPILKEPK---------
D3UIQ5_HELM1      LNKEFDKIDHIQARIFFAKQYNLQFILPQYKD--SQIILRDFAHPILTNPK---------
F8KP97_HELBC      INHEFDYIDHIIARVQFAKSANLSFIKPNNR---GDFTLSHFAHPNLNNPK---------
D1AZR4_SULD5      VNKEFDRFDAYYARVAYAREKDMDFVLPSKG---NALKLENFAHPALLHPK---------
A6Q4G0_NITSB      INRAFDRFDHYQARVRFAKAKNLHIILPKND---NKIILKSFAHPAIVYPK---------
Q7M8Q5_WOLSU      LDKEFDRFDHYQARVAFARAKNLEFMTPSRD---TKIILEGFCHPALNNPK---------
D5V647_ARCNC      INKEFDRIDHYLARLFFAKIDDKNFIIPSKN---GKNVLKEFVHPALHGGK---------
E4U1V6_SULKY      CDREFERFDHYQARVLFARARDFAILKPQNN---ADVVLEEFSHPAIHKPK---------
E6X2W5_NITSE      LDRQFDRFDHYQARVRFARSRDYEFVLPSKE---PGIVLREFAHPALENPV---------
B9LA77_NAUPA      INREFDKFDHIQARIFMAKNENLEFILPSKT---KKMVLKNFCHPALNECK---------
MUTS2_THET8       TLEALGLLDLVQAQAALARDLGLSRPAFGE-----RYELYRAFHPLIPDAV---------
B7J6A5_ACIF2      ALRHIGRLDAVRAGLELGDACGGILPKVDAA---AAFDLRALRHPLLCLRHPG-------
MUTS2_BORBU       LYNNFLYYDSLKARAIYGIKTKGVFPEISN-----VLNIFDAHHPLLKDSK---------
Q6MNH7_BDEBA      SQVLMKDADVRFAQAQFANQVEAHPIEFSD----DSMELIEVRHPLLQLSGKK-------
F2LUE2_HIPMA      NEKKLGVFDVIVAKYHYSKNLPECDIEFSSD---PIIKAKRAKHPILAAIKEK-------
E1X288_HALMS      ELHYLYKIDLIKTKANFSAELGLKRPQLNES---KEVYIKDFFHPLIENCV---------
                                                             ** :             

F8E638_FLESM      -------------AESVPIDFVLRRDNDLAVITGPNTGGKTAALKSAGLNCIIAKCGLPV
D3P8K4_DEFDS      -------------EGSIPIDIEFENNKNLIVISGPNTGGKTAALKSLGLNHILAMCGLPL
E4TIY8_CALNY      -------------EKSVPIDFEMTEDVNVAIITGPNAGGKTAALKSIGINTVLGRCGLPL
D4H7D0_DENA2      -------------EESVPLDFSLSSAELTAVVTGPNTGGKTAALKSIGLNHVLGKCGLPL
MUTS2_AQUAE       -------------EDVVPVGILLKEKK-GLILTGPNTGGKTVALKTLGLSVLMFQSAIPV
MUTS2_THEMA       ---------------VVPINLELPPNKRGFIITGPNMGGKTVTVKTVGLFTALMMSGFPL
MUTS2_THEP1       ---------------VVPINLELPPNKRGFIITGPNMGGKTVTVKTVGLFTALMMSGFPL
G8QVG0_SPHPG      ---------------AVPINVSLDDKVKAVVITGPNAGGKTVTIKTVGLLSLLNQFTGYI
F4GIH5_SPHCD      ---------------AVPVTVDIPPGIDGVVFSGPNAGGKTVTIKTVGLFALLNQFCGYV
MUTS2_BACSU       ---------------VVANDIELGRDFSTIVITGPNTGGKTVTLKTLGLLTLMAQSGLHI
MUTS2_BACVZ       ---------------VVANDIELGGDYSTIVITGPNTGGKTVTLKTLGLLTIMAQAGLHI
MUTS2_BACLD       ---------------VVPNDIELGGEYTTIVITGPNTGGKTVTLKTLGLLTMMAQSGLHV
MUTS2_BACCZ       ---------------IVPNNIMLGKDFTTIVITGPNTGGKTVTLKTVGICVLMAQSGLHI
MUTS2_BACAH       ---------------IVPNNIMLGKDFTTIVITGPNTGGKTVTLKTVGICVLMAQSGLHI
MUTS2_BACAN       ---------------IVPNNIMLGKDFTTIVITGPNTGGKTVTLKTVGICVLMAQSGLHI
MUTS2_BACHK       ---------------IVPNNIMLGKDFTTIVITGPNTGGKTVTLKTVGICVLMAQSGLHI
MUTS2_BACC1       ---------------IVPNNIMLGKDFTTIVITGPNTGGKTVTLKTVGICVLMAQSGLHI
MUTS2_BACCN       ---------------IVPNDIVLGKDFTTIVITGPNTGGKTVTLKTVGICVLMAQSGLHI
MUTS2_GEOKA       ---------------AVPNDIELGGDYTTIVITGPNTGGKTVTLKTIGLLTLMAQAGLFI
MUTS2_GEOTN       ---------------AVPNDIVLGGDYTTIVITGPNTGGKTVTLKTVGLLTIMAQAGLFI
MUTS2_BACHD       ---------------IVPIDIELGHSYSSLVITGPNTGGKTVTLKTIGLLTLMAQSGLHV
MUTS2_BACSK       ---------------VVPSDMAIGDQVRSLVITGPNTGGKTVTLKTIGLLTLMAQSGLFV
MUTS2_OCEIH       ---------------VVANDIEFGREYTSIVITGPNTGGKTVTLKLVGLCTLMAQSGLQV
MUTS2_LISMO       ---------------VVANDIYLGEDFTTIVITGPNTGGKTITLKTLGLLTLMAQSGLQI
MUTS2_LISMF       ---------------VVANDIYLGEDFTTIVITGPNTGGKTITLKTLGLLTLMAQSGLQI
MUTS2_LISW6       ---------------VVANDIYLGEDFTTIVITGPNTGGKTITLKTLGLLTLMAQSGLQI
MUTS2_LISIN       ---------------VVANDIYLGEDFSTIVITGPNTGGKTITLKTLGLLTLMAQSGLQI
MUTS2_ENTFA       ---------------AVANDIVIGEEYQAIVITGPNTGGKTITLKTLGLLQLMGQAGLPI
MUTS2_STAEQ       ---------------VVANTIEFIDDVETVIITGPNTGGKTVTLKTLGLIIVMAQSGLLI
MUTS2_STAES       ---------------VVANTIEFIDDVETVIITGPNTGGKTVTLKTLGLIIVMAQSGLLI
MUTS2_STAHJ       ---------------VVANTIEFVDDIETVIITGPNTGGKTVTLKTLGLIIIMAQSGLLI
MUTS2_STAAS       ---------------VVANTIEFMEDIETVIITGPNTGGKTVTLKTLGLIIVMAQSGLLI
MUTS2_STAAW       ---------------VVANTIEFMEDIETVIITGPNTGGKTVTLKTLGLIIVMAQSGLLI
MUTS2_STAAM       ---------------VVANTIEFMEDIETVIITGPNTGGKTVTLKTLGLIIVMAQSGLLI
MUTS2_STAAN       ---------------VVANTIEFMEDIETVIITGPNTGGKTVTLKTLGLIIVMAQSGLLI
MUTS2_STAAC       ---------------VVANTIEFMEDIETVIITGPNTGGKTVTLKTLGLIIVMAQSGLLI
MUTS2_STAAR       ---------------VVANTIEFMEDIETVIITGPNTGGKTVTLKTLGLIIVMAQSGLLI
MUTS2_CLOBL       ---------------VVPISVKLGEEFTSLMITGPNTGGKTVTLKTVGLIHLMAMSGLMI
MUTS2_CLOAB       ---------------VVPLNIYMGREFTSLVITGPNTGGKTVTLKTTGLLEVMAMSGLMI
MUTS2_CLOPE       ---------------VVSSDIYLGREFSTLLITGPNTGGKTVTLKTTGLIELMGLSGLLI
MUTS2_CLOTE       ---------------VVPTDIYLGKDFTSLIITGPNTGGKTVTLKTLGLIHIMGLSGLLI
MUTS2_CALS4       ---------------VVPIDIHIGREFTTLVITGPNTGGKTVTLKTVGLLTLMAMAGINI
MUTS2_SYNY3       ----------EGGPAVVPITLTIDSQIRVIAITGPNTGGKTVTLKTLGLVALMAKVGLYI
Q31CW4_PROM9      ----------KGSPPPVAVDFQINRNIKVVAITGPNTGGKTAALKGLGLSLLMARAGLLI
E6VWL5_PSEA9      -----------TDTAVQPVDIELLAGHKALIISGGNAGGKTVCLKTLGLIALMTFAGLPV
Q30ZP5_DESAG      -----------SSADTHPVDLELLEGQNCLIISGGNAGGKTVSLKTIGLVALMAAAGLPV
B8IZR6_DESDA      DSGHTQKSAARAAAAVKPLDIVLRPGERALIITGGNAGGKTVCLKTLGLIAAMTLSGLPV
MUTS2_HELPY       -------------------PLNLKFEKSMLAVTGVNAGGKTMLLKSLLSAAFLSKHLIPM
MUTS2_HELPJ       -------------------PLNLKFEKSMLAVTGVNAGGKTMLLKSLLSAAFLSKHLIPM
D3UIQ5_HELM1      -------------------HIQLDFNKQLLLITGVNAGGKTMLLKSILSAVFLAKHLIPF
F8KP97_HELBC      -------------------PISLRFDRSLLLITGVNTGGKTMLLKSILSAVFLAKHFLPF
D1AZR4_SULD5      -------------------PISIDFSKQVLMITGVNAGGKTMLLKSILSAAILSKYLLPM
A6Q4G0_NITSB      -------------------PVDLVFDKKVLIITGVNAGGKTMLLKSILASAYMAKYLIPM
Q7M8Q5_WOLSU      -------------------PISVRFEKSILMVTGVNAGGKTMLLKSILSSAFLARYLIPM
D5V647_ARCNC      -------------------PISIDFSKSVIMITGVNAGGKTMMLKSILSAVLMSKYLIPY
E4U1V6_SULKY      -------------------PISVDFRSNLLMITGVNAGGKTMLLKSLLSASLMAKYLIPM
E6X2W5_NITSE      -------------------PVSIRAVKPIVLVTGVNAGGKTMLLKSILSAAWMSKYLLPF
B9LA77_NAUPA      -------------------PINLEWDKQVLIITGVNAGGKTMLLKSILSSAYMAKHLLPM
MUTS2_THET8       -----------------RNSFALDEKNRILLISGPNMGGKTALLKTLGLAVLMAQSGLFV
B7J6A5_ACIF2      --------------QVVGNALRLGADAQQLVITGPNTGGKTAILKALGLNHLMAYMGLPV
MUTS2_BORBU       ------------------AITFTPAENRVVIITGPNAGGKTVTLKTIGLLSAMFQFGIPI
Q6MNH7_BDEBA      ---------------VVANTVLLEGHKSILLLSGPNAGGKTVLLKSIGLAAQMARCGLPI
F2LUE2_HIPMA      ---------------TIPVDIDL-STNRKLIITGPNTGGKTVFLKTIGLLIVGIFSAIPP
E1X288_HALMS      -----------------LNTLHLDPLTKGLIISGPNTGGKTVTLKSVTLCYLLAAMGLYV
                                                 .:* * ***:  :*               

F8E638_FLESM      -FGN-TLKMADFHSVFADIGDKQSLILDLSTFSSHMLNIKNILEEAD-------------
D3P8K4_DEFDS      -FGQ-YAEVKIFKNILADIGDNQSLIMDLSTFSSHMVNIKKIIESSD-------------
E4TIY8_CALNY      -FAR-CAELINFDKIFTDIGDQQSLVMDLSTFTSHMVNIKHIVDNSD-------------
D4H7D0_DENA2      -IGK-SARLVNFKNILADIGDKQSLVMDLSTFSAHMVNIRDIIKKAD-------------
MUTS2_AQUAE       -PASPNSKLPLFEKVFTDIGDEQSIEQNLSTFSAHVKNMAEFLPKSD-------------
MUTS2_THEMA       -PCDEGTELKVFPKIMADIGEEQSIEQSLSTFSSHMKKIVEIVKNAD-------------
MUTS2_THEP1       -PCDEGTELKVFPKIMADIGEEQSIEQSLSTFSSHMKKIVEIVKNAD-------------
G8QVG0_SPHPG      -PALEGSSLPLFDDIYTDIGDEQSIEESLSTFSGHMKQVGFILQHMT-------------
F4GIH5_SPHCD      -PAEEGTSLPLFDGIFSDIGDDQSIEKEFSTFSGHLHRIGFIMKEAT-------------
MUTS2_BACSU       -PADEGSEAAVFEHVFADIGDEQSIEQSLSTFSSHMVNIVGILEQVN-------------
MUTS2_BACVZ       -PADEGSEAAVFDNVFADIGDEQSIEQSLSTFSSHMVNIVNILKDVS-------------
MUTS2_BACLD       -PAEEGSETAVFDQVFADIGDEQSIEQSLSTFSSHMVNIVDILKDMT-------------
MUTS2_BACCZ       -PVMDESEICVFKNIFADIGDEQSIEQSLSTFSSHMVNIVDILEKAD-------------
MUTS2_BACAH       -PVMDESEICVFKNIFADIGDEQSIEQSLSTFSSHMVNIVDILEKAD-------------
MUTS2_BACAN       -PVMDESEICVFKNIFADIGDEQSIEQSLSTFSSHMVNIVDILEKAD-------------
MUTS2_BACHK       -PVMDESEICVFKNIFADIGDEQSIEQSLSTFSSHMVNIVDILEKAD-------------
MUTS2_BACC1       -PVMDESEICVFKNIFADIGDEQSIEQSLSTFSSHMVNIVDILEKAD-------------
MUTS2_BACCN       -PVQEESEICVFKNIFADIGDEQSIEQSLSTFSSHMVNIVDILEKAD-------------
MUTS2_GEOKA       -PAADGSEAAVFRSVFADIGDEQSIEQSLSTFSSHMVNIVDILRHVD-------------
MUTS2_GEOTN       -PAADGSEAAVFRSVFADIGDEQSIEQSLSTFSSHMVNIVDILRHVD-------------
MUTS2_BACHD       -PAEEESELAVFKHVFADIGDEQSIEQSLSTFSSHMTNIVDILGKVD-------------
MUTS2_BACSK       -PAAEETELAVFEHIFADIGDEQSIEQSLSTFSSHMKNIVSILNEMN-------------
MUTS2_OCEIH       -PALDGCEMPVFDEVFADIGDEQSIEQNLSTFSSHMTNIVDIMKKIT-------------
MUTS2_LISMO       -PAQEDSTIAVFEHVFADIGDEQSIEQSLSTFSSHMTNIVSILEKVN-------------
MUTS2_LISMF       -PAQEDSTIAVFEHVFADIGDEQSIEQSLSTFSSHMTNIVSILGNVN-------------
MUTS2_LISW6       -PAQEDSTIAVFEHVFADIGDEQSIEQSLSTFSSHMTNIVSILEKVN-------------
MUTS2_LISIN       -PAQEDSTIAVFENVFADIGDEQSIEQSLSTFSSHMTNIVSILEKVN-------------
MUTS2_ENTFA       -PVEEESKMGIFTEVFADIGDEQSIEQSLSTFSSHMTNIVSVLKKVD-------------
MUTS2_STAEQ       -PTLDGSQLSIFENVYCDIGDEQSIEQSLSTFSSHMKNIVEILQDAD-------------
MUTS2_STAES       -PTLDGSQLSIFENVYCDIGDEQSIEQSLSTFSSHMKNIVEILQDAD-------------
MUTS2_STAHJ       -PTLDGSQLSVFENVYCDIGDEQSIEQSLSTFSSHMKNIVEILQETD-------------
MUTS2_STAAS       -PTLDGSQLSVFKNVYCDIGDEQSIEQSLSTFSSHMTNIVEILKHAD-------------
MUTS2_STAAW       -PTLDGSQLSVFKNVYCDIGDEQSIEQSLSTFSSHMTNIVEILKHAD-------------
MUTS2_STAAM       -PTLDGSQLSVFKNVYCDIGDEQSIEQSLSTFSSHMTNIVEILKHAD-------------
MUTS2_STAAN       -PTLDGSQLSVFKNVYCDIGDEQSIEQSLSTFSSHMTNIVEILKHAD-------------
MUTS2_STAAC       -PTLDGSQLSVFKNVYCDIGDEQSIEQSLSTFSSHMTNIVEILKHAD-------------
MUTS2_STAAR       -PTLDGSQLSVFKNVYCDIGDEQSIEQSLSTFSSHMTNIVEILKNAD-------------
MUTS2_CLOBL       -PARENSVISYFNNVFADIGDEQSIEQSLSTFSSHMKNIVEIMDKAD-------------
MUTS2_CLOAB       -PARENSTISFFKEVYADIGDEQSIEQSLSTFSSHMTNIVRIIDDAD-------------
MUTS2_CLOPE       -PASENSSISFFEEIFADIGDEQSIEQSLSTFSSHMTNIVRIMEKAN-------------
MUTS2_CLOTE       -PAKENSTIAFFEEIFADIGDEQSIEQSLSTFSSHMVNIVDIISKAD-------------
MUTS2_CALS4       -PAEEKSQISIFEDVFVDIGDEQSIEQSLSTFSSHMTNIVSILKKVN-------------
MUTS2_SYNY3       -PAKETVEMPWFAQILADIGDEQSLQQNLSTFSGHICRIIRILQALPSGVQDVLDPEIDS
Q31CW4_PROM9      -PSTNNPIIPFCPNIYVDIGDNQSLEENLSTFSGHISRIKEILESLDNRRG---------
E6VWL5_PSEA9      -PVAEGSVLPLWTDIFVVMGDEQSLEENVSTFTAQIKYLCRVWDQIG-------------
Q30ZP5_DESAG      -PAAEGSTLPCWRAVHAFIGDEQSLEGNVSTFTAQIRNLSDIWQEVG-------------
B8IZR6_DESDA      -PVGAGSHLPWFSRMDAFIGDEQSLADNVSTFTAQIEHLAKAWKHLD-------------
MUTS2_HELPY       KINAHHSIIPYFKEIHAIINDPQNSANNISTFAGRMKQFSALLSKEN-------------
MUTS2_HELPJ       KINAHHSTIPYFREIHAIINDPQNSANNISTFAGRMKQFSALLSKEN-------------
D3UIQ5_HELM1      KINASHSKIPHFKNIFAIISDPQNSKNDISTFAGRMLDFSHILQEKE-------------
F8KP97_HELBC      KIHAPTSAIPYIEHIQAIINDPQNSQNDISTFAGRMLDFQRALNTPQ-------------
D1AZR4_SULD5      RIDAKHSSIGSFKEVFAILDDPQNVKNDISTFAGRMSEFSKLFGKKA-------------
A6Q4G0_NITSB      QCDPK-SHIGRFKEILPIIEDPQNVKNDISTFAGRMLEFSRLFSKNH-------------
Q7M8Q5_WOLSU      PILASKSSIGSFKGIAAVLDDPQSAKNDISTFAGRMLSFERFFKERG-------------
D5V647_ARCNC      KANEN-SSIGYFKNALAVLDDPQSVKNDISTFAGRMVEFSKLFTQRD-------------
E4U1V6_SULKY      KINPHKSRIGSFKRIEAVIDDPQSVSNDISTFAGRMVQFSHLFEHKS-------------
E6X2W5_NITSE      RCNAAETRIGHYRNIEAIIDDPQSVKNDISTFAGRMLEFSRLFRERE-------------
B9LA77_NAUPA      KIREN-SIIPSFKEIKPIIDDPQNVKNDISTFAGRIKEFKEVFFKEN-------------
MUTS2_THET8       --AAEKALLAWPDRVYADIGDEQSLQENLSTFAGHLRRLREMLEEAT-------------
B7J6A5_ACIF2      ---TAEGTLGYFPKCFAVIGDAQDIHTDLSTFSAQVQRLREVLEHAD-------------
MUTS2_BORBU       -VVGESSTFKIFDNIFIDIGDEQSISNSLSTFSSHMSNISYILKHTT-------------
Q6MNH7_BDEBA      -CASETSKLPFFKNVLIGIGDAQSVDEELSTFAAHLKILGKAASVKG-------------
F2LUE2_HIPMA      --NAEQLTIGSFDNVFAIIGDEQDIFESLSGFSSKIVAFREAFKKAT-------------
E1X288_HALMS      --PAGECNIFLPDGIYYFSHDQQDLSSGLSSFASEAKNYLQLLDEIS-------------
                                      : *.    .* *:..                         

F8E638_FLESM      -----KNSLVLLDELGTGTEPKEGAALAVSIIEYLLEKDA-KVVVTTHFSEVKNYALKYK
D3P8K4_DEFDS      -----NNSLILLDELGTGTDPKEGAILAVAILKYLVDKGG-YIAVTTHFNEVKEFALKNS
E4TIY8_CALNY      -----GGSLVLLDELGTGTEPKEGEALAISIIEYLMDRGS-RVIVTTHFSGVRNMAYRYK
D4H7D0_DENA2      -----SDTLVLLDEAGTGTEPQEGAALAVAVCTTLADKRT-KSVVTTHFGEMKNYALSTD
MUTS2_AQUAE       -----ENTLVLIDELGAGTDPIEGSALGIGILEYLKKKKA-WVFVTTHHTPIKLYSTNSD
MUTS2_THEMA       -----SDSLVILDELGSGTDPVEGAALAIAIIEDLLEKGA-TIFVTTHLTPVKVFAMNHP
MUTS2_THEP1       -----SDSLVILDELGSGTDPVEGAALAVAIIEDLLEKGA-TIFVTTHLTPVKVFAMNHP
G8QVG0_SPHPG      -----DRSLIILDELGSGTDPVEGASLARATLEYCIEKAK-LSFVTSHHGVLKQFAYAKD
F4GIH5_SPHCD      -----PRSLIILDELGSGTDPAEGAALARAILEYCLDHAF-LTLVTSHHGVLKQYAYGSD
MUTS2_BACSU       -----ENSLVLFDELGAGTDPQEGAALAMSILDDVHRTNA-RVLATTHYPELKAYGYNRE
MUTS2_BACVZ       -----ENSLVLFDELGAGTDPQEGAALAMSILDEVHRTNA-RVLATTHYPELKAYGYNRQ
MUTS2_BACLD       -----ENSLVLFDELGAGTDPQEGAALAISILDEVCQTGA-RVIATTHYPELKAYGYNRE
MUTS2_BACCZ       -----FESLVLFDELGAGTDPQEGAALAISILDEVCNRGA-RVVATTHYPELKAYGYNRE
MUTS2_BACAH       -----FESLVLFDELGAGTDPQEGAALAISILDEVCNRGA-RVVATTHYPELKAYGYNRE
MUTS2_BACAN       -----FESLVLFDELGAGTDPQEGAALAISILDEVCNRGA-RVVATTHYPELKAYGYNRE
MUTS2_BACHK       -----FESLVLFDELGAGTDPQEGAALAISILDEVCNRGA-RVVATTHYPELKAYGYNRE
MUTS2_BACC1       -----FESLVLFDELGAGTDPQEGAALAISILDEVCNRGA-RVVATTHYPELKAYGYNRE
MUTS2_BACCN       -----FESLVLFDELGAGTDPQEGAALAISILDEVHNRGA-RVVATTHYPELKAYGYNRN
MUTS2_GEOKA       -----GESLVLFDELGAGTDPQEGAALAIAILDEVHGRGA-RTVATTHYPELKAYGYNRP
MUTS2_GEOTN       -----EESLVLFDELGAGTDPQEGAALAIAILDEVHGRGA-RTVATTHYPELKAYGYNRP
MUTS2_BACHD       -----HESLVLFDELGAGTDPTEGAALAIAILDDVYRRGA-RIVATTHYSELKGYAYNRE
MUTS2_BACSK       -----ENSLILFDELGAGTDPTEGAALAISILDHVYKRGA-LAVATTHYSELKGYAYNRE
MUTS2_OCEIH       -----DRSLVLFDELGSGTDPQEGAALAMAILDEVISKQA-RVIATTHYPELKAYGYNRE
MUTS2_LISMO       -----QKSLILYDELGAGTDPQEGAALAIAILDASHEKGA-SVVATTHYPELKAYGYNRV
MUTS2_LISMF       -----QKSLILYDELGAGTDPQEGAALAIAILDASHAKGA-SVVATTHYPELKAYGYNRV
MUTS2_LISW6       -----HKSLILYDELGAGTDPQEGAALAIAILDASHEKGA-SVVATTHYPELKAYGYNRV
MUTS2_LISIN       -----HKSLILYDELGAGTDPQEGAALAIAILDASHKKGA-SVVATTHYPELKAYGYNRA
MUTS2_ENTFA       -----HQSLVLFDELGAGTDPQEGAALAIAILDSLGAKGA-YVMATTHYPELKVYGYNRA
MUTS2_STAEQ       -----QNSLILFDELGAGTDPSEGAALAMSILDYVRRLGS-LVMATTHYPELKAYSYNRE
MUTS2_STAES       -----QNSLILFDELGAGTDPSEGAALAMSILDYVRRLGS-LVMATTHYPELKAYSYNRE
MUTS2_STAHJ       -----KNSLVLFDELGAGTDPSEGAALAMSILDHVREIGS-LVMATTHYPELKAYSYNRE
MUTS2_STAAS       -----KHSLVLFDELGAGTDPSEGAALAMSILDHVRKIGS-LVMATTHYPELKAYSYNRE
MUTS2_STAAW       -----KHSLVLFDELGAGTDPSEGAALAMSILDHVRKIGS-LVMATTHYPELKAYSYNRE
MUTS2_STAAM       -----KHSLVLFDELGAGTDPSEGAALAMSILDHVRKIGS-LVMATTHYPELKAYSYNRE
MUTS2_STAAN       -----KHSLVLFDELGAGTDPSEGAALAMSILDHVRKIGS-LVMATTHYPELKAYSYNRE
MUTS2_STAAC       -----KHSLVLFDELGAGTDPSEGAALAMSILDHVRKIGS-LVMATTHYPELKAYSYNRE
MUTS2_STAAR       -----KHSLVLFDELGAGTDPSEGAALAMSILDHVRKIGS-LVMATTHYPELKAYSYNRE
MUTS2_CLOBL       -----ENSLVLFDELGAGTDPTEGAALAISILENLRKRGT-KIIATTHYSELKAYALRKE
MUTS2_CLOAB       -----EDSLVLFDELGAGTDPTEGAALAISILEALRKRGT-KIVATTHYSELKAYALKTE
MUTS2_CLOPE       -----NKSFVLFDELGAGTDPTEGAALAISILENLRARGC-RIMSTTHYSELKGYALKTE
MUTS2_CLOTE       -----HKSLVLFDELGAGTDPTEGAALAISILENLRRRKC-KIVATTHYSELKGYALKTE
MUTS2_CALS4       -----KNSLVLLDELGAGTDPLEGSALAMSILDFLHRTGC-RTIATTHYSELKQYALKTK
MUTS2_SYNY3       PNHPIFPSLVLLDEVGAGTDPTEGSALAIALLRHLADQPC-LTVATTHYGELKALKYQDA
Q31CW4_PROM9      ------LSVVLLDEIGSGTDPLEGSALAMALLKEFANKSD-ITLATTHYGDIKALKYNDS
E6VWL5_PSEA9      -----RRTLFILDEFGAGTDPTQGAALAQAVIDNLVEREA-TSIIATHFPALKAYAMAAD
Q30ZP5_DESAG      -----SGSLVILDEFGAGTDPAQGAALAQAVVDELMEKNV-TVCVATHFPALKAYALSRE
B8IZR6_DESDA      -----ASGMVLLDEFGAGTDPAQGAALAQAVLDELLDKHT-FVLAATHFPALKSYALTRE
MUTS2_HELPY       -------MLLGVDEIELGTDADEASSLYKTLLEKLLKQNN-QIIITTHHKRLSVLMAENK
MUTS2_HELPJ       -------MLLGVDEIELGTDADEASSLYKTLLEKLLKQNN-QIVITTHHKRLSVLMAENK
D3UIQ5_HELM1      -------MILGIDEIELGTDADEAASLYKALLENLLQKGA-KIIVTTHHKRLAAMMANDA
F8KP97_HELBC      -------LLLGVDEIELGTDASEASCLYKVLLEKLMTQGA-KIVVTTHHKHLALLLAKNH
D1AZR4_SULD5      -------TLVGVDEIELGTDADEAANLFKVMIEKLIDKEM-KIVITTHHKRLASLLATHP
A6Q4G0_NITSB      -------LLVGVDEIELGTDSDEAATLFKVIIEELMKKDI-KIAITTHHKRLASLMAAHE
Q7M8Q5_WOLSU      -------FLVGVDEIELGTDSDEAASLFKVILEQLIKRDF-KIIITTHHKRLAALMAANE
D5V647_ARCNC      -------VIVGVDEIELGTDSDEAASLFKVIIEELIDKNI-KIIITTHHKRLAALMAAND
E4U1V6_SULKY      -------ALVGVDEIELGTDSDEAAALFAIVLDELIKRGQ-KIIVTTHHKRLAALMADRS
E6X2W5_NITSE      -------ALVGVDEIELGTDADEAASLFRVLLETLKEREI-TFVVTTHHKRLASLMAGEE
B9LA77_NAUPA      -------YLIGVDEIELGTDANEAASLFKVIIEEIMKKN--RIVITTHHKRLATLLAQNE
MUTS2_THET8       -----SHSLVLIDELGSGTDPEEGAALSQAILEALLERGV-KGMVTTHLSPLKAFAQGRE
B7J6A5_ACIF2      -----AHSLVLLDELGNGTDPREGGALAQAVAEALLAAEC-CTLLTSHLEVMKRYALSHA
MUTS2_BORBU       -----KDSLVIFDEFCSGTDIDQGQALAISILEYLININS-YVLISTHYNALKYFAYTHE
Q6MNH7_BDEBA      -----RDNLILIDEICGSTDPEEGSALGRAFIEEFSNNDV-FAVITSHLGPLKSGWDEQS
F2LUE2_HIPMA      -----SNTMMLIDEIGSGTSPDEGEAVAYSIIKNT-AKKC-PVCATTHYKKLAYILES-E
E1X288_HALMS      -----ENSLIVVDEIFNSTSSEEASALAISFLEQIHSRSNSLVIISTHHQFFKTYIHASK
                          ..  **   .*.  :.  :                  ::*   .        

F8E638_FLESM      EAIIYSVDFDYENFLPKYRLLSGVVGKSNPLVI----AGKLGFNETVIKNAENIIARN-S
D3P8K4_DEFDS      FAENYAVDFDYETFTPKYNLLKGVLGKSDPILI----AKKLKFNPEVIEIAEKLLKEK-K
E4TIY8_CALNY      GVVLYGVDFDYENFEPKFRLIKGLAGRSDPLII----AGKLHFNESIISRAKKILEEY-S
D4H7D0_DENA2      SALIYAVDFDYKDFSPKYRLLKGVTGKSDPLVI----ARRLNFPEDVVRLASSMIDKK-K
MUTS2_AQUAE       YYTPASVLFDRETLKPLYKIAYNTVGESMAFYI----AQKYGIPSEVIEIAKRHVGEF-G
MUTS2_THEMA       LLLNASMEFDPETLSPTYRVLVGVPGGSHAFQI----AEKLGLDKRIIENARSRLSRE-E
MUTS2_THEP1       LLLNASMEFDPETLSPTYRVLVGVPGGSHAFQI----AEKLGLDKRIIENARSRLSRE-E
G8QVG0_SPHPG      SVINASMEFDENSHHPTFRVINGIPGDSHALDT----ARAMNLPKEVVDKAQQYLGSE-A
F4GIH5_SPHCD      RLLNAAMEFDEEFHRPTFRVVSGISGESHAIET----ARRMDLPSEVIVAAQKYLGTE-A
MUTS2_BACSU       GVMNASVEFDIETLSPTYKLLIGVPGRSNAFEI----SKRLGLPDHIIGQAKSEMTAE-H
MUTS2_BACVZ       GVMNASVEFDIETLSPTYKLLIGVPGRSNAFEI----SRRLGLPEHIIGQAKSEMTAE-H
MUTS2_BACLD       NVINASVEFDIDTLSPTYKLLIGVPGRSNAFEI----SKRLGLPDYLIGRAKAEMTAE-H
MUTS2_BACCZ       QVINASVEFDVNTLSPTYKLLIGVPGRSNAFEI----SKRLGLSDRVIDQARNHISTD-T
MUTS2_BACAH       QVINASVEFDVNTLSPTYKLLIGVPGRSNAFEI----SKRLGLSDRVIDQARNHISTD-T
MUTS2_BACAN       QVINASVEFDVNTLSPTHKLLIGVPGRSNAFEI----SKRLGLSNRVIDQARNHISTD-T
MUTS2_BACHK       QVINASVEFDVNTLSPTYKLLIGVPGRSNAFEI----SKRLGLSDRVIDQARNHISTD-T
MUTS2_BACC1       QVINASVEFDVNTLSPTYKLLIGVPGRSNAFEI----SKRLGLSDRVIEQARNHISTD-T
MUTS2_BACCN       QVINASVEFDVNTLSPTYKLLIGVPGRSNAFEI----SKRLGLSERVINRARNHISTD-T
MUTS2_GEOKA       GVVNASVEFDTETLRPTYKLLIGIPGRSNAFDI----SRRLGLDERIIERAKAQVSAE-S
MUTS2_GEOTN       GVVNASVEFDTETLRPTYKLLIGIPGRSNAFDI----SRRLGLDERIIERAKVQVSAE-S
MUTS2_BACHD       GVMNASVEFDVETLSPTYRLLIGVPGRSNAFAI----SKRLGLEEKIIEQAKAHIDED-A
MUTS2_BACSK       GALNASVEFDVETLRPTYRLLVGVPGRSNAFAI----SRRLGLDERIIDQAKLQIDSD-A
MUTS2_OCEIH       QVVNASVEFNVETLKPTYRLLIGVPGRSNAFDI----STRLGLERATIERAKSLIGVD-S
MUTS2_LISMO       HATNASVEFNVETLSPTYKLLIGVPGRSNAFDI----SRRLGLSENIITEARSLVDTE-S
MUTS2_LISMF       HATNASVEFNVETLSPTYKLLIGVPGRSNAFDI----SRRLGLSENIITEARSLVDTE-S
MUTS2_LISW6       HATNASVEFNVETLSPTYKLLIGVPGRSNAFDI----SRRLGLSENIITEARSLVDTE-S
MUTS2_LISIN       HATNASVEFNVETLSPTYKLLIGVPGRSNAFDI----SRRLGLSESIITEARSLVDTE-S
MUTS2_ENTFA       GTINASMEFDVDTLSPTYRLLIGVPGRSNAFEI----SKRLGLDNSIIEAAKQIMDGE-S
MUTS2_STAEQ       GVMNASVEFDVETLSPTYKLLMGVPGRSNAFDI----SKKLGLSLNIINKAKTMIGTD-E
MUTS2_STAES       GVMNASVEFDVDTLSPTYKLLMGVPGRSNAFDI----SKKLGLSLNIINKAKTMIGTD-E
MUTS2_STAHJ       GVMNASVEFDVNTLSPTYKLLMGVPGRSNAFDI----SRKLGLSLGIINKAKTMIGTD-E
MUTS2_STAAS       GVMNASVEFDVDTLSPTYKLLMGVPGRSNAFDI----SKKLGLSLNIINKAKTMIGTD-E
MUTS2_STAAW       GVMNASVEFDVDTLSPTYKLLMGVPGRSNAFDI----SKKLGLSLNIINKAKTMIGTD-E
MUTS2_STAAM       GVMNASVEFDVDTLSPTYKLLMGVPGRSNAFDI----SKKLGLSLNIINKAKTMIGTD-E
MUTS2_STAAN       GVMNASVEFDVDTLSPTYKLLMGVPGRSNAFDI----SKKLGLSLNIINKAKTMIGTD-E
MUTS2_STAAC       GVMNASVEFDVDTLSPTYKLLMGVPGRSNAFDI----SKKLGLSLNIINKAKTMIGTD-E
MUTS2_STAAR       GVMNASVEFDVDTLSPTYKLLMGVPGRSNAFDI----SKKLGLSLNIINKAKTMIGTD-E
MUTS2_CLOBL       GVENASVEFDVETLRPTYRLLIGIPGKSNAFEI----SKRLGLPDYIIDFARENISNE-N
MUTS2_CLOAB       NVENASVEFDVETLRPTYRLLIGIPGKSNAFEI----SKRLGLSDYIIEEARKGISKD-T
MUTS2_CLOPE       NVENASVEFNVETLRPTYRLLIGVPGKSNAFEI----SRRLGLKDNVIEEAKKVISTE-S
MUTS2_CLOTE       DVENASVEFDVETLRPTYRLLIGIPGKSNAFEI----SKRLGLGEDIIEEAKNNIESD-S
MUTS2_CALS4       GVENASVEFDVETLRPTYRLIIGIPGRSNAFEI----SRRLGLSEEIIENAKSYMSGE-A
MUTS2_SYNY3       RFENASVEFDDQSLSPTYRLLWGIPGRSNALAI----AQRLGLPLAIVEQAKDKLGGF-S
Q31CW4_PROM9      RFENVSVAFDEDSLKPKYILNWGIPGRSNALSI----SKRIGLNESILNEAANYLKPKEV
E6VWL5_PSEA9      SVRAASVLFDPGTKKPLFRLAYDQVGASIALDV----AREHGLPRTILERAERYLLLE--
Q30ZP5_DESAG      GVRAASVLFDPGTKRPLYRLAYDQVGASQALDV----AREHGMPDAVLRRAHNYLLLD--
B8IZR6_DESDA      GARAASMLFDPQSKKPLFKLAYDQVGASQALDV----AREHGLPESIVRRAEHYLLQD--
MUTS2_HELPY       EVELLAALYDEEKERPTYTFLKGVIGKSYAFET----ALRYGVPHFLIEKAKTFYGED-K
MUTS2_HELPJ       EVELLAALYDEEKERPTYTFLKGVIGKSYAFET----ALRYGVPPFLIEKAKAFYGED-K
D3UIQ5_HELM1      RIELCAAIYDEARQKPTFEFLHGSIGKSYAFET----ARRYKIPLNLIEEAQKNYGED-K
F8KP97_HELBC      AIQLLAAHFDPQAQLPTYTFSPGLIGKSYAFES----ALRYGVPLEIINQARALYGAE-Q
D1AZR4_SULD5      EVELLAAIYDEKTERPTYSFLKGTIGKSYAFET----ALRYGIPQTLVAEARVLYGED-K
A6Q4G0_NITSB      DVELVAAMYDEEKGVPTYEFLQGIIGKSYAFET----ARRYGIPLGIVQRAKKEYGED-Q
Q7M8Q5_WOLSU      EVELMAALYDEKRQMPTFSFLQGTIGKSYAFET----AERYGIPPFVIKEAKEVYGQD-K
D5V647_ARCNC      KVELIAAIYDEANQRPTYDFLQGTIGRSYAFET----AQRYGIPINVVKKAKEVYGDD-Q
E4U1V6_SULKY      DVELMAALYDEERRVPTYEFLQGVIGKSYAFET----ASRYGINPAIITRAKALYGEN-H
E6X2W5_NITSE      DVELVAALYDEERRQPTFTYLEGSIGKSYAFET----AERYGIPASVVAKARELYGED-K
B9LA77_NAUPA      EVELLAAIYDEKNQKPTYEFIKGTIGKSYAFET----AKRYGIPFNIIEKAKKEYSDD-L
MUTS2_THET8       GIQNASMRFDLEALRPTYELVLGVPGRSYALAI----ARRLALPEEVLKRAEALLPEG--
B7J6A5_ACIF2      GVALAGMGFDAESLKPTYRLLWGVGGASQGLVI----ARRVGMPAPLMNRAEALYADD-R
MUTS2_BORBU       GVVNASMRMDLETMQPNYNLIFSIPGESYAFNV----ASKALIDRSIVIRANEIYSSQ-K
Q6MNH7_BDEBA      RVYNGSLEYDPKTGRPTYQFLAGIPGDSMAIQT----AKRVGVAQSIVQRALDVLAPA-T
F2LUE2_HIPMA      GFRVAAFEFNTKTLKPTYKLTYDRIGKSYGIEI----LKTLNVDKQITNEAHEFYSNQ-A
E1X288_HALMS      EYISSHVGFDMETSKPTYKLNYGSPGSSMAFKIFDILAEKFGLSNTISSKAEHILDKK--
                           :     * .    .  * *  :           .       *         

F8E638_FLESM      SQAEFKLDELNEQKAALERRLFELRQHEQNVLEQKEDVERREKEINRKLRMKESEILEES
D3P8K4_DEFDS      GSIEFEIEKINEIKLETELLKKSLENKKAELEEKEKQLEEKIKEFNNKLQQKEEKLLEEA
E4TIY8_CALNY      SLEILSADELNRLKLDIEKERYTLEELKRSLEIKESELLVKENELKKKLNAKEEQILSDA
D4H7D0_DENA2      SQADLSVEEISRMQADLEGRLKDYEERMASLQELEQRYKEKEERLKERLAKKETELLEDT
MUTS2_AQUAE       EQYIKAMEKLSDYVKKYEEEFRKLEELRKELQKEKEEVEKLRKEYEEAKRKGWKEAYKEA
MUTS2_THEMA       MELEGLIRSLHEKISLLEEEKRKLQKEREEYMKLREKYEEDYKKLRRMKIEEFDKELREL
MUTS2_THEP1       MELEGLIRSLHEKISLLEEEKRKLQKEREEYMKLREKYEEDYKKLRRMKIEEFDKELREL
G8QVG0_SPHPG      IQIGEIIKGLERKKQDADLRERHIEERYTALQQQVRDIQLKELKLRQESLLLKEEQASQL
F4GIH5_SPHCD      VRISTIIRDLEEKQRRARQMEEEMAQDKKALESALAQARERSRTLLEEEVRVREDGMAQL
MUTS2_BACSU       NEVDTMIASLEQSKKRAEEELSETESIRKEAEKLHKELQQQIIELNSKKDKMLEEAEQQA
MUTS2_BACVZ       NEVDLMIASLEKSKKRADEELSETESIRKEAEKLHKDLQQQIIELNAQKDKMMEEAEQKA
MUTS2_BACLD       NEVDTMIASLEDSKKRAEAELKETEAIRAEAEALHRDLQQQISEWQEKKDKLYEEAEQKA
MUTS2_BACCZ       NKIENMIAKLEESQKNAERDWNEAEALRKQSEKLHRELQRQIIEFNEERDERLLKAQKEG
MUTS2_BACAH       NKIENMIAKLEESQKNAERDWNEAEALRKQSEKLHRELQRQIIEFNEERDERLLKAQKEG
MUTS2_BACAN       NKIENMIAKLEESQKNAERDWNEAEALRKQSEKLHRELQRQIIEFNEERDERLLKAQKEG
MUTS2_BACHK       NKIENMIAKLEESQKNAERDWNEAEALRKQSEKLHRELQRQIIEFNEERDERLLKAQKEG
MUTS2_BACC1       NKIENMIAKLEESQKNAERDWNEAEALRKQSEKLHRELQRQIIEFNEERDERLLKAQKEG
MUTS2_BACCN       NKIENMIAKLEESQKNAERDWKEAEELRKQSEKLHRELQRQIIEFNEERDERLLKAQKEG
MUTS2_GEOKA       HNVENMIASLERSKKQAEEDEARARAALEEAERLRAEWEQKWEELEEEKAERLAEATQKA
MUTS2_GEOTN       HSVENMIASLERSKKQAEEDEARAHSAREEAERLRAEWEQKLEELEDKKAEQLAEAAQKA
MUTS2_BACHD       SQVESMIASLEQSQKSAESDWEEAEKALQEAEQLRLDLQKKLDDLEKEKERILAEAEQQA
MUTS2_BACSK       SQVEKMIASLEDSQKSAQSEWSRAEAVRREAEALKRDLEKRMASFEEMKEAALQKAEQKA
MUTS2_OCEIH       KSVENMIASLEKSHLEAEQDYEQAHDVLLESEKLRNALEHEWNLFEQKKEKLYKKAEEKA
MUTS2_LISMO       ADLNDMISSLEEKRNLAETEYEEARELARGADNLLKDLQKEITNYYQQKDKLIEQASEKA
MUTS2_LISMF       ADLNDMISSLEEKRNLAETEYEEARELARGAGNLLKDLQKEISNYYQQKDKLIEQASEKA
MUTS2_LISW6       ADLNDMISSLEEKRNLAETEYEEARELARGADALLKDLQKEITNYYQQKDKLMEQAREKA
MUTS2_LISIN       ADLNDMISSLEEKRNLAEREYEEARELARGADALLKDLQKEITNYYQQKDKLLEQANEKA
MUTS2_ENTFA       QDLNEMIEDLENRRKMAETEYLEARHYVDESAALHKELKEAYQVFFEEREKELQKARKEA
MUTS2_STAEQ       QEINAMIESLEQNSKRVDQQRIELDRLVREAQQTHDALSKQYQQYQNYETSLMDEAKEKA
MUTS2_STAES       QEINAMIESLEHNSKRVDQQRIELDRLVREAQETHDALSKQYQQYQNYEKSLMEEAKEKA
MUTS2_STAHJ       QEINSMIESLEKNSKRVDEQRIELDRLLKEARKTHDDLEHQYEQYKSYEKKLMDEAKEKA
MUTS2_STAAS       KEINEMIESLERNYKRVETQRLELDRLVKEAEQVHDDLSKQYQQFQNYEKSLIEEAKEKA
MUTS2_STAAW       KEINEMIESLERNYKRVETQRLELDRLVKEAEQVHDDLSKQYQQFQNYEKSLIEEAKEKA
MUTS2_STAAM       KEINEMIESLERNYKRVETQRLELDRLVKEAEQVHDDLSKQYQQFQNYEKSLIEEAKEKA
MUTS2_STAAN       KEINEMIESLERNYKRVETQRLELDRLVKEAEQVHDDLSKQYQQFQNYEKSLIEEAKEKA
MUTS2_STAAC       KEINEMIESLERNYKRVETQRLELDRLVKEAEQVHDDLSKQYQQFQNYEKSLIEEAKEKA
MUTS2_STAAR       KEINEMIESLERNYKRVETQRLELDRLVKEAEQVHDDLSKQYQQFQNYEKSLIEDAKEKA
MUTS2_CLOBL       IRFEELIENLQEKSIKAQEDARLAENLKLERDKEKKKYEEKLEGLQKVRDNALIDARREA
MUTS2_CLOAB       LEFEDLIQNLQTRSVKAEENLRKAEFLKEQAEKFKEKYEEKVSSITETREKALHEGRREA
MUTS2_CLOPE       LQFEDLIQSLQEKSIKAENDAREAAILRNDAEKYKNRYKEKFERIESVRDNVYADARREA
MUTS2_CLOTE       LKFEALIEKLQSKSIKASDDARRAEMYKLEADRLKDKYEDKLKIVEETREKLLKGAQEEA
MUTS2_CALS4       IRFEDVIKDVEEKRKDLENAYQEVERLKKEVEVLKEELEKEKRKLESQKDKILKEAKEKA
MUTS2_SYNY3       EDINQVIAGLESQRREQEQKAANAQKLLQETEIFYQQVSQKAASLQARERELKSYQDQEV
Q31CW4_PROM9      DNINSIIKGLEEERIKQQNSAEAAAELIARTEILHDELKRNYEYQKINAEKIQEIERYKL
E6VWL5_PSEA9      --GSDTSSVLDRLNEMAVKREQELDAVRAEREKLEHKRDKLEARFEKERARVLKDIQAQA
Q30ZP5_DESAG      --GEDSAALIERLNALAVSREQELDDLEREKLRLKSKRDKLEARFEKERLRLFESVQAQA
B8IZR6_DESDA      --GQDATALLSRLNDLAAKREEELVILRQEQDKTRSAARHEREKLEKERLRLHDEVRTKA
MUTS2_HELPY       EKLNVLIENSSALERELKQKNEHLENALKEQEYLKNAWLLEMEKQKEIFHNKKLELEKSY
MUTS2_HELPJ       EKLNVLIENSSTLERELKQKNEHLENALKEQEDLKNAWLLEMEKQKEIFHHKKLELEKSY
D3UIQ5_HELM1      EKLNILIEKSAQLEITLQQKIKECQAKILLYEKKEQALEDLKEEQKNAYAREKSKLENIY
F8KP97_HELBC      ENLNALIERTSALEQELRVQHAQLEEAKKAHSQQIQEELEQLQAKAQAQQAKQNALEKSY
D1AZR4_SULD5      EKLNDLIQKNIDLELKMRQTSEELEAKLHEVEKLKLSLKEEKERVKDEFELAYSKMAKEF
A6Q4G0_NITSB      EKLSELIERGSELERALKEKNQKLNLELSRVTRERMLLQEEREKFHEMLKSEKRKLEQIY
Q7M8Q5_WOLSU      EKLGELIEKSAQLEIELGQKNRALELELERVRQKREELNDTLEKQKEAHRHHLQRLDQRY
D5V647_ARCNC      DRLNELIERSSALEMEYQQKIAKLDMEIDKHQKLNKNLKEAKQELDDHINVEKSKLHKEY
E4U1V6_SULKY      EKLSVLIERGSELERELKRKNREVDERLEALKAQEAALKEAREQLRSDLDAEKAKLRAGY
E6X2W5_NITSE      ERLNELIEQSTRLEAEMRRKIDEVERSTEALRRKEEQLKALEEKMREEQRKALSTLENRY
B9LA77_NAUPA      EKLDVLIEKSAALEFEQKQKIKELESELEDVKLLKESLIRQKEEFNETIEKEKNRLLKEY
MUTS2_THET8       GRLEALLERLEAERLALEAERERLRRELSQVERLRKALAEREARFEEERAERLKALEEEV
B7J6A5_ACIF2      ENWERWEAQRETLLQAARQAMDEAVLARDEATSVARSLERELEAARQERDKAAAAARAEW
MUTS2_BORBU       TEINEILEKLIEKEKDLLLIKESMDKKLIQIELQEKELENFYQDLLLREKNIETKLLNEQ
Q6MNH7_BDEBA      RARLEGLEQIEQLKADINLLQDHLKKETKKATEMKRKYEGMLEQFNKDKDEWLQRTVKKA
F2LUE2_HIPMA      SIFNKLEGQLQKTIEHYTKAKNALAKTKERYINLIENEKKEKEELIQKLKEEQYQKQKEY
E1X288_HALMS      ------QLSYEQLLQELSQKKSELDKKLIENRQLNINLKNQKKSMDGLVLLEKERITSEY
                                                                              

F8E638_FLESM      YSLLQKLKRKVKSKKPVYPEKQLDED---------INATEEKLNNV--------------
D3P8K4_DEFDS      FTLLQKGKNLIKNSK-QYSPNEIDKD---------LKIVSKKLNKI--------------
E4TIY8_CALNY      LSILNKVKSLKVRSN---NNKEVDEI---------KSNIVKRMESL--------------
D4H7D0_DENA2      VRMYNRAKRLAEKPQ--KVKESVEEE---------IKRASDKLVKT--------------
MUTS2_AQUAE       REYLRK---LVQESEEIFKKAKEKKE---------IKEFVSKKREE--------------
MUTS2_THEMA       NDYIRKVKKELDQAIHVAKTGSVD-EMREAVKTIEKEKKDLEQKRI----EEATEEEIKP
MUTS2_THEP1       NDYIRKVKKELDQAIHVAKTGSVD-EMREAVKTIEKEKKDLEQKRI----EEATEEEIKP
G8QVG0_SPHPG      ARFMRDKRKELENLVADLRTGEITREKTKKVKAYVSSLEDKHALTE----SQIESEKG-M
F4GIH5_SPHCD      SSYIADTRKSLENLIADLRHGEISREKTLRAKQFIADLQEKEKKER----DALVSRKDRQ
MUTS2_BACSU       AEKVKAAMKEAEDIIHELRTIKEEHK--S-FKDHELINAKKRLEGA----MPAFE--KSK
MUTS2_BACVZ       AEKLEAAANEAEQIIRELRSIKQEHR--S-FKEHELIDAKKRLGDA----MPAFE--KSK
MUTS2_BACLD       AEKVKAAMKEADDIIQSLRMIKEDHK--A-FKDHELIEAKKRLEEA----VPSFE--KAK
MUTS2_BACCZ       EEKVEAAKKEAEGIIQELRQLRKAQL--ANVKDHELIEAKSRLEGA----APELV--KKQ
MUTS2_BACAH       EEKVEAAKKEAEGIIQELRQLRKAQL--ANVKDHELIEAKSRLEGA----APELV--KKQ
MUTS2_BACAN       EEKVEAAKKEAEGIIQELRQLRKAQL--ANVKDHELIEAKSRLEGA----APELV--KKQ
MUTS2_BACHK       EEKVEAAKKEAEGIIQELRQLRKAQL--ANVKDHELIEAKSRLEGA----APELV--KKQ
MUTS2_BACC1       EEKVEAAKKEAEGIIQELRQLRKAQL--ANVKDHELIEAKSRLEGA----APELV--KKQ
MUTS2_BACCN       EEKVEAAKKEAEAIIRELRQLRKAQL--ANVKDHELIEAKSRLEGA----APELV--KKQ
MUTS2_GEOKA       ADIIRAAEREAERIIQELRRLQKEKQ--AEVKEHELVEAKQRLAAA----MPKVE--KRK
MUTS2_GEOTN       TDIIRAAEREAERIINELRRLQKEKQ--AEVKEHELIAAKQRLAAA----VPVVE--KRK
MUTS2_BACHD       EQAVKDAKEEAEVIISELRDLQK-QG--VSVKEHQIIDAKKHLEEA----APKLTK-QQK
MUTS2_BACSK       EKVVAAAQENAELIISELRDLQK-QG--VAVKEHQLIEARKQLEEA----APKLVS-KKR
MUTS2_OCEIH       EKAIQKAREEAETIVSEMRQMKD--S--AGLKEHEWIEARKMLDEA----KPNLTKNGNQ
MUTS2_LISMO       ATIVEKAEAEAEEIIRELRTMQLNGA--AGIKEHELIDAKTRLGNA----KPKTIN-KTI
MUTS2_LISMF       ATIVEKAEAEAEEIIHELRTMQLNGA--AGIKEHELIDAKTRLGNA----KPKTIN-KTI
MUTS2_LISW6       ANIVTKAEVEAEEIIHELRTMQLNGA--AGIKEHELIDAKTRLGKA----KPKTIN-KTI
MUTS2_LISIN       AGIVEKAETEAEEIIHELRTMQLNGA--AGIKEHELIDAKTRLGKA----KPKTIN-KAI
MUTS2_ENTFA       NKIIAEAEENAETIISDIRKMQLESGQQGGVKEHQLIDAKTQLSQL----HHEETK-LAK
MUTS2_STAEQ       NQRVKSATKEADEILKELRNLRDHKG--AEVKEHELIDKKKQLDDQ----YEVKSI----
MUTS2_STAES       NQRVKSATKEADEILKELRNLRDHKG--AEVKEHELIDKKKQLDDQ----YEAKSI----
MUTS2_STAHJ       NQRVKSATKEADSILKELRTLRDQKG--ADVKEHELIDKKKQLDDQ----YEAKSL----
MUTS2_STAAS       NQKIKAATKEADDIIKDLRQLREQKG--ADVKEHELIDKKKRLDDH----YEAKSI----
MUTS2_STAAW       NQKIKAATKEADDIIKDLRQLREQKG--ADVKEHELIDKKKRLDDH----YEAKSI----
MUTS2_STAAM       NQKIKAATKEADDIIKDLRQLREQKG--ADVKEHELIDKKKRLDDH----YEAKSI----
MUTS2_STAAN       NQKIKAATKEADDIIKDLRQLREQKG--ADVKEHELIDKKKRLDDH----YEAKSI----
MUTS2_STAAC       NQKIKAATKEADDIIKDLRQLREQKG--ADVKEHELIDKKKRLDDH----YEAKSI----
MUTS2_STAAR       NQKIKAATKEADDIIKDLRQLREQKG--ADVKEHELIDKKKRLDDH----YEAKSI----
MUTS2_CLOBL       KNIIKEAKEEADKILKDIRQLERMGY--SSDARRKLEEERKKLKDK----LDSIEEK--E
MUTS2_CLOAB       KKIIEEAKSEADKILKDMREMERLGY--SSEARQRLQESRQKLKEK----LNNAEESL-N
MUTS2_CLOPE       KQILDSAKEEADAILKNMRDLERMGI--SSDARRKLEAERGKLRDK----ISDAEARLQK
MUTS2_CLOTE       KKLIKEAKEEADEILKNIRELEKMGY--SSTARQKLEEERKKLNSK----IHKLEEKE-E
MUTS2_CALS4       REIIKEAKQTAEEVIKRIKEAEEKEK--NKD--RAIQEIREKIKKN----LEELEEEVLK
MUTS2_SYNY3       QQAIAAAKEEIAKVIRQLQRGKPSAQ------------KAQQATEI----LGQIQAEQ-K
Q31CW4_PROM9      SKKIISAKKEVIDLIRKLRDQNVNGE------------DTRIIGKR----LKEIETEHLT
E6VWL5_PSEA9      QAIVRQWQADKLGRKETRKKLAEVRERVLEMGPNPTAGTGNTAGDGDLSFADIVPGLKVS
Q30ZP5_DESAG      QDVLRDWKQGKRSHKQALKDLAAVRQRLVSEQAAAQQGQAAPV-------EALCAGMTVR
B8IZR6_DESDA      SELMRAWKEGRATHKQALKEMARLRASLVPDDTADKSGSVLPIA------EHFVVGQQVL
MUTS2_HELPY       QQALNILKSEVAS----KDTSSMHKE---------IHKASEILSKH------------KT
MUTS2_HELPJ       QQALNILKSEVAS----KDTSSMHKE---------IHKASEILNKH------------KT
D3UIQ5_HELM1      NQALKALKLELKE----KQSQDIHRS---------INHANKILAQQ------------KS
F8KP97_HELBC      QQALRALQDALKEFERTQNKSHAHQQ---------IQAIKASLTQP------------KP
D1AZR4_SULD5      QEAIGEAKKAIKS----SDTKESHRL---------LNKANQLHQET------------KK
A6Q4G0_NITSB      QEAVSEAKKALRA----KEEKELHRH---------LTKASQIAKSA------------KL
Q7M8Q5_WOLSU      QEAIDAAKEAAKE----SQAESIHKG---------MNNANKLLQAI------------KE
D5V647_ARCNC      KDARDEAKKAIKA----KIYQESHQH---------LNIAHKKVKEI------------TV
E4U1V6_SULKY      DEAVREAKEAARG----MDMAAIHRQ---------LNKAQAKLPKA------------EP
E6X2W5_NITSE      NAATKRALAALKK----AENPEARRL---------LNEAHRHKNRA------------RM
B9LA77_NAUPA      NEAIKKAKEAIRA----KSVKDAHRA---------LNEANKVRSNI------------KV
MUTS2_THET8       RAELLKVEAELKALKEKARTEGKRDA---------LRELMALRERY--------------
B7J6A5_ACIF2      EDILATARQQVRQAIAALKSGRDTQA---------ATAALQRLEVP--------------
MUTS2_BORBU       NEFLKNSRKVLENLVREIKEGNINVAKNKAFISDLEKNVDLKTNKV--------------
Q6MNH7_BDEBA      ERKVEEAIAHAKADETFKRHTALQEI------KYKLPEIVKAKPIT-------------Q
F2LUE2_HIPMA      EKLLESLKNEISQLLKTKNISKAHKK----------INQIKQQSKN--------------
E1X288_HALMS      KKKLDKIISQAENLLVETKKGKIDSRKQFEKKVINLTDSIPDPKKQ--------KFNERV
                                                                              

F8E638_FLESM      ---KKHDKPVENIS-KGDTVFLEKYNKEAEILDVDKD--RVYVDMGGIKVKMSKNDIIGR
D3P8K4_DEFDS      ---KEKKPKITDIK-IGDKILLEKYNKIAEILEIKKD--TVYVNLEGIKIELKKSDLIGE
E4TIY8_CALNY      ---DIGDH-IPDVK-VGDMVKLSKYGKVAKILEISKN--KAYVDMEGMKFTIELDKIRGE
D4H7D0_DENA2      ---KKKIKPVEGIR-AGDLIHLERYGKNAKILEVEGN--SARMDIGGMKISMKLSEIVGK
MUTS2_AQUAE       ---IENLAPQKPQK-LEVGDLVEFMGKKGKVLEVKGN--KALVLVDHLRMWLDTRELQKV
MUTS2_THEMA       GDHVKMEGGTSVGK--VVEVKSGTALVDFGFLRLK-------VPVSKLRKTKKEE-----
MUTS2_THEP1       GDHVKMEGGTSVGK--VVEVKSGTALVDFGFLRLK-------VPVSKLKKAKKEE-----
G8QVG0_SPHPG      IEPHRQAGHIQFKE--QMDVLCGTAKREGRIIRRAAK-DSWIVAIGTMKFTMKEQDLSLP
F4GIH5_SPHCD      RTFNRTQDATLLTE--GMDVLVGTARKEGRLLRKKGK-NSWEVSVGVMRMVIDEKDIHPV
MUTS2_BACSU       KPEKPKTQ-KRDFK-PGDEVKVLTFGQKGTLLEKTGG-NEWNVQIGILKMKVKEKDLEFI
MUTS2_BACVZ       QPERKTEK-KRELK-PGDEVKVLTFGQKGALLEKTGE-KEWNVQIGILKMKVKEKDLEFL
MUTS2_BACLD       KPAQKKTD-KRELK-PGDEVKVLTFGQKGTLLEKTGA-AEWNVQIGILKMKVKEKDLEFL
MUTS2_BACCZ       KVNVKNTAPKQQLR-AGDEVKVLTFGQKGQLLEKVSD-TEWSVQIGILKMKVKESNMEYI
MUTS2_BACAH       KVNVKNTAPKQQLR-AGDEVKVLTFGQKGQLLEKVSD-TEWSVQIGILKMKVKESNMEYI
MUTS2_BACAN       KVNVKNTAPKQQLR-AGDEVKVLTFGQKGQLLEKVSD-TEWSVQIGILKMKVKESNMEYI
MUTS2_BACHK       KVNVKNTAPKQQLR-AGDEVKVLTFGQKGQLLEKVSD-TEWSVQIGILKMKVKESNMEYI
MUTS2_BACC1       KVNVKNTAPKQQLR-AGDEVKVLTFGQKGQLLEKVSD-TEWSVQIGILKMKVKESDMEYI
MUTS2_BACCN       KVKVKNTAPKQQLR-PGDEVKVLTFGQKGQLLKKVSD-SEWNVQIGILKMKVKESDMEYI
MUTS2_GEOKA       K--AKKAASRHVFQ-PGDEVKVTSLNQKGYLIEKVSD-DEWQVQLGILKMKIHERDLEYI
MUTS2_GEOTN       K--TKKATARHAFQ-SGDEVKVTSLNQKGYLLEKVSE-DEWQVQLGILKMKIHERDLEYI
MUTS2_BACHD       K-VKRTAEKKREFK-PGDEVKVLSFGQKGHIVEKVSE-AEYQVQMGIMKMKVEASDLQLI
MUTS2_BACSK       KQVKKQAEKAKRLPEPGDEVKVLSFNQKGTVVKKIGD-NEYQVQLGIMKMAVPIDDIQLL
MUTS2_OCEIH       KQVDPKPVEDRQLQ-PGDEIKLLTVNQMGEVLERVSD-KEYLVQVGIMKVKVKRKDLELI
MUTS2_LISMO       PQAPKQK--PHVFQ-EGDNVRVLSLGQKGTLLNKISD-KEWNVQIGIIKMKIKTADLEYI
MUTS2_LISMF       PQAPKQK--PHVFQ-EGDNVRVLSLGQKGTLLNKISD-KEWNVQIGIIKMKIKTVDLEYI
MUTS2_LISW6       PQAPKQK--PHVFQ-VGDNVRVLSLGQKGTLLNKISD-KEWNVQIGIIKMKIKTTDLEYI
MUTS2_LISIN       PKAPKQK--PHVFQ-AGDNVRVLSLGQKGTLLNKISD-KEWNVQIGIIKMKIKTTDLEYI
MUTS2_ENTFA       NKVLKKAKEQKKLK-AGDEVIVNTYGQRGTLLKDNGK-GQWQVQLGILKMNVSEEDMTPV
MUTS2_STAEQ       KQHVQKKKYDTIHT--GDEVKVLSYGQKGEVLELVGD-EEAVVQMGIIKMKLPIEDLEKT
MUTS2_STAES       KQHVQKKKYDTIHA--GDEVKVLSYGQKGEVLELVGN-EEAVVQMGIIKMKLPIEDLEKT
MUTS2_STAHJ       KQNVQKQKYDEIHA--GDEVKVLSYGQKGEVLELVSE-EEAVVQMGIIKMKLPIEDLEKT
MUTS2_STAAS       KQNVQKQKYDKIVA--GDEVKVLSYGQKGEVLEIVND-EEAIVQMGIIKMKLPIEDLEKK
MUTS2_STAAW       KQNVQKQKYDKIVA--GDEVKVLSYGQKGEVLEIVND-EEAIVQMGIIKMKLPIEDLEKK
MUTS2_STAAM       KQNVQKQKYDKIVA--GDEVKVLSYGQKGEVLEIVND-EEAIVQMGIIKMKLPIEDLEKK
MUTS2_STAAN       KQNVQKQKYDKIVA--GDEVKVLSYGQKGEVLEIVND-EEAIVQMGIIKMKLPIEDLEKK
MUTS2_STAAC       KQNVQKQKYDKIVA--GDEVKVLSYGQKGEVLEIVND-EEAIVQMGIIKMKLPIEDLEKK
MUTS2_STAAR       KQNVQKQKYDKIVA--GDEVKVLSYGQKGEVLEIVND-EEAIVQMGIIKMKLPIEDLEKK
MUTS2_CLOBL       IKTVHKGEALKNVK-EGDEVLLASINQKVIVLSKPDNKGDVLVQAGIMKITANIKDLRAA
MUTS2_CLOAB       ISERDQGEALKSVK-EGEEVFIPSLNMKGIVISTQDSKGEVGIQAGIMKINVKLKDLRKT
MUTS2_CLOPE       KKEEQKGEELKKIE-VGMEALLPSINQKVIVLSKPDNKGEVQVQAGIMKINVKAKDLRVA
MUTS2_CLOTE       NLNKEKGKKIKEIN-LGEEVYLPKLDQKVIILSKPDNRGEVQVQAGIMKINVKLDDLRLV
MUTS2_CALS4       PKEFSYGKIPDSLK-AGQTVYIVPLDQNGIVLSPPDASGNVEVQAGILKMTVHISNLRVK
MUTS2_SYNY3       AKVAPKPIGYQPTV--GERIRIPSFGQTAEVTQVNATAQTVNVTLGLMKMTVPMADIESL
Q31CW4_PROM9      QKKVDKSISWNPKV--GDFVKIKSLNSTGQIVDLDKKGGFYEVKCGSFRSILSVNDFEGI
E6VWL5_PSEA9      YPAWNKSGTVIEVN---VRKRQAKVDIGGVAMWIKAENLGPVEKSGEP--LARAEVVSSG
Q30ZP5_DESAG      YIPWGKKAVIEEVD---ARKERLKVDLNGVSLWVSCKDVAASVPPAAPKTVRRESVVAED
B8IZR6_DESDA      HTVFNKRGVVTDVD---ERRNRVRLEMNGVNLWAEMKALRLPGSQGNPQPVGKPSSILAA
MUTS2_HELPY       NQEIPQI-----ITNFQANEKARYKNESVLIVQILDKGYYWIETELGMRLKAHGSLLKKI
MUTS2_HELPJ       DQEIPQI-----ITSFQINEKARYKNESVLVIQILDKGYYLVETELGMRLKAHGSWLKQI
D3UIQ5_HELM1      IKQETPK-----TKAFTIHQRVKYKQAKGQILSLL-KDRALIELDEGMRLKVPLALLKPL
F8KP97_HELBC      TPKTTTN-----PPALTQGACVRYKNQLGSIISLN-KESCLVALDNGLKIKINAQELTLA
D1AZR4_SULD5      VIPEHK------PEPLVVGDRIKYGSSKGVIKSIK-KEEAMIECD-GISLRVPLSKLKRS
A6Q4G0_NITSB      KEKE--------PEELKVGDSVKYRKTRGVILSIR-GKEAMIEAD-GMKLRVPLSELKRS
Q7M8Q5_WOLSU      EERSRSISNPSLKHEFKAGERVRYRQSQGTILSLG-EREVMIELDEGFKLRVKKGELRPL
D5V647_ARCNC      EKVEE-------NYNFKEKDRVKYKSSKGEIISVR-GKKALILTDAGMRLHVNVDELRPS
E4U1V6_SULKY      IKIAEPE-----PIRYEVGQAVKYRTQRGTVVSVG-AKDAMIEVE-GMRLRVKLSDLKPS
E6X2W5_NITSE      RESKAE------PLQLKVGDRVKYRSHTAEILSLK-EKEAMISVD-GLKMRVPLSKLRPA
B9LA77_NAUPA      KKSEIN-------KEFKVGDTVKYFTSIGEILDIK-GKNALVDID-GKKLWIPKNSLEPY
MUTS2_THET8       -AKKAPPPPPPPGLAPGVLVEVPSLGKRGRVVELRGE--EVLVQVGPLKMSLKPQEVKPL
B7J6A5_ACIF2      --FRAEEQQVDSLPAVGTRGLFLPLRQVTQVLRADPAQHRVQIQLRGKQLWVPAAQFAVD
MUTS2_BORBU       -NSLNNKRNVVADFKIGDKVRIVNSNAKGKIVGISKK--KITVNVGAFNVSVSSSEISLE
Q6MNH7_BDEBA      PGAPETAEEFGKKFPPGSKVYVPTLNQDGIIQSTPNSKGDVMILSGSVRLQLPWTILKPA
F2LUE2_HIPMA      --LFKDEKQKQEVPLFRVGEAVLFNGLKGTITSIKSDKATVEIEGKLLNVKLSSLSKIEH
E1X288_HALMS      KQTTAEKKISIDQLKENDYVFSPTFNKNLKIVSINQRKKEVQVLNGKMSLWMSIKNLTWP
                                                                              

F8E638_FLESM      KINKNAKES-----------VKSAKKVKVSTPPNTAVKREIVVVGKTVDEAWDRVDKFID
D3P8K4_DEFDS      KIKNKTFN----------------KKLDIKSDVKKDTSWEINVIGKRADEALSEVDKFID
E4TIY8_CALNY      KLSVNQKK--------------VDKEISVSAVVERSPRYEIVLVGKTVDEAWDELDKFLD
D4H7D0_DENA2      KVTDSEKI---------------QQDVRVSKEVQTEGRSELVLVGKRVEEGLDLLDRKLD
MUTS2_AQUAE       GKAEPQKE----------------TKVTVQTPVMEK-RDTLNLIGKDVETAVRELEKFIE
MUTS2_THEMA       ---------------------KKETSTFSYKPSS--FRTEIDIRGMTVEEAEPVVKKFID
MUTS2_THEP1       ---------------------KEESSAVSYRPSS--FRTEIDIRGMTVEEAEPVVKKFID
G8QVG0_SPHPG      KRD------------------KKKVKVL-YQSDAPMPKMVIDVRGMNLEETLAALDGQIE
F4GIH5_SPHCD      RRR------------------ETPVSVISYATASPRPSPILDVRGMTLDQALEEVSRRVE
MUTS2_BACSU       KSA---------------PEPKKEKMITAVKGKDYHVSLELDLRGERYENALSRVEKYLD
MUTS2_BACVZ       KSA---------------PEPKKEKAITAVKGKDYHVSLELDLRGERYENALSRVEKYLD
MUTS2_BACLD       KSA---------------PEPEKQKTIAAVKGKDYHVSLELDLRGERFENALHRVEKYLD
MUTS2_BACCZ       NTP---------------KQTEK-KAVATVKGRDYHVSLELDLRGERFENAMARVEKYLD
MUTS2_BACAH       NTP---------------KQTEK-KAVATVKGRDYHVSLELDLRGERFENAMARVEKYLD
MUTS2_BACAN       NTP---------------KQTEK-KAVATVKGRDYHVSLELDLRGERFENAMARVEKYLD
MUTS2_BACHK       NTP---------------KQTEK-KAVATVKGRDYHVSLELDLRGERFENAMARVEKYLD
MUTS2_BACC1       NTP---------------KQTEK-KAVATVKGRDYHVSLELDLRGERFENAMARVEKYLD
MUTS2_BACCN       NTP---------------KQLEK-KAVATVKGRDYHVSLELDLRGERFENAMMRVEKYLD
MUTS2_GEOKA       GSA---------------PAKDV-TPIATVKGKDAHVSLELDLRGERYEDALIRLEKYLD
MUTS2_GEOTN       GSA---------------PAKEV-TPIATVKGKDAHVSLELDLRGERYEDALVRLEKYID
MUTS2_BACHD       DRP---------------QPVET-KPLATIRGSDHHVKPELDLRGERYEEAMLKVEKYLD
MUTS2_BACSK       EQE---------------RRQPE-KAITTIRGNDAHVKAELDLRGERYEDAMRRVEKYID
MUTS2_OCEIH       RKP---------------KKKQV-DPVTTIKGSNYHVSTELDLRGERYEDAILRLEKYVD
MUTS2_LISMO       QPE---------------KPKKQ-RIITSVHSSGSPAKSELDLRGERYEDALQKVDKYLD
MUTS2_LISMF       QPE---------------KPKKQ-RIITSVHSSGSPAKSELDLRGERYEDALQKVDKYLD
MUTS2_LISW6       QPE---------------TPKKQ-RIITSVHSSDSPVKSELDLRGERYEDALQKVDKYLD
MUTS2_LISIN       EPE---------------KPKKQ-RIITSVHSSDSPAKSELDLRGERYEDAIQKVDKYLD
MUTS2_ENTFA       APQ---------------KEAKP-RVTTVRSAESSHVGTQLDLRGKRYEEALAEVDQYID
MUTS2_STAEQ       KKK---------------KEKPT---KMVTRQNRQTIKTELDLRGYRYEEALNELDQYLD
MUTS2_STAES       KKK---------------KEKPT---KMVTRQNRQTIKTELDLRGYRYEEALNELDQYLD
MUTS2_STAHJ       KKK---------------KEKPS---KMVTRQNRQTIKTELHLRGYRYEEAVSELDQYID
MUTS2_STAAS       QKE---------------KVKPT---KMVTRQNRQTIKTELDLRGYRYEDALIELDQYLD
MUTS2_STAAW       QKE---------------KVKPT---KMVTRQNRQTIKTELDLRGYRYEDALIELDQYLD
MUTS2_STAAM       QKE---------------KVKPT---KMVTRQNRQTIKTELDLRGYRYEDALIELDQYLD
MUTS2_STAAN       QKE---------------KVKPT---KMVTRQNRQTIKTELDLRGYRYEDALIELDQYLD
MUTS2_STAAC       QKE---------------KVKPT---KMVTRQNRQTIKTELDLRGYRYEDALIELDQYLD
MUTS2_STAAR       QKE---------------KVKPT---KMVTRQNRQTIKTELDLRGYRYEDALIELDQYLD
MUTS2_CLOBL       KGSN------------FNSSSSKIKKSKKLNLNLRRVESSVDLRGMDAEEAIYTVDKYLD
MUTS2_CLOAB       NNNP------------ISKKEKAVKK-REARLNLKSVAQSIDLRGLDSEEAIYKTDIYLD
MUTS2_CLOPE       KE---------------TKEEKKIKK-REARLNLRQVDPSIDLRGMDSEEACYTADKYLD
MUTS2_CLOTE       DK---------------PKEENKKGRKREAKLRMRTVESEIDLRGMDSMEAVYNTDKYLD
MUTS2_CALS4       EEQ--------------EQEEVKKGYSRFINEKAKSISPSLDVRGMTLDDALLEVEKYID
MUTS2_SYNY3       NGKKVEPPPKSEPVPKKVKAEPPATEAKSPPVLVRTEKNTLDCRGDRLERAESRLEKALN
Q31CW4_PROM9      NGE--------KPNFKRSKIEIKSSREDFSFSKVRTSKNTIDVRGLRVHEAEIIIEEKIR
E6VWL5_PSEA9      --------------------------------PPSELVVEVDIRGNRADMALSMLERAMD
Q30ZP5_DESAG      NVQ-----------------------------EPAGPPMRADLRGMRADVAVAELAAVLD
B8IZR6_DESDA      AHGS----------------SSTGGGGARPAGAATGASLRLDMRGLRADVALAELEQFMD
MUTS2_HELPY       QKPPKNKF----------------KPPKTTIPKPKEASLRLDLRGQRSEEALDLLDAFLN
MUTS2_HELPJ       QKPPKNKF----------------KPPKTIVPKPKEASLRLDLRGQRSEEALDLLDAFLN
D3UIQ5_HELM1      GKEPPE------------------LKTKTKIPLPKSGNVHLDLHGMRAEEAIERLDQFLS
F8KP97_HELBC      --TPPKIP----------------PQVKLERKPTAQASMRLDVRALEVLEALQQAQDFLA
D1AZR4_SULD5      GNQPKVQ----------------RAGVSISKETPSA-SMILDLHGLRADEAIERLDKFLS
A6Q4G0_NITSB      -SMPQKK----------------KSASKVHVSKPKALSVKLDLHGLRVEEALEKTDKFLS
Q7M8Q5_WOLSU      GQLPRPK----------------PKAPKISVEGARSAQVSLDLHGLRGDEAVEKLDSFLS
D5V647_ARCNC      GNEVKAKI---------------KKKTTISVEKPQGGHVNIDLHGLRGDEAVEKLDKFIS
E4U1V6_SULKY      GNLPKKP------------------KVTVTSQIDQKSGLKLDLHGLRGEESCERMDKFLS
E6X2W5_NITSE      AATPKVKKP--------------KPVSQVKVEKSDRAPLHIKLLGMRADEAEEALDAFLS
B9LA77_NAUPA      RLPKKAK-------------------AQIIKPKASKVDIKLDLHGMRLEEALEKTEEYLN
MUTS2_THET8       PEAE---------------------PGKPLLAKPRREVKEVDLRGLTVAEALLEVDQALE
B7J6A5_ACIF2      AALQ-----------------IPKEAGSTQYATPDDHPWRLDLRGQLREDALAALRRHVD
MUTS2_BORBU       NFKEKKEN-------------GKNFNFSIDYNKENLLSFTIDIRGMRSVDALDFLNKKID
Q6MNH7_BDEBA      GKPSN-------------PTSQLIRQSSNITVALADDDRTLDLRGRTVEDALQELELTLD
F2LUE2_HIPMA      KKE---------------------EKQIKVNTKLSDVSLELNLIGKRRDEAYFDLVKFID
E1X288_HALMS      TNKQ-----------------PPKQSIQVNFTKSVSGKLEIDGRGMRLDDFQRLVEDSIH
                                                              .             : 

F8E638_FLESM      EAILANISEIFIIHGRGSGALKRGIRDFLKDDVRVNSYKEASPKEGGSAVTVVNL-----
D3P8K4_DEFDS      KAVLSGVNSVYIIHGRGTGILKNIIRDFLKNDPRVKSFRAGTFHEGGDAVTVVEF-----
E4TIY8_CALNY      KAILSGWNRVFVIHGRGSGALRKGLHNILKSDQRVKNFRIADIKEGGDAITIVELL----
D4H7D0_DENA2      DSLLAGHSKLFVVHGRGSGQLRKAVHEYLRTDQRAQSYALATNEEGGQAVTVVQI-----
MUTS2_AQUAE       EAYSAGYKVVKVIHGIGSGKLKSAVREALSKNEKVKFFRDAYPKEGGSGVTVVYLEYGEE
MUTS2_THEMA       DLMMNGISKGYIIHGKGTGKLASGVWEILRKDKRVVSFRFGTPSEGGTGVTVVEVKV---
MUTS2_THEP1       DLMMNGISKGYIIHGKGTGKLASGVWEILRKDKRVVSFRFGTPSEGGTGVTVVEVKV---
G8QVG0_SPHPG      SALVHGMTTFSVIHGFGDGILSRGIGDYLKKHPRVSDFRFALPEDGGMGKTYIML-----
F4GIH5_SPHCD      ACIVHDMSGFEIIHGYGDGILAQGIGNFLDSFPAVKKRFFARPEEGGMGKTYVEL-----
MUTS2_BACSU       DAVLAGYPRVSIIHGKGTGALRKGVQDLLKNHRSVKSSRFGEAGEGGSGVTVVELK----
MUTS2_BACVZ       DAVLAGHPRVSIIHGKGTGALRKGVQDLLKNHRSVKSSRFGEAGEGGSGVTIVELK----
MUTS2_BACLD       DAVLAGYPRVSIIHGKGTGALRKGVQDLLKSHRNVKNSRFGEAGEGGSGVTIVELK----
MUTS2_BACCZ       DAQLASYPRVSIIHGKGTGALRQGVQDYLKKHRGVKTFRYGDMGEGGLGVTVVELK----
MUTS2_BACAH       DAQLASYPRVSIIHGKGTGALRQGVQDYLKKHRGVKTFRYGDMGEGGLGVTVVELK----
MUTS2_BACAN       DAQLASYPRVSIIHGKGTGALRQGVQDYLKKHRGVKTFRYGDMGEGGLGVTVVELK----
MUTS2_BACHK       DAQLASYPRVSIIHGKGTGALRQGVQDYLKKHRGVKTFRYGDMGEGGLGVTVVELK----
MUTS2_BACC1       DAQLASYPRVSIIHGKGTGALRQGVQDYLKKHRGVKTFRYGDMGEGGLGVTVVELK----
MUTS2_BACCN       DAQLANYPRVSIIHGKGTGALRQGVQDYLKNHRGVKSFRYGDMGEGGLGVTVVELK----
MUTS2_GEOKA       DAVLAGYARVSIIHGKGTGALRQGVQQFLKQHRAVKSFRFGEANEGGTGVTIVELK----
MUTS2_GEOTN       DAVLAGYPRVSIIHGKGTGALRQGVQQFLKQHRAVKSFRFGAANEGGTGVTVVELK----
MUTS2_BACHD       DALLAGYASVSIIHGKGTGALRKGVKDLLKRHPHVKSARDGGANEGGLGNTVVELR----
MUTS2_BACSK       DALLAGYHQVSIIHGKGTGALRKGVKQFVANHPRVKSARDGGMNEGGLGNTVIELK----
MUTS2_OCEIH       DVLLAGYPKASIIHGKGTGALRKGVQEFVGRHPRIKGARPGESGEGGSGVTVIQLG----
MUTS2_LISMO       EALLAGYPQVAIIHGKGTGALRTGVTEYLKNHRMVKSIRFGAAAEGGNGVTIVEFK----
MUTS2_LISMF       EALLAGYPQVAIIHGKGTGALRTGVTEYLKNHRMVKSIRFGAAAEGGNGVTIVEFK----
MUTS2_LISW6       EALLAGYPQVAIIHGKGTGALRTGVTEYLKNHRMVKSIRFGAAAEGGNGVTIVEFK----
MUTS2_LISIN       EALLAGYPQVAIIHGKGTGALRTGVTEYLKNHRMVKSIRFGAAAEGGNGVTIVEFK----
MUTS2_ENTFA       AAILAGYPQVTIVHGKGTGALRTGITEFLKNHRSVKSYEFAPQNQGGNGATVVKFQ----
MUTS2_STAEQ       QAVLSNYEQVYIIHGKGTGALQKGVQQHLKKHKSVRQFRGGMPSEGGFGVTVAELK----
MUTS2_STAES       QAVLSNYEQVYIIHGKGTGALQKGVQQHLKKHKSVRQFRGGMPNEGGFGVTVAELK----
MUTS2_STAHJ       QAVLSNYEQVYIIHGKGTGALQKAVQNHLNKHKSVKSYRGGMPSEGGFGVTVAELK----
MUTS2_STAAS       QAVLSNYEQVYIIHGKGTGALQKGVQQHLKKHKSVSDFRGGMPSEGGFGVTVATLK----
MUTS2_STAAW       QAVLSNYEQVYIIHGKGTGALQKGVQQHLKKHKSVSDFRGGMPSEGGFGVTVATLK----
MUTS2_STAAM       QAVLSNYEQVYIIHGKGTGALQKGVQQHLKKHKSVSDFRGGMPSEGGFGVTVATLK----
MUTS2_STAAN       QAVLSNYEQVYIIHGKGTGALQKGVQQHLKKHKSVSDFRGGMPSEGGFGVTVATLK----
MUTS2_STAAC       QAVLSNYEQVYIIHGKGTGALQKGVQQHLKKHKSVSDFRGGMPSEGGFGVTVATLK----
MUTS2_STAAR       QAVLSNYEQVYIIHGKGTGALQKGVQQHLKKHKSVSDFRGGMPSEGGFGVTVATLK----
MUTS2_CLOBL       EAYLGGLGEVTIVHGKGTGVLRKTIMDMLKGHSHVKRHRLGEYGEGGTGVTVVELK----
MUTS2_CLOAB       EAYMAGLGSVTVIHGKGTGVLRNAINTMLKKNSHVKSYRLGNFGEGGTGVTVVELK----
MUTS2_CLOPE       DAYVAGRGEVTLVHGKGTGVLRKAINDMLKKHPHVKSHRLGEYGEGGTGVTVVILK----
MUTS2_CLOTE       EAYVAGLKEVTVIHGKGTGILRKSINDMLKRHPQVKNYRLGEYGEGGTGVTVVELK----
MUTS2_CALS4       DAYLAGLNQVTIIHGRGTGVLRTGIAKFLRNSKYVKSFRLGRYGEGGDGVTIVELHSR--
MUTS2_SYNY3       QAL--DAGVLWIIHGKGTGKLRQGVQEYLSHHPLVKSYALAPQNDGGAGVTIAYLR----
Q31CW4_PROM9      KF----HGPLWIVHGIGTGKLKQGLRKWLSGLNYVDKIEDAALNEGGPGCSIAWIK----
E6VWL5_PSEA9      DALRKGAGKMEIIHGRGTGALRREVHDFLGHYPAVAEFSIANEERGGDGMTEVTLK----
Q30ZP5_DESAG      NALLAGTREVEVVHGRGTGALRKEVHAFLRSFAAVDAFRLAPEGRGGDGMTIVELK----
B8IZR6_DESDA      KALLAGFREVEVVHGRGTGALRRQVHEFLRTFPAVENFCLAPEDRGGDGMTIVILR----
MUTS2_HELPY       DALLGGFEEVLICHGKGSGILEKFVKEFLKNHPKVVSFSDAPINLGGSGVKIVKL-----
MUTS2_HELPJ       DALLGGFEEVLICHGKGSGILEKFVKEFLKNHPKVVSFSDAPINLGGSGVKIVKL-----
D3UIQ5_HELM1      DCLLLGFDEILVYHGIGTGVLAKVVRDFLSTHPKVLHFEDAPTRLGGLGAKIIKL-----
F8KP97_HELBC      NALLAGFEEVLIVHGKGKGILRQALREWLKKHPKVIAFEDAPYNLGGSGAQVVKI-----
D1AZR4_SULD5      DALMSGFDEVLVYHGIGTGKLAYAVRTFLSTYPALVSYGDAPINMGGFGATLIKL-----
A6Q4G0_NITSB      DALVAGFDEVLIYHGVGSGKLARAVREFLKNHPRVVSYEDAPPQMGGFGATVVKL-----
Q7M8Q5_WOLSU      DALLAGFDEILVYHGIGTGKLAYAIKEFLKTHPKVRSFEDAPAQMGGFGAKIIKL-----
D5V647_ARCNC      DCLISGFDEVLVYHGIGTGKLSKIVKDFLIKHPNVKSFTDAHPSQGGFGAKVVKL-----
E4U1V6_SULKY      DALLQGFDEVIIYHGIGTGKLAYAVKEFLKEHPSVKSFSDAPQHLGGFGAKVVRL-----
E6X2W5_NITSE      NALLHGLGEVEIIHGTGTGVLAKVVSDYLKRHPRVKNFYRMP---GNMGATIAEL-----
B9LA77_NAUPA      NAALAGLEEVWIYHGMGKGILAKGITELLKQHPLVKEFHDAPPHMGGYGAKIVKL-----
MUTS2_THET8       EARALGLSTLRLLHGKGTGALRQAIREALRRDKRVESFADAPPGEGGHGVTVVALRP---
B7J6A5_ACIF2      GAVAAGRRQVQILHGKGNGVLAEMVREFAGQDPRVSQWRMARPEHGGGGVSELELR----
MUTS2_BORBU       NIILNGINKFEIIHGKGEGHLMREVHNLLKELKFIRKYYFAHPSDGGSGKTIVEI-----
Q6MNH7_BDEBA      KAAQAREDRIKIIHGHGTEALKKAVRTYLSRSIYVKKWKAGSPEGGGDGITWVEIGEA--
F2LUE2_HIPMA      SLSLQSIKTARIVHGIGNGILKDMVRETLKQLPHVKEFHPAPPHEGGDGATIVELK----
E1X288_HALMS      ELINGDIPFLNIIHGHGEGILKKWLRTFLKSYTEVYWQ----SEDGNDGATRLTLKN---
                             : ** *   *   :                    *. .     .     

F8E638_FLESM      -
D3P8K4_DEFDS      -
E4TIY8_CALNY      -
D4H7D0_DENA2      -
MUTS2_AQUAE       T
MUTS2_THEMA       -
MUTS2_THEP1       -
G8QVG0_SPHPG      -
F4GIH5_SPHCD      -
MUTS2_BACSU       -
MUTS2_BACVZ       -
MUTS2_BACLD       -
MUTS2_BACCZ       -
MUTS2_BACAH       -
MUTS2_BACAN       -
MUTS2_BACHK       -
MUTS2_BACC1       -
MUTS2_BACCN       -
MUTS2_GEOKA       -
MUTS2_GEOTN       -
MUTS2_BACHD       -
MUTS2_BACSK       -
MUTS2_OCEIH       -
MUTS2_LISMO       -
MUTS2_LISMF       -
MUTS2_LISW6       -
MUTS2_LISIN       -
MUTS2_ENTFA       -
MUTS2_STAEQ       -
MUTS2_STAES       -
MUTS2_STAHJ       -
MUTS2_STAAS       -
MUTS2_STAAW       -
MUTS2_STAAM       -
MUTS2_STAAN       -
MUTS2_STAAC       -
MUTS2_STAAR       -
MUTS2_CLOBL       -
MUTS2_CLOAB       -
MUTS2_CLOPE       -
MUTS2_CLOTE       -
MUTS2_CALS4       -
MUTS2_SYNY3       -
Q31CW4_PROM9      -
E6VWL5_PSEA9      -
Q30ZP5_DESAG      -
B8IZR6_DESDA      -
MUTS2_HELPY       -
MUTS2_HELPJ       -
D3UIQ5_HELM1      -
F8KP97_HELBC      -
D1AZR4_SULD5      -
A6Q4G0_NITSB      -
Q7M8Q5_WOLSU      -
D5V647_ARCNC      -
E4U1V6_SULKY      -
E6X2W5_NITSE      -
B9LA77_NAUPA      -
MUTS2_THET8       -
B7J6A5_ACIF2      -
MUTS2_BORBU       -
Q6MNH7_BDEBA      -
F2LUE2_HIPMA      -
E1X288_HALMS      -