CLUSTAL format seed alignment for MF_00093

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RF1_AGRFC         ------MAKLPVEKMRELERRFGEIEARMS-AGPA--ADVYVKLASEYSELEPVVKKIRD
RF1_SINMW         ------MAKLPVEKMRELERRFGEIEARMS-AGPS--ADVYVKLASEYSELQPVVSKIRA
RF1_BARBK         ------MVSLSQDRMKQIEKRFEIIESQMA-QNPN--AETYVKLASEYAELQQIVTPIRT
RF1_RUEPO         --------MIPEERLDQITQRFQYLEAAMA-DGAS--GSDIAALAKEYSDLRPVVEQIAA
RF1_RHOS5         --------MVPMDRLLQIVRRFEFLEARLS-AGAA--PAEIAALSREYAELKPVVAEIAA
RF1_CAUVC         -------MRLPQARLDQVLDRFREVEARMG-AATD--GAEIVKLSKEHAELRPVAEAVER
RF1_MARMM         -------MHAPEARLAQVIDRFDQVEARLG-AAGD--ADEIVKLSKEHAELKPVAEKANA
RF1_HYPNA         ------------MRLQQVIDRYEEVEARMG-ATSN--TNEIIALSKEHAELRPVVEKARA
RF1_SPHWW         ------MAGITSARIAQIEARRDELQALMA-RGDLP-SDQFVQLSKDYAEIEPVAQAAGE
RF1_ZYMMO         ------MIAISPDRLAAIIARREELQAEMA-RPDLD-SNRLVALSREYSEVEPVALAAEN
RF1_SPHAL         ------MTSVSARQIDAIIERHAALQARMA-TGDMA-PADFVAASKEFAELEPVATAARE
RF1_GLUDA         --------MGLDDRLDRIVARSEELQAALA-EGLV--GEAFAKASREYAELEPIVDRIGE
RF1_ACICJ         --------MTLEQKLDRIVLRAEELRAMLA-AGVD--GERFVAASRELAEIEPVEQQILL
RF1_BRADU         ------MSSLPEAKLDVLLAHHASLEAESL-GQLA--SERYVQITRELAEITPLIEAVKT
RF1_WOLTR         --------MDIENNLQDLKRKFNYIERKLE-NPTNLSQKEFINLSKEYSELRPIIKIINE
RF1_NEOSM         -------MDNLWGVLEEILNRHTYLADRLR-CPEAIASQEFSKLSKEYAELKPKVELIAR
RF1_RICTY         --------MSFSDNLVKILDKYENLGRKL---SSGIIGDEFVKASKEYAELEDIVVKIKE
RF1_MAGSA         --------MNLETQFDKVLYRHDEVRAQLS-SGEGMDSQTIQRLSKELSELDPVVTAVQA
RF1_FRAP2         ------MKDSIKAKLQSLIERHEEVSALLGEANVISDQNKFRDLSKEYSHLEPIVMAFKE
RF1_HAHCH         ------MKESIKLKLDLLKDRYEEVGALLSDPDIISVQEKFKELSKEYAELEPVVQCYQE
RF1_SACD2         ------MKASILEKLEHLAERFTEVGALMGDPDVISNQDKFRDLGREYAELEPVIKCYNE
RF1_MARMS         ------MKESIKLKLESLSDRYDELAALLGVAEVIMDQDLFRAYSKEYAELEPVVKCFNE
RF1_COXBU         ------MKPSLIEKLKTLTYRYSEIGGLLSDSTVINDQDRYRELGKEYAQLEPIVKCFQQ
RF1_NITOC         ------MKDSIRSKLETLAERQQELTALLAEPEIASAQKKFRELSQEYAQLEPVIGCFRD
RF1_ALKEH         ------MKASIRNKLERLRERHEEISALLAEPDTASDQKRFAALSREYAQLEPVIAELNH
RF1_HALHL         ------MKATIRNKLERMAERHEEIGAQLADPDVVGDPSKFAELSREYARLEPVVQDLNA
RF1_CHRSD         ------MKATLRTRLDGFQERFEELAALLAEPDVIADQARFRDYSREYAELEPLIEAWRS
RF1_PSEPF         ------MKASLLNKLDILQDRFEELTALLGDGEVISDQTKFRAYSKEYAELEPVVQGYKK
RF1_ECOLI         ------MKPSIVAKLEALHERHEEVQALLGDAQTIADQERFRALSREYAQLSDVSRCFTD
RF1_CROS8         ------MKPSIVAKLEALQERHEEVQALLGDAGTLADQERFRALSREYAQLSDVSRCFLE
RF1_SERP5         ------MKPSIVAKLEALQERHEEVQALLGDAGVIAEQDRFRALSREYAQLTDVSRCFLE
RF1_SODGM         ------MKSSIVAKLEALQERREEVEVLLGDPGVISDQIRFRALSKEYAQLSDVTRCFQH
RF1_HAEDU         ------MKASIIHKLDCLSERHEELQALLGDASVIADQDKFRAYSKEYAQLEEVVATFNR
RF1_SHESH         ------MKDSVIRKLEGLLERNEEVLALLSDPGVISDQERFRALSKEYSQLEDVVTSFKS
RF1_SHEFN         ------MKESVIRKLEGLLERNEEVLALLSDATVISDQDRFRGLSKEYSQLEDVVSSFKA
RF1_SHEAM         ------MKESVIRKLEGLLERNEEVLALLSDASIISDQDRFRALSKEYAQLEDVVKGFKA
RF1_COLP3         ------MKSSVYQKLEVLVERFEEVQALLSDPATISDQEKFRALSKEFKQLDAVTSVFNN
RF1_PSEA6         ------MKESVQRKLESLTERFEEVQALVSQPEIIADQDKYRALTKEYSQLEGVVKCFAD
RF1_PHOPR         ------MKSSILVKLETLVERYEEIQHLLGDPGIIGDQNKFRALSKEYSQLEDITQCFQA
RF1_AERS4         ------MNPSLIRKLEGLIERHEEVQAMLGEPGVASDQDRYRALTREYAQLEDIVHAFQR
RF1_VESOH         ------MNSSILAKLEQLSIRLEEVSIMLSDPEVVSNVKKFTKLSIEYAQLTPVNQQFQT
RF1_PSYWF         ------MKDSLRERLDQMVDRFEEVTALLSDPDTISDNNKFRELSMEHSELSEITALWQR
RF1_PSYCK         ------MKESLRLRLDQMVDRYEEVTALLSDPSVISDNNKFRELSVEHSDLMDITTLWQN
RF1_ACIAD         ------MKESLRLRLDQLCDRHEELTALLADAEVISDNKRFRKLSREHSDLNEIVDVWSK
RF1_THIDA         ------MKATLADKLARADERLEELDALLAQPEVAADMDSYRKLTREHAELSPVVGLYRQ
RF1_AZOSB         ------MKQSIRDKLEHLAGRLAELDRELSSEDATRDMNAFRDLSRERAELEPVVALYGA
RF1_NEIM0         ------MKPSILEKLQQLGDRLEEVTHLLGQPEATADMDNYRKLTREHAELTPVVEVFQN
RF1_CHRVO         ------MKASIAARLAQLADRLEEVTHLLASETATQDMEAFKKLTREHAELTPVVETFSA
RF1_DECAR         ------MKSSIRQKLELLVDRLDEIDRMLSAPSTASDMDQFRKLSRERAEVEPVVVQFNA
RF1_BORA1         ------MKSSMLGRLEQLAHRLIEVDALLADPDSAGDMDRFRRLSRERAELEPVVLAFNA
RF1_POLSJ         ------MKPFLRQTLDRQLLRLHELDSLLSATDVVSDLDRFRALTREHAEASVVAEQYTR
RF1_VEREI         ------MKPFLRSQLARHAQRLGELDFLLARPDIMADMVQYRSIAREHAEVTQVAGRYAR
RF1_XYLFT         ------MKPTLRRKLEALAERHEELERLLSDPKIASDTDRFRTYSRELAQLAPIATTLAE
RF1_BUCAI         ------MNNSILNKLKSLRNRYQEIEIMLTQKNVISNRENLKTLSKEYLKLSEIIKYFIE
RF1_BUCBP         ------MKSSMMKKLESLHRRYEEIESMLSDRTVISNQEKFRELSQEYLKLSDINYCFVQ
RF1_BUCCC         ------MKKSIVNKLKSLKKRYIQLEKLLSNNYSKFDKREFSKLSKEKANLYDLYKEFMS
RF1_BLOPB         ------MNSIIVNKLIALQERFNVLEKLLSKPNAIDDKKHFCTLAKEHARLSEIVVCFER
RF1_BLOFL         ------MHTILINKLMSLKQRFYKLEKSLNNFNTINNK-EFYSLSKEHTYLHEIIKYFEE
RF1_WIGBR         MKFSFEKNYALVQKLKKLKNRYKEIKIILSDPFSAKKQKNFFLLSKEYSKLNILNKYLKS
RF1_GEOMG         ----------MFDKIEELEIRYQELESLLAVPTVIANQPEFRKLSREHNDLTGLVEAYRR
RF1_PELPD         ----------MFDKIEELERRYQELEALLSDPAVISNQPEFRKLSREHADLTGLVAAYRR
RF1_ARCB4         ---------MLKDKLQPFINRFEEINQLLMSSEITSDIKRMTDLSKEQSSIQPIVSKAKE
RF1_CAMFF         ---------MLADKLRPFIDRYNELNSILSDPEVINDISRMTKLSKEQRNLESIKDATQR
RF1_HELHP         ---------MLIDKLKPIVARYDEISSLLSSESVLSNIKQLTELSKEQSDIESIAQNAKT
RF1_WOLSU         ---------MLISKLTPFIERFEEITRLLGTMEVISDIKRMTELSKEQSALEALVLKAKE
RF1_SULNB         ---------MFKEKLQPFIDRYNEISELLSSPDIASDINRMTELSKEQSGLAPLVEKANL
RF1_TREDE         ----------MKERLDNLRKRLVEVEKEVENPNLIKDVAKYKETMREHSYLSKLMEEYDN
RF1_TREPA         ----------MIEKLEELRAQWRKLQQEVENPSLFSSTQSYRERMRDHAYLSRLMEEYDR
RF1_CHLMU         ----------MEVKVLECLRRLEEVEKLISDPNIFSNPKEYSSLSKEHARLSEIKNAHES
F8L7A9_SIMNZ      ----------MEDKVKELLGRLPDLEAKLGDPKVTQDQKKYRELSQEHAYLSDLKEAWTD
RF1_PELLD         ----------MFDKLQSIKERHLDLERMLADPAAAGDQTRFRRLNKEYSDLKEIVQAYDR
RF1_CHLCH         ----------MLDKLQAIKEKHLDLEQALSDPSLANDQERFRKLNREYSNLREVVQAFDA
RF1_PORGI         -----MSENNLLDRLDGLESRFEEISTLITDPAVIADMKRFTKLSKEYRDLEKIHTAGRD
RF1_PARD8         -----MAENSLLGKLDGLVSRFEEVGTLITDPAVIADMKRFVKLNKEYRDLEKIVGARSE
RF1_SYNPW         -----MDPSTLISRLEAARSSFHNLERQLADPDVASDPTRLQSIARERSRLEPLVNDYAS
RF1_SYNS3         -----MDTTTLISRLEAASSSFHNLERQLADPDVAADPQRLETIARERSRLEPLVLDYTS
RF1_PROMM         -----MDSSTLITRLETAKTSFQSLERQLADPDVAADPKLLESIARERARLEPLVLDFEA
RF1_PROMA         -----MDTSTLKARLETASATFNNLELQLADPDVASDPKKLETIARERARLEPLVLDYKE
RF1_PROMP         -----MEYTTLIARLKNASESFVNLEMQLADPDIANNPKKLESIARERAKLEPLVLDFNQ
RF1_SYNY3         -----MAETYLLDKLASVEQTYQELTRMLADPDIATNPDELQRVAKARSSLEETVDTYET
RF1_SALRD         --------MIEREKLDKVKHRFQEVESLMADPEVANDPDRMRELGQEHSRLEEVVEAIDR
RF1_ACIC1         ----------MFEAVEEVLREYADLERRLADPAVHADPRTARTLGRRYAQLGPIVEAYRR
RF1_KINRD         ----------MFEAVTPLLDEHAELERRLADPAVHADAALARTLGRRYAELGAVVVAHAA
RF1_NOCSJ         ----------MFEAVEGMLAEHADLEQRLGAPETHADARLAKQLNQRYAALSSIIGAYRE
RF1_STRAW         ----------MFEAVEELIGEHADLEKKLADPSVHADQANARKLNKRYAELTPIVATYRS
RF1_FRACC         ----------MTSPLDGLIAEHAEIEGQLADPAVHNDPAKARALSRRYAQLAPVVDLARE
RF1_ARTS2         ----------MFESVQGLLDEHAAIQAQLGDPAVYADQKLARKLGRRSAQLNGIVEAYHR
RF1_CLAMS         ----------MFESVVQLLEEHEELQQQLGDPELHADASRSRKVNRRYAELSRIVAAHAE
RF1_BIFLO         ------MADEQFPAAATALEEYQSIEEQMASPEVVSNPDKLRKLGRRHAELGAIVGAYKA
RF1_COREF         -------MAGHVSAVDDILAEYHGLEEQMADPALHNDPAAARRVGKRYSELQPIINVHRQ
RF1_MYCLE         -------MAQPVQSIDVLLIEHAELELALADPELHSNPAEARKAGRRFARLAPIVATHRK
D6ZDA5_SEGRD      ----------MNSSLPELIAEYESLQKRWADPSLQDDVSAAKKIGKRVAELGPVYEAHTQ
RF1_RUBXD         ------MDEQVVKLAKETVARYRELTEELSDPAIFNDQRRYAEVAREHSRMRRGAELSER
RF1_DEIRA         --------MANMSRLNELVSEFGLVERRLGDPQALADGREYARLTRRHRELLPLVTLVRE
RF1_DEIDV         ----------MSGRLSELAAEFGMVERALGDPAALADPQAYTRLTRRHRELLPLVTLLRE
RF1_THET8         ----------MLDKLDRLEEEYRELEALLSDPEVLKDKGRYQSLSRRYAEMGEVIGLIRE
RF1_THEMA         -----------------MKEKKKEIEKLLARPDLT--PEQMKNYGMEYAKIEEIENITNR
RF1_CARHZ         ----------MFDKLDQLEEKYEELSRLISDPEVIADTQRWQGYVKAHAEIEEIVQVYRE
RF1_MOOTA         ----------MLEKLEQIEARYEELGRLMGDPEVIADPEQLQKHARAHAALEDIVTTFRR
RF1_CLOAB         ----------MLERLEFIESKYDELSVKISDPSVMANQSEWQKLCKEHSEVENIVLKYRE
RF1_CLONN         ----------MLDKLEFTENKYEELSIKISDPSVMANQNEWRKLCKEHAELETIVTKYRE
RF1_CLOPS         ---------MILDRLNFIENKYDELSVKISDPSIMANQKEWRKLCKEHADLEVIVNKYKE
RF1_CLOB8         ---------MLLDKLEFIENKYDELSVKISDPSIMQNQNEWRKLCKEHADLEVIVNSYRE
RF1_CLOK5         ----------MLERLNFIENKYEELSIKISDPTIIADQKKWQKLCKEHAELEEIVMKYRE
RF1_ALKOO         ----------MLDKLAFLEEKYEDLSEKISEPEIINDQPQWKKLVKEHSDLEEIVMKYRE
RF1_CLOD6         ----------MLKKLEVLEDTYKDLSEKIGDPDVINDQKVWQKYIKEHADLEPIVMKYRE
RF1_CALS4         ----------MIEKLQAIEDRYVELSQKISDPNVISNVEEWRKYVKEHAAIEDIVLKYRE
RF1_LAWIP         ----------MFAKLENLEQKFIEIECSLAQPNIFNDQEQYRKLTKTHSDLKPIVTTFQQ
RF1_SYNFM         ----------MFDRLESVAQKFRKLEEDLSNPELLANQKEYQKIAREHAEIAPIVEAYGL
RF1_KORVE         ----------MFERLDLMEAKYDELTQALASPEIVNDSAKYQKTAKAHAELTQLVQKYRE
RF1_SOLUE         --------MQFAQKLDQLEKRFDELTQQMADPAVISDADQYRKVAKAQSELSDIAAKYRE
RF1_SYMTH         ----------MKQKLEGVVQRYEDLTYKLGDPSVINNPTEYRQVAREHNRLGPIVEKFRA
RF1_CHLAA         ----------MFDKLAAVAARYDELTELMAQPEVATNVTLLQQYAREQREIEDIVNAYRE
RF1_FUSNN         --MINLRGVKMFDKLEEVVARYDELNKMLVSPEVLADSKKMIECNKAINEITEIVEKYKE
RF1_BDEBA         ----------MFSKLDAVESRYEEVNMALQRPDIASNQTQYRALMKELGNLEKIVLVYRD
RF1_MYXXA         ----------MIDKLEDVERRFERLTADLSNPDVLADSARLQKVSKERAGLEKLVEAFRT
RF1_BACP2         ----------MLDRLKSIEERYEKLNEYLSDPEVVNDPTKLREYSKEQSDIQETVEVYRQ
RF1_BACCN         ----------MLDRLQAVEDRYEKLNELLSDPAVINDSNKLREYSKEQSDIQETVEVYRE
RF1_BACHD         ----------MFERLQSLDERYERLNELLSDPEVISDSNKLREYSKEQADMEETVQVYRE
RF1_GEOTN         ----------MFDRLEAVEQRYEKLNELLMDPAVINDPKKLRDYSKEQADLTETVQTYRE
RF1_LISMO         ----------MYDRLQAVEDRYDELNELLSDPDVVSDPKRLRDLSKEQSGITATVETYRE
RF1_STAS1         ----------MFDQLDIVEERYEQLNEMLSDPDVVNNPDNLRKYSKEQAELQKTVDVYRD
RF1_LACS1         -------MDKLFDRLQMLEDRYEELGELLSDPDVISDTKRFTKLSKEMADLRETVEKYNK
RF1_LACSS         -------MDKMFEQLDGLLDRYAELQELMSDPEVINETSRYMELSKEEAGLREIVGKYTR
RF1_LACDA         -------MDNVMAQLESLEVRYEEIQEMMADPEVIADTKRYMEITKEEADMREVVQKFRK
RF1_LACLA         ----------MFDQLESIVGRYEELGELLSDPEVVSDTKRFMELSREEADLRDKVATYNE
RF1_MYCGE         ----MDFDKQLFFNVEKIVELTEQLEKDLN--KPNLSFEQIKVINKELKHKQPLIVKFKE
RF1_MYCGA         ----MEYNKQMYETLVAIRATAQKLNKELE--SLTNDFKRIHAINKELKQKKQLLEVFEL
F6FHF2_MYCHI      --MASEKNSSLYKTLATIHEKYVQLNKRLE--QETEG-KEIIQINKEIAKLEKISQGFIE
RF1_MYCMS         ------MNAKTYEALETMQKRLLQILKDLEDENILKDIKKFTELNKEKSNLEEVVEKFVE
RF1_MYCHJ         ------MEKKMFNSLMKIHQKYQDLKQLLETDQILNDQKQYLQIAKEIASISEIIEVFQK
RF1_PHYAS         ----------MLARLKKIQQKYQNLQQDLLQ---NQSISNKINIFKNLSKLEPIVELFQQ
RF1_ONYPE         ----------MLDRLKIIKQKYQDLQKLLLN---EQNINQKIDILKNLSKLEPTVELFNR
                                          :                                   

RF1_AGRFC         YEKAISEAADLEALLADKT--TDKDMRDLAEMELPEVETRI-RELEKDMQVLLLPKDAAD
RF1_SINMW         YEKATAELADIGAMLADRA--TDKDMRDLAELEKPEIEERV-EALEQEIQILLLPKDAAD
RF1_BARBK         LNALYKEVTELEAMANTTQ--IDADMYALAQEELVLLRQKI-EQLEQEIQILLLPKDIAD
RF1_RUEPO         WRQLCADMDEARAMLS------DPDMKALAEEELPLLKARL-PEAEQALQLALLPKDAAD
RF1_RHOS5         YRTALEDLAEAEAMLA------DPEMRALAEDELPRLRARI-PEMEQALRLALLPRDAAD
RF1_CAUVC         LAKLSAERAELDVMAS------DPEMAEMVRDEIQALDEKL-PVMERELALMLAPKDKDE
RF1_MARMM         LKSARAELAELAEMMEGD----DAEMAEMAREEFYALKERL-PELEHAMSLMLLPKDKDD
RF1_HYPNA         LMTVRKGLSEAEAMIASG----DREMAELAEMEIDDLRERL-PGLEQEMQLLLLPKDVDD
RF1_SPHWW         VRRLRAELDVLKGMAEDEA--GDAELRAMAIEEAEEIRARL-PEAERALALKLLPRDAAD
RF1_ZYMMO         VGRLREEGETLEAMTKDD----DPELQAMAVEELEANKTAL-AEAERALALSLLPRDAAD
RF1_SPHAL         VVRLREELVALNEMLADP------EMKAMAVEEIAAVEAAL-PAAEHDLALQLLPKDVAD
RF1_GLUDA         LRLAEQEERQSQALLADP------EMRELAEAELEDLRARI-PVLRQDIRIAMLPRDEAD
RF1_ACICJ         LRAAERARDEAEAARADP------ELRELADAELDSLRETL-PRLEHEIRLALLPRDAAD
RF1_BRADU         YRSAVKELADTEALIADPA--TDAEMRGMAEAERDELAPRI-EDLVQKIRVALLPKDAMD
RF1_WOLTR         YDTLKKEILDLEEIIKDEN--SEYDIKELAKEEFFEKQKVLLPQVKAKLKLALLPKDEDD
RF1_NEOSM         YKKLKEEQAYLELLVKNPL--EDQEIREIGKSDLQAIQDVI-PKLELEIKRMLLPKDKDD
RF1_RICTY         YNKVKSELEEANNLRLEVA--LDNATLEMINNEIYILENLL-PKLERAVRISLLPKDEAD
RF1_MAGSA         FRKAREDMVQAAEMMNDP------DMKDLAEEEFYALKERL-PALEREVQIMLLPKDEAD
RF1_FRAP2         YTQALEDKEAAYEMLNE----KDAELVEMAKEELKSANESI-ERLEDELQILLLPRDPND
RF1_HAHCH         YQNALNAIEESKLLLND----SDADMREMAKEELAAAEESS-EQLEKDLQILLLPRDPRD
RF1_SACD2         YNTVLGNIAEAKVLISD----SDPDMRAMGQDELKENEAAL-EPLELELQKLLLPKDPND
RF1_MARMS         FQQIDENIAEAELMMTD----ADPDIKEMGVEEYKAGLAQK-EELQLVLQKLLLPKDPND
RF1_COXBU         FQQNEKAIESAEEMQQE----KDPELRKLAEEELEQLTLKK-EELEDQLKLLLVPKDPND
RF1_NITOC         FEQAQSVLNESKALLQD----QDPELRVLAQEEIAAAEKKL-ERLDRELHTLLLPSDPND
RF1_ALKEH         YQETEQALASAREMARD----DDLEIREMAEEEISQAQARL-EALEAELQVLLLPPDPND
RF1_HALHL         YRAEADTVASAEAMLND----GDAEIRALAEQELAEAQRRL-EELEGALQRHLVPTDPND
RF1_CHRSD         YRRTEDDLEAAEQMRED----SDPEMRELAEEEWREAQARL-EALDADVKRLLVPRDPDD
RF1_PSEPF         LLGVQGDLEGAQALLKD----SDPDMREMAVEEVREAKELL-ITLESDLQRMLLPKDPND
RF1_ECOLI         WQQVQEDIETAQMMLD------DPEMREMAQDELREAKEKS-EQLEQQLQVLLLPKDPDD
RF1_CROS8         WRQVQEDMETARLMLS------DPEMRDMAQDELLEAKAKS-EALEQELQLLLLPKDPDD
RF1_SERP5         WRKVQDDLATAEMMLD------DPEMREMAQEELKDAKAAT-EELEQQLQVLLLPKDPDD
RF1_SODGM         WWQVQEDIHTAEHLLQ------DPEMRDMAQEELLASGASL-EQLEQQLQVLLLPRDPDD
RF1_HAEDU         WKKLNSDIEEAELLLD------DPDMKEMATEEITQNKAEI-ECLEQHLQILLLPKDPND
RF1_SHESH         FQQATEDLEAAKEMASD----DDPELKEMAQEEMKEAKSLL-EKLEDELQILLLPKDPND
RF1_SHEFN         FQQAQKDFDYAKEMLEE----DDLEMREMAQDEYKQSKQVL-EKLEDELQVLLLPTDPND
RF1_SHEAM         YQQAVADLETAKEMLEE----DDPELKEMAQEEIKSAKASL-ERLEAELQILLLPKDPND
RF1_COLP3         YKSAEDDFSTAELMLKD----DDPDMREMAQEEFKDAKKAV-ADIADELQILLLPRDPND
RF1_PSEA6         YQGAQGDFESAQEMMQE----SDPEMREMAQEEYKSSKQAI-EQYEDELQILLLPKDPND
RF1_PHOPR         YLGAKDDLEAAEEMAKD----DDPEMREMAQEEVKESKANI-LRLEDELQVLLIPKDPND
RF1_AERS4         FRQAEENLEATKLMLEE----DDADLREMAQEELPLAKSTL-EEQEQALQVMLLPRDPKD
RF1_VESOH         YLSHLKNLEDAQLILFE----DDMEIKTMAKEEILNTKKIL-SQLDLKLKKSILPKDPND
RF1_PSYWF         YRQAEIDKKDAQEMINDA---SDPDMKEMMQEEIDSASRDI-EAMEEELNVMMLPKDPND
RF1_PSYCK         YVGAEKDQADAEAMLKEA---SDPDMKEMMQEEIDSARDTI-VEMEEALNLMMLPKDPND
RF1_ACIAD         YRQAEEDIETAESML------SDPDFKDMAQEEIKENRALI-EQLEGDLNILMIPKDPND
RF1_THIDA         YKQVEADQKTAQEMLA------DADMRELAEAELADGAARI-TELENELQTALLPRDPND
RF1_AZOSB         YRQAEQDCATARELLD------DPEMQELGRSELEAGEARI-AALDGDLQRALLPRDPND
RF1_NEIM0         YRLAQSDLADAEEMLS------DPEMKDFAAEEIEAAKAKI-GALDTELQKLLLPKDADD
RF1_CHRVO         YRQCEGDIAAAEDMLA------DPEMKEFAQAEIAEGKDKL-EALDLELQKLLLPKDPND
RF1_DECAR         FRQAENDLAEAEAMLS------DPDMREFAEEEMAAAKARL-PELELELQKLLLPKDPND
RF1_BORA1         FQSTQADLATAQEMLA------DPEMKAMAEEEIKAARERI-EVLEGELQVLLLPRDPND
RF1_POLSJ         LTSREADLASAEGMLAEAK--DDPEMAAMAEEEIAAAKLDI-AQLDEALQLMLIPKDPDD
RF1_VEREI         YLQREADLGAARELLA------DPGMAELAQEEIDSSQTEL-RQLEDELQRLLLPKEPDD
RF1_XYLFT         ETRTKADLAAAETLRT------DPEMRELAEQEIAIAQAHL-TTLDEQLQRLLIPQDPRD
RF1_BUCAI         WEKLEVDIENVNILLN------DVEIQGMAEEELYFFNKKK-KALEKKINQLLLPEDPND
RF1_BUCBP         WKNCNHDVIETKLLLL------DSELHDVAEQELQMLSKKM-KKIETEIQVLLLPCDPND
RF1_BUCCC         WLSIKSEIKDIQLLLN------DLDLSTLAQEELLIALKRK-KEIEKKIKMLLIPIDPYD
RF1_BLOPB         WLDIKQEIINTKKLLE------DVDMHDIAQDELKTFYLNR-NNIEKNLKILLLPTDSND
RF1_BLOFL         WLNIQKNIVHTKDMLS------DIDMHDIVQDELKILNTSK-HNLENKIKILLFS-DPQD
RF1_WIGBR         LESINNTIESTKTMLL------DPEMHDLAKNEINIYKNKK-KLIEKKIILYLIPNEDEY
RF1_GEOMG         YKKVLAEIEGNRELLA------DPEMKEMAEAELEDLERQQ-EELEGEIKLLLLPKDPND
RF1_PELPD         YRRVLEEMEGNRELLA------DVDMKEMAEEELKVLEEEK-ERLEGEIQMLLLPRDPND
RF1_ARCB4         YIKVLEDIEENKLMLD------DPELGDLAKEELKELETRK-PELEEEIKVLMIPKDPND
RF1_CAMFF         YLSILNGIEENKTLLE------DPELGELAKDELKALETEL-PKLEEEIKLLLLPKDPND
RF1_HELHP         YFSILENIVQNKALLE------DKELGELAKEELKDLESAK-ATLEEEIKLLLIPKDPND
RF1_WOLSU         YLQTHRSIQENRALFE------DKELGDLAKEENKLLEESL-ESLESEIKLLLIPKDPND
RF1_SULNB         YIETADAIAENKELLS------DEELGDLAKEELSELEPML-PKLEEEIKILMIPKDKND
RF1_TREDE         YLSIEKQIEDSKLLIQEE---SDAELKEMAREELHSLEAAF-EKSEADLKMLLIPPDPLE
RF1_TREPA         YLLTEKQLEDAHVLIQDE---SDADFKDVIRQEIRTLEAAL-HTSQKRLKTLLIPPDSLQ
RF1_CHLMU         ILAAKKILHDDKLALSTE---KDPEMIAMLEEGIQGGEESL-ERLSKQLENLLIPPDPDD
F8L7A9_SIMNZ      FVKQSKDLKDNRDLLKEE---TDPEFVQVVQDDIAKLETAV-QNSRSRIESLLVPPDPND
RF1_PELLD         YASARQQLEESRHMQK--A-EEDPEMKAMAREEMLELEERI-PGLEQELRILLLPKDEAD
RF1_CHLCH         YQRKATELEAAQHLLA--T-ESDTEMKALAEAEVDELQETV-AELEQGLKILLLPKEEAD
RF1_PORGI         YRNLLANIEEAKHTMA--K-ESDEELREMAREMLAEANERL-PILEEEIKMLLIPANPED
RF1_PARD8         YVKVLNGIEEAKALLE--S-EQDPEMREMAREELDTCNERI-PALEEEIKLLLVPADPQD
RF1_SYNPW         LQAVQSEREQARELLRD-S-RGDEEMAHLAQLELDELDIRH-EALIERLTLALLPRDPRD
RF1_SYNS3         LQKVEAEQVQAKSLLKE-S-RGDAAMEELAQQELQELDRHH-ADLIQRITLALLPKDPRD
RF1_PROMM         LQHVEQEWQETKQLLRE-S-RGDDAMESLAQEELQQLEARK-TVLVRRLTLALLPSDPRD
RF1_PROMA         LQAIDLEYKEAKELLRQ-S-KSDKEMEALAQEELIRLEELE-KDLVNRLTLALLPKDPRD
RF1_PROMP         LLDTDKEIGDSKQLLKE-N-RNDKDMESLINEELFSLEDLK-NQLIEKLTIALLPKDPRD
RF1_SYNY3         WKRSQEDLKGARQIVKE-S-GNDPEMREMAQLEVEELENAI-GELEKRLTILLLPKDPND
RF1_SALRD         YERLLDERDELEGMIR----DESGEMEALAKEELEQLETKL-PAVEEDLKQKLIPKDPEE
RF1_ACIC1         WKALDADVAAAHEL--------AAADPAFR-AEIPALEAER-EAVAERLRSLLAPADPND
RF1_KINRD         WRAAADDAEAAREL--------AAEDAAFA-AELPALQRAA-EEAGEKLRRLLLPRDPDD
RF1_NOCSJ         LQQLDDDIEAAREL--------AQEDPAFA-EEAAALTGRR-QEVEERLRRLLVPRDAAD
RF1_STRAW         WKQTGDDIETAKEF--------VADDPDFA-AEVKDLEKQR-EELTEKLRLLLVPRDPSD
RF1_FRACC         LDRVEGDLAAAREL--------ALLDPSFR-DEVQDLGEEL-ARLNDRLRAYLVPIDPDD
RF1_ARTS2         WESIRDDLAAAKEM--------ADEDPEFA-AEVPELEASL-ETAAAKLRRLLIPRDPDD
RF1_CLAMS         WTQLGDDLAAAREL--------AEEDPAFV-DEIPGLEEQL-DQAQEKLRRLLIPRDPDD
RF1_BIFLO         WLQVKDDLAAAQEM--------AGEDADFA-EEAKRLEDEL-PGVEEKLRTALIPRDPDD
RF1_COREF         LVQVRDDLEAAREM--------AHEDHEFA-AEAERLEVEL-VELEEKLADLLAPRDEHD
RF1_MYCLE         LISARDDLQTAREL--------AAGDESFA-DEIAELESRI-AELTTQLTDMLAPHDPHG
D6ZDA5_SEGRD      REAARADLAAAHEL--------AELDPEFGREEVERLTGRI-HELDAALAELLAPRDPHD
RF1_RUBXD         FLEALREEREARELIPAAE---SAEEREFFAGEAREAGRRA-GELAEEIRSELIDRDPND
RF1_DEIRA         REQAEADLSGARELLQDPD-MRDPDMKELAQLEVGGLQARL-AEIEAELEVLLLPTDPDD
RF1_DEIDV         REALESDLRGAQELLSDP------DMRELAQNEITEATARL-EQLGAELEVLLLPTDPDD
RF1_THET8         YRKVLEDLEQAESLLDDP------ELKEMAKAEREALLARK-EALEKELERHLLPKDPMD
RF1_THEMA         IKETQEFIELLREE----------------GENELEIEKYE-KELDQLYQELLFLLSPEA
RF1_CARHZ         YKKTVKEIEDAERMLDEKL---DPDFRELVQSELHDLKERR-EELEAKLKILLLPKDPND
RF1_MOOTA         YRQVSNELAEDKAMLEEEK---DREFQELLKAEIERLTGEQ-ERLEQELKILLLPKDPND
RF1_CLOAB         YKKAKEDLEADKEMLRDKI---DAELKEMVEEEIKELEKSV-VDYEEELRVMLLPKDPND
RF1_CLONN         YKTNKEELEANKEMLSEET---DKDMKEMIQEEIKTLEESI-VKDQEELKILLLPKDPND
RF1_CLOPS         YKEATEELEANKEMLSEES---DQEMREMINSEIKDLTERK-KELEDEIQILLLPKDPND
RF1_CLOB8         YKKVVEDLKANKEMLSGES---DKEMREMLNEEITDLTNRE-EQLETEIQILLLPKDPND
RF1_CLOK5         YKEALQDLEDNKEMLREET---DKDMREMEQEEIKRLGDII-EKREDELKILLLPKDPND
RF1_ALKOO         YKKTEQGLNDAKEILRDKTA--DEEFREMAKMEIAELEEKI-EVLEGELKILLLPKDPND
RF1_CLOD6         YKSVLDSIKESKEILQEES---DEELRELAKMELAEMEEKV-APLEEEIKILLLPKDPND
RF1_CALS4         YKKVLEEIKATEELLSSQD----EELKEMAEEELSQLEEKK-EKLMEEIKILLLPKDPND
RF1_LAWIP         FKKLQQQLSENKELI-SDI---DPDIQEMALEEIKKLELEL-THLEYELKILLLPKDPLD
RF1_SYNFM         YKGLHRQLLDNQQLLEQET---DPEMRELFRQEIAELKRQI-EDTENGLKLMLAPRDPND
RF1_KORVE         YKDLTRGIKDSRQMVAEET---DAEMKAYAQQELTELEQRL-HAVEEDLKVLLLPRDPND
RF1_SOLUE         WKKVEDGLAQARPMLQEQ----DAELKEMAELEIAQLEPEK-LRIEEELRVLLLPKDPND
RF1_SYMTH         YQKTERELDDVLEMLEGPL---DPEERALFNQELRDLKEKL-QTLSDELRILLLPRDPND
RF1_CHLAA         YQATQRAIEEAEAMLEDS----DPELRALAQEELETQRKRL-ASLEEQLKLLLLPRDPND
RF1_FUSNN         YKKYVDDIEFIKESFKTEK---DSDMKEMLNEELKEAEEKL-PKLEEELKILLLPKDKND
RF1_BDEBA         YRKKTENLKASKELLTAEQ---DAEMRELIREEVKELEAEL-PDLEQQLKIALIPKDPND
RF1_MYXXA         YRKVLADLSEVEAWLGS-S---DADEKAFARESLPGLKEQR-DELEASLKILLLPKDPND
RF1_BACP2         YRAAYDQLSEAKAMLEDK---LDAEMRDMVKEEISELTEET-ERLEDELKILLIPKDPND
RF1_BACCN         YKDVREQLQDAKAMLEDK---LDAEMREMVKEEVSDLEVQE-KELSDRLKILLVPKDPND
RF1_BACHD         YKTVMDQYQDAKEMLEDK---LDDEMYAMVKEEIDELATRK-EDLEAKLKVLLLPKDPND
RF1_GEOTN         YKSVRSQLAEAKAMLEEK---LEPELREMVKEEIDELEERE-EALVEKLKVLLLPKDPND
RF1_LISMO         YKNVNEQINETKELLGEK---LDDEMREMAKEEFAELQKEK-TDLEERLKLLLVPKDPND
RF1_STAS1         YKQTKEDISEVEEMLRDT---KDNDEIEMLKEEHQTLQNKV-PKLEEELKFLLIPKDPND
RF1_LACS1         YKEVTQQISDDEEMLSDG---LDDEMASLVKEELSNAKNEK-VKLEEEIKILLLPKDPND
RF1_LACSS         LKEVLSEVTENEELLRET---TDSEMTELVKADLEELQTEK-AQLEQEIKILMLPTDPND
RF1_LACDA         FKADKEEIAGNKEIIADG---SDPELVEMAKMENSELEDEI-SQLEDEIKILMLPKDPND
RF1_LACLA         YKKVLETISDSEEMLGEGG--LDDDMKEMLKEELSSAKSQK-ELLEEEIKILLLPKDPND
RF1_MYCGE         LQKLVENANEAEQILNNS---SLKELHEEAKKELEKIKASL-PSLEEEIKFLLLPVDENN
RF1_MYCGA         YDKLVVSGLEAEKIINDN---AMKEFHELAILDLDAAKEQI-PDLEEKLKVLLLPADPND
F6FHF2_MYCHI      YKRELENLDECLEIIKKE---SNPEFVKLAQSELEAGKRRI-PELENSLKRLLIPTDPMD
RF1_MYCMS         YKKAVEHIKDAKAILENE---KDQELIELAKIELDENNDKV-EHLQQVIEEMLLPKDPND
RF1_MYCHJ         FLDDQKVLEDAKTILIQE---DDPELIQLAKVEIATMSKNI-EEYEKKLLILMLPKDKND
RF1_PHYAS         YLTLEEQLTNITKALNQDQ-IEDKEILELAQKEKETLSQQK-KVLWNQLRILLLPQDPED
RF1_ONYPE         YLNLETEFTQIQTILKTQ---QDQELLLLAHQEKDTILSEK-KTTLDQLKILLLPQDPFD
                                                                      :   .   

RF1_AGRFC         EKSAILEIRAGTGGSEAALFAGDLFRMYERFAATKGWKVEVLSASEGE-AGGYKEIIATI
RF1_SINMW         EKSAILEIRAGTGGSEAALFAGDLFRMYERYAAGKGWRVEVLSASEGE-AGGYKEIIATV
RF1_BARBK         EKSAIIEIRAGTGGSEAALFAGDLFRMYERYANAHKWKVEVVSLSDSE-VGGYKEIIATI
RF1_RUEPO         ARPAMLEIRPGTGGDEAALFAGDLLRMYQRYAEARGWKLELIELQETE-LGGIKEVVARI
RF1_RHOS5         ARPAILEIRPGTGGEEAALFAGDLLRMYQRYAEAQGWRFELLDLAPSE-LGGIREATARI
RF1_CAUVC         NASAILEVRAGTGGDEAALFAGDLFRMYQRYAQTQGWRVEIDSISEGE-MGGFKEIVASI
RF1_MARMM         SANAMIEIRAGTGGDEAAIFAGNLYGMYQRYAQLQGWSWELVSASEGE-HGGYKEVVAAI
RF1_HYPNA         KADIVLEVRAGTGGDEAALFAGDLFRMYTRFAQIMGWSVEIVDVAPGD-AGGYKEIIANV
RF1_SPHWW         ERSAMLEIRAGTGGDEAALFAGDLFRMYQRYAEDRGWRVELISASAAD-LGGYKEVVASV
RF1_ZYMMO         ERSAILEIRAGTGGDEAALFGGDLLRMYSRYAEEHGWRVEMISASAAE-LGGYKEVVISI
RF1_SPHAL         SRAAMLEIRAGTGGDEAALFAGDLLRMYSRYADTQGWKVEIISANEAE-VGGYKEVVASV
RF1_GLUDA         ERSAILEIRPAAGGDEAALFAAELFDAYRRYAALRGWRFEIMEFDESE-LGGLREGIANI
RF1_ACICJ         ERPAILEIRPAAGGDEAALFAAELFAAYRRYADLRGWRFEILDYTETE-LGGLREGIAEI
RF1_BRADU         DRNVVLEIRAGTGGDEASLFAGDLFRMYERFASLQGWKVEVISASEGT-VGGYKEIIAEV
RF1_WOLTR         SRNAILEIRAGTGGEEAALFAAMLFRMYQKYAERRNWKFEPISISSTG-IGGYKEASALI
RF1_NEOSM         ALNVMLEVRAGTGGDEAALFAASLFHMYQKYAERMKWRFEIISISHNE-IGGYKEANASI
RF1_RICTY         SKSAIIEVRAGSGGEEAALFAAVLFNMYQRYAEFKGWRFEILAISNTG-IGGYKEASASI
RF1_MAGSA         EKNAIIEVRAGTGGEEAALFAAELFRMYERYAGLHGWRFEVMDVNDTG-IGGVKEASATI
RF1_FRAP2         DANIFLEIRAGTGGDEASIFSGDLFKMYSKYAEQRGWKIEVVSASEGE-HGGYKEIISRI
RF1_HAHCH         GSNVFLEIRAGTGGDEAAIFAGDLFRMYSRYAELKKWKVEIVSESPGE-HGGYKEVISRV
RF1_SACD2         GKNVFLEIRAGTGGDEAAIFSGDLFRMYSRYAESKGWKVEIISENQGE-HGGYKEIITRV
RF1_MARMS         SRNVFLEVRAGTGGDEASIFSGDLFRMYSRYAETQRWKVEIVSASDGE-HGGYKEVIARI
RF1_COXBU         ERNVFLEIRAGTGGNEAAIFAGDLFRMYARYAETKGWRVNIVSAHEGE-HGGFKEVIARV
RF1_NITOC         KRNIFLEIRAGTGGDEAALFASDLLRMYLRYAEQRGWRTEIMGDSPGE-HGGHKEIIVRI
RF1_ALKEH         GRNLYLEIRAGTGGDEAALFAGDLLRMYARYAERHGWRLEEISASEGE-QGGYKEVITRI
RF1_HALHL         QRNIFLEVRAGAGGDEAALFAGDLLRMYMRYAERQGWKTEILSAREGE-HGGYREVIARV
RF1_CHRSD         ASNVFLEIRAGTGGDEAALFAGDLFRMYSRYAEKVGWRIEVINASHGE-QGGYKELIARV
RF1_PSEPF         GRNVFLEIRAGTGGDEAAIFSGDLFRMYSRYAERRGWRVEILSENEGE-HGGYKEVIARI
RF1_ECOLI         ERNAFLEVRAGTGGDEAALFAGDLFRMYSRYAEARRWRVEIMSASEGE-HGGYKEIIAKI
RF1_CROS8         ERNAFVEVRAGTGGDEAALFAGDLFRMYSRYAESRRWRVEIMSASEGE-HGGYKEVIAKI
RF1_SERP5         ERDCFLEVRAGTGGDEAAIFAGDLFRMYSRYAETRRWRVEIMSANEGE-HGGYKEVIAKV
RF1_SODGM         ERGCFLEVRAGTGGDEAALFAGDLFRMYSRYAETRRWKVEIVSASYGE-HGGFKEVIAKV
RF1_HAEDU         EYNAFLEIRAGTGGDEAGIFAGDLYRMYSRYAESKRWRIEEMSANESE-QGGYKEIIVKI
RF1_SHESH         DNNCFIEIRAGAGGDEAAIFAGDLFRMYSKYVESKRWQLEVMNTNEGE-HGGFKEVIAKV
RF1_SHEFN         DTNAFLEIRAGAGGDEAAIFAGDLYRMYSRYCEANRWQMEVMNVNEGE-HGGFKEIIVKI
RF1_SHEAM         EANAFVEIRAGAGGDEAAIFAGDLFRMYSRYAETQRWQVEIMSANEGE-HGGYKEVIARF
RF1_COLP3         DNNCFVEIRAGAGGDEAAIFAGDLFRMYSRYAEKKGWKIEVMNSNESE-QGGYKELIMKV
RF1_PSEA6         ESNCFIEIRAGAGGDEAAIFAGDLFRMYSRYAEARRWKVEVVTMNEGD-HGGYKEVIANI
RF1_PHOPR         DRNCFVEIRAGAGGDEAGIFAGDLFRMYSRYAERRGWRIEVINENRSE-QGGYKEMIAKV
RF1_AERS4         DNNCYLEIRAGAGGDEAAIFAGDLFRMYSRYAERQGWRISIVSCNDGE-HGGYKEVIAKV
RF1_VESOH         SRNIIIEIRAGTGGDEASIFSGDLFKIYSRYSEKQKWTIEIISSSIGE-HGGFKEIIARI
RF1_PSYWF         KVPAFLEIRAGTGGDEAAIFSGDLFRMYERYASSQGWTIEVLSANEGE-HGGYKEIISRV
RF1_PSYCK         KVPAFLEIRAGTGGDEAAIFSGDLFRMYQKFAQNQGWTLEILSANEGE-HGGYKEIITRV
RF1_ACIAD         ANAAYLEVRAGTGGDEAAIFSGDLFRMYSKYAESRGWRIEVLSENEGE-HGGYKEVICRV
RF1_THIDA         ERNIFLEIRAGTGGDESALFAGNLLRMYTRYAERQRWKVEIVSESPGE-VGGYKEVIVRI
RF1_AZOSB         ERNLFLEIRAGTGGDEAALFAGDLLRMYSRYAERQRWRVEIVSSNPSD-LGGYKEVIARI
RF1_NEIM0         DKNIFIEVRAGTGGDEAALFAGDLLRMYSRYAERNRWQVEIVSANESE-LGGYKEVIARI
RF1_CHRVO         DKNIFLEIRAGTGGDEAALFAADLLRMYTRYAERNRWQVEIVSASESD-LGGYKEVIVRL
RF1_DECAR         ERSVLLEIRAGTGGDESALFAGSLFRMYSRFAERQRWQVEVMSASESE-LGGYREIICRI
RF1_BORA1         GRSLFLEIRAGTGGDESALFSGDLLRMYSRYAESQGWRVEIMSESPSE-LGGYKEVIARI
RF1_POLSJ         ARAAFIEIRAGTGGDESALFAGDLFRMYTRFAERNRWQVEIISESPSE-LGGYKEVVLRM
RF1_VEREI         ARNAFVEIRAGTGGDESALFAGDLTRMYTRYAARRGWQVQVLSENPAE-LGGYKEIVLRI
RF1_XYLFT         ECNLFLEVRAGTGGDEAAIFAGNLFRMYTRYAERQRWKVEVESDTPGE-HGGYKEIIARI
RF1_BUCAI         KHSCFIEIRSATGGDESSIFAGELFRMYLRYAESYSWKVEIMNTSESE-KGGFKEIIAKI
RF1_BUCBP         QQNCFLEIRSASGGDEAAIFSGDLFRMYIKYSEFQNWKTNIIHMTHSL-KGGYKDIIVKI
RF1_BUCCC         KNSCFIEIRAATGGHEAAIFSGDLCKMYMKYADFKSWKVDIINMHEGE-KGGYKEIILKV
RF1_BLOPB         KLGCFIELRAGTGGKEAAIFTGELFRMYVRYSEVRRWKMEIINATYGE-CGGYKEIIAKI
RF1_BLOFL         QYNCFIELRAGTGGKEAAIFAGELFRMYSRYIEMQRWNMEIIHATYGE-CGGYKEIIIKV
RF1_WIGBR         ICNCFIEIRSGTGGKEASLFVRDLCRMYIKYSEIKNWKTDIINYSNSE-HGGYKEVIIKI
RF1_GEOMG         DRNVILEIRAGTGGDESALFAGDLFRMYSRFAERNRWKVEVMSASESE-RGGFKEVVALI
RF1_PELPD         DKSVILEIRAGTGGDESALFAGDLFRMYSRFADVNRWKVETISASESE-RGGFKEIIASV
RF1_ARCB4         DRNIYLELRAGTGGDEAAIFVGDLFRAYLRYAENNGWKVEIMSSSDSE-SGGYKEIVILV
RF1_CAMFF         EKNIFLELRAGTGGDEAALFVGDLATAYIRYTEERGYKYEIVSSSEGS-AGGYKELILLI
RF1_HELHP         NKNIYLEIRAGTGGDEAGIFVGDLFKAYCRYADLQKWKVEIISSNENN-VGGYKEVIALV
RF1_WOLSU         DKNIYLEIRAGTGGDEAGIFVGDLFKSYCRYADLKGWKVEIISSSENS-VGGYKEVIALI
RF1_SULNB         DKNIFLELRAGAGGDESALFVADVFRMYSRYAEQMGWKVEIVSTNDGT-AGGYKELIAEI
RF1_TREDE         EKNIIMEIRGGTGGDEAALFAADLFRMYTHYAEMKNWKYEVLSLNETE-LGGYKEITFSI
RF1_TREPA         EKNIIMEIRGGTGGDEAALFAADLFRMYTHYAESKQWRYEVLAVSETE-LGGFKEITFSI
RF1_CHLMU         DLSVIMELRAGTGGDEAALFVGDCVRMYHLYASIKGWQCEVLSASESD-LGGYKEYIMGV
F8L7A9_SIMNZ      HANVIMELRAGTGGDEAAIFVGDCLRMYRLFADHMGWKYETLSCTDSE-VGGYKEYILSL
RF1_PELLD         SRNVIMEIRAGTGGEEAALFAADLMRMYQRYAERQGWRCEVLDYNESSGPGGFREVTLTI
RF1_CHLCH         SRNVIIEIRAGTGGDEASLFAADLTRMYQRYAEQKGWQYKVLDYNESSVPGGFKEMILEI
RF1_PORGI         DKNAIVEIRGGTGGDEAALFAGDLYRMYVKYCESKGWQVEVTDLSEGA-TGGYKEIVFSV
RF1_PARD8         DKNAIVEIRGGTGGDEAALFAGDLYRMYVKYCELKGWKISVSSFSEGS-SGGFKEIIFTV
RF1_SYNPW         ERSVMLEIRAGAGGDEACLWAGDLARMYERFSSRRGWTVQPVSASEAD-LGGFKELILSV
RF1_SYNS3         ERSVMLEIRAGAGGDEACLWAGDLARMYERFSSRRGWSVTPVSANEAD-LGGYKELILSV
RF1_PROMM         QRSVMLEIRAGAGGNEACLWAGDLARMYERYGQRIGWSVQPLSATEAD-LGGFRELILSI
RF1_PROMA         ERSVMLEIRAGAGGDEACIWAGDLARMYERYGLKVGWVVKAMSATEAD-LGGFRELIISV
RF1_PROMP         ERSVMLEIRAGAGGNEACIWAGDLARMYERYGQKIGWTVKPISASESD-MGGFKELVISV
RF1_SYNY3         EKNIMLEIRAGTGGDEASIWAGDLVRMYTRYAESQGWKVSLLSESLAD-MGGFKEAILEV
RF1_SALRD         EKNAIVEIRAGAGGDEASLFAGDLFRLYTQYAKQQGWTYELIDASPGT-QGGFREVIFAV
RF1_ACIC1         GKDVIMQIKAGEGGEESALFAGDLLRMYLRYAERRGWKTEILDATESD-LGGYKDVTVAI
RF1_KINRD         SRDVILEIKAGEGGEESALFAGDLLRMYLRYAERHGWVTEVLDANPSD-LGGYKDVSVAV
RF1_NOCSJ         DKDAILEVKSGEGGEESALFAGDLLRMYTRYAEARGWKVEVLDAAESD-LGGYKSVTVAV
RF1_STRAW         DKDVILEIKAGAGGDESALFAGDLLRMYLRYAERVGWKTEIIDSTESE-LGGYKDVQVAV
RF1_FRACC         ARDAILEVKAGAGGEESALFAGDLLRMYLRYAERRGWKTEILDANPSD-LGGYRDVSVAV
RF1_ARTS2         ARNVILEVKGGEGGDEAALFAADLLRMYSRYAESRGWKTELISATESD-LGGYKDVQMAV
RF1_CLAMS         ARDVIMEIKMGEGGAESALFAADLLRMYLHYAESRRWKTEVLSQTQSD-LGGYKDVQVAI
RF1_BIFLO         ARDTIMEIKAGTGGEEAALFAGDLLRMYTRYAEKRGWSVNVQSENTTE-LGGVKDVQIAI
RF1_COREF         GDDIVMEIKAGAGGEEAALFAGDLLRMYQKYADKHGFIIEVLDSAESD-LGGVKDITLSI
RF1_MYCLE         PDDIVLEVKSGEGGEESALFAADLARMYIRYAERHGWTVTVLDETTSD-LGGYKDATLAI
D6ZDA5_SEGRD      GDDVVLEVKSGAGGEESALFAGDLMRMYTKFAERRRWRVEVLSMAESD-LGGVKDATISI
RF1_RUBXD         DKDVILEIRAGTGGDEAALFAGDLYEMYARYADRLGFRHRVLDASPAE-VGGYKEIIVEI
RF1_DEIRA         GKDVILELRAGAGGAEAGLFVMDLLRMYERYAAGLNLKLNVLDAAESD-LGGASKVVAEV
RF1_DEIDV         LKNVILELRAGAGGAEAGLFVMDLLRMYTRYAEDRGLRLNVLEASESD-LGGASKVVAEI
RF1_THET8         ERDAIVEIRAGTGGEEAALFARDLFNMYLRFAEEMGFETEVLDSHPTD-LGGFSKVVFEV
RF1_THEMA         SDKAIVEIRPGTGGEEAALFARDLFRMYTRYAERKGWNLEVAEIHETD-LGGIREVVFFV
RF1_CARHZ         EKNVIMEIRAGAGGEEAALFAGDLFRMYSKYADRMGWKVEIMDSHPTD-LGGFKEVIFTI
RF1_MOOTA         EKDIIMEIRAGAGGEEAALFAGDLFRMYQRYAEKKRWRTEIISSHPTE-LGGFKEIIFQV
RF1_CLOAB         SKNVFVEIRGGTGGEEAALFAADLFRMYTRYAERQGWHTEVMSANETD-IGGFKEIVFMV
RF1_CLONN         DKNVFIEIRAGAGGDEAALFAANLFRMYTRYAERHGWKTELMSANETD-IGGFKEVVFML
RF1_CLOPS         DKNVFVEIRGGAGGDEAALFAANLFRMYTKYAEKNRWKVELMSANETD-IGGFKEVVFMI
RF1_CLOB8         DKNVFVEIRGGAGGEEAALFAYNLFRMYTRYAETQRWGVEIMSLNETD-LGGFKEVVFMI
RF1_CLOK5         DKNVFVEIRGGAGGEEAALFAANLTRMYTRYAEIKGWKVETISLSATD-IGGFKEIVFMV
RF1_ALKOO         DKDVIVEIRAGAGGDEAGLFAADLFRMYTRYAENVGWKVEMMSANDTG-IGGYKEVIFMI
RF1_CLOD6         DKNVIVEIRGGAGGDEAALFAGDLFRMYSRYAERRRWKIELLSASDTG-VGGYKEVSFMI
RF1_CALS4         EKNVIMEIRAGAGGEEAALFAYDLFRMYTMYAEKKGWKVEIMSANKTD-IGGFKEVIFSI
RF1_LAWIP         EKNILLEIRAGTGGEEAALFAADLFRMYCRYAEKMHWKVEIMSQSDSD-TGGFKEIIALI
RF1_SYNFM         DKNVILEIRAGTGGEEAALFVSDLFRMYTRYAELRRWKVEILDSHQTG-IGGLKEVIAAV
RF1_KORVE         DKNIIVEIRAGTGGDEASLFAAELFRMYNRYAETQRWKVEVLSSSESG-VGGLKEVIAII
RF1_SOLUE         DKNVVLEIRAGTGGDEATLFAAEIFRMYSRYAETQNWKMEVTSSSESS-VGGLKEVIALV
RF1_SYMTH         DKNVIMEIRAGAGGDEASLFAAELFRMYTRLAERHKWKTEVLSISENE-AGGIKEVLFQI
RF1_CHLAA         SKDVIMEIRQGEGGDEAALFAADLFRMYTRFAESRGWKVEVDSLTENG-IGGIKEVIFQI
RF1_FUSNN         DKNVIVEIRGGAGGDEAALFAADLFRMYSRYAERKKWKIEIIEKQDGE-LNGLKEIAFTI
RF1_BDEBA         DKNTILEIRAGAGGDEAALFADELFRGYVHYASTQGWKVEMISFSEGN-AGGAKEIIASI
RF1_MYXXA         EKNVILEIRAGAGGDEAALFAEEVMQMYLRYADRRGWKADILDMSPGN-AGGVKDATVTL
RF1_BACP2         NKNVIVEVRGAAGGEEAALFAGNLYRMYSRYAEMQGWKTEVMEASVTG-TGGYKEIIFMI
RF1_BACCN         DKNVIVEIRGAAGGDEAALFAGDLYRMYSRYAEMQGWKTDIIEASYTE-LGGYKEIIFMI
RF1_BACHD         DKNVIVEVRGAAGGDEAQLFAADLYKMYARYAEAQGWKIEVIEASSTE-LGGYKEIIFSV
RF1_GEOTN         EKNVIMEIRAAAGGEEAALFAGDLYRMYTRYAESQGWKTEVIEASPTG-LGGYKEIIFMV
RF1_LISMO         DKNVILEIRGAAGGDEAALFAGDLFRMYSKYAESRGWKVEIMDANPTG-IGGYKEIIAMM
RF1_STAS1         DKDVIVEIRAAAGGDEAAIFAGDLFRMYSKYAETLNYKTDIVEVTESD-HGGYKEISFSV
RF1_LACS1         DKNIIMEIRGAAGGDEASLFAADLFSMYSKYAERQGWSIEVIDKNVTE-VGGFKEIALII
RF1_LACSS         EKNIIMEIRGAAGGDEASLFAGDLLNMYQRYAESQNWQTEIIDETATE-VGGFKEVAMMI
RF1_LACDA         DKDIIMEIRGAAGGDEASLFAGDLLRMYEKYAENQGWNVSIVDSEQTE-VGGYKRAAIMI
RF1_LACLA         GKNIILEIRGAAGGDEAALFAGDLLNMYQHFSESQGWKFEIMEANITG-IGGYKEVSALI
RF1_MYCGE         QKNVIVEIRPAAGGDESCIFLSDLFNMYKNYCTSKNWTVELNEIIPA--SVGINFVSFAV
RF1_MYCGA         DKEVIVEMRPAAGGDESSIFVGNMFDLYKEYCSKHNWKINVIEMLPT--SVGYSFISFEI
F6FHF2_MYCHI      EKNVIVEMRSAAGGDESTIFVENLFDTYKRYADMNNWKLTILNIQEN--SIGMHFLAFSL
RF1_MYCMS         DKNVIVEIRGAAGGDEANIFAGDLLRMYKLYAETQNWKINILEASVGE-AGGYSQVVFMI
RF1_MYCHJ         EKDVIVEIRGAAGGDEANIFVGDLFKMYHKWADSQKAKVKVLSSSLAL-AGGFSQIIFQI
RF1_PHYAS         QKNVILEIKGAVGGNEANLFAADLLRTYMKYAESKKWKVEILNLHPSI-KGGLSSVELLI
RF1_ONYPE         KKNVVLEIKGASGGNEANLFAADLLRTYVKYAESKKWKVEILNLNPSI-KGGLSSVELLI
                       :::: . ** *: ::       *                       *       .

RF1_AGRFC         TGRG----------VFSKLKFESGVHRVQRVPETEASGRIHTSAATVAVLPE--AEDIDV
RF1_SINMW         SGRG----------VFSRLKFESGVHRVQRVPETEAGGRIHTSAATVAVLPE--AEDIDI
RF1_BARBK         SGKG----------VFSKLKFESGVHRVQRVPETETSGRIHTSAATVAVLPE--AEEIDI
RF1_RUEPO         SGEN----------VFARLKYESGVHRVQRVPETESGGRIHTSAATVAVLPE--AQDVDI
RF1_RHOS5         EGEG----------AFARLKYESGVHRVQRVPETEAQGRIHTSAATVAVLPE--AEEVDI
RF1_CAUVC         TGDG----------VFGRLKFESGVHRVQRVPATEAQGRIHTSAATVAVLPE--AEDVEI
RF1_MARMM         SGNG----------VFGRLKFESGVHRVQRVPATESQGRIHTSAATVAIMPQ--PEDIDI
RF1_HYPNA         SGDG----------VFGRMKWESGVHRVQRVPATETQGRIHTSAATVAVLPA--PENIEI
RF1_SPHWW         TGAG----------VFARLKFESGVHRVQRVPVTESGGRIHTSAATVAVLPE--AEEVDV
RF1_ZYMMO         TGAG----------VFARLKFESGVHRVQRVPVTESGGRIHTSAATVAVLPE--AEEVDV
RF1_SPHAL         SGQG----------VFAKLKFESGVHRVQRVPVTESGGRIHTSAATVAVLPE--AEEVDV
RF1_GLUDA         TGRG----------VFARLKYESGVHRVQRVPATESQGRIHTSTVTVAVLPE--AGDVDV
RF1_ACICJ         TGRA----------VFARLKFESGVHRVQRVPATETQGRIHTSTVTVAVLPE--AEDVDV
RF1_BRADU         QGRG----------AFSKLKFESGVHRVQRVPDTETQGRIHTSAATVAVLPE--VEDVDV
RF1_WOLTR         NGTE----------VFARLKFESGVHRVQRVPETESSGRLHTSAATVAILPE--VEEVDF
RF1_NEOSM         SGSD----------VFAKLKFESGVHRVQRVPETESAGRIHTSTATVAVLPE--PEDVDV
RF1_RICTY         KGKD----------VFSKLKFESGVHRVQRVPETESQGRIHTSAATVAVLPE--AEGVDI
RF1_MAGSA         TGRN----------VFARLKFESGVHRVQRVPATESQGRIHTSAATVAIMPE--AEEVDI
RF1_FRAP2         YGDG----------VYSQLKFESGAHRVQRVPATESQGRIHTSACTVAVMPE-ADEVEGI
RF1_HAHCH         AGDN----------VFNLLKFESGAHRVQRVPETESQGRIHTSACTVAILPE-VEEVGDV
RF1_SACD2         VGQG----------VYSELKFESGAHRVQRVPETESQGRIHTSACTVAVMPE-ADEMAEV
RF1_MARMS         VGEG----------AYSKLKFESGAHRVQRVPATESQGRIHTSACTVAVMPE-MDEVDDI
RF1_COXBU         IGEG----------VYSQLKFESGAHRVQRVPVTESQGRIHTSACTVAIMPE-VDEIDQI
RF1_NITOC         VGAG----------AYSRLKFESGGHRVQRVPQTESQGRIHTSACTVAIMPE-AEEIDDI
RF1_ALKEH         SGEG----------AWSRLKFESGAHRVQRVPETESQGRIHTSACTVAVLPE-PDAVEDI
RF1_HALHL         SGRS----------VYARLKFESGAHRVQRVPATESQGRIHTSACTVAILPE-LDEVSAI
RF1_CHRSD         RGDN----------VYARLKFESGAHRVQRVPATESQGRIHTSACTVAVMAE-ASAVGEV
RF1_PSEPF         EGDN----------VYGKLKFESGAHRVQRVPATESQGRIHTSACTVAVLPE-PDEREAI
RF1_ECOLI         SGDG----------VYGRLKFESGGHRVQRVPATESQGRIHTSACTVAVMPE-LPDAELP
RF1_CROS8         SGEG----------VYGRLKFESGGHRVQRVPATESQGRIHTSACTVAVMPE-LPEAELP
RF1_SERP5         SGDG----------VFGQLKFESGGHRVQRVPETESQGRIHTSACTVAVMPA-VPEAELP
RF1_SODGM         SHEG----------AYGLLKFESGGHRVQRVPETESQGRIHTSACTVAVMPE-IPEAELP
RF1_HAEDU         SGES----------VYGQLKFESGGHRVQRVPKTESQGRIHTSACTVAVMPE-LPESEMP
RF1_SHESH         SGEG----------VYGQLKFESGGHRVQRVPETESQGRVHTSACTVVVLPE-IPESEAI
RF1_SHEFN         SGDG----------AYGKLKFESGGHRVQRVPETESQGRVHTSACTVVVLHE-VPEAEAI
RF1_SHEAM         SGER----------VYGKLKFESGGHRVQRVPETESQGRVHTSACTVAVLHE-VPEAEAV
RF1_COLP3         NGEG----------VFGHMKFESGGHRVQRVPATESQGRVHTSACTVVVMPE-IPEADAI
RF1_PSEA6         IGDG----------AYGVLKFESGGHRVQRVPETESQGRIHTSACTVVVMPE-VPESEAI
RF1_PHOPR         SGDG----------AYGVLKFESGGHRVQRVPATESQGRVHTSACTVAVMPE-VPEAEIP
RF1_AERS4         DGEH----------VYGRLKFESGGHRVQRVPETESQGRVHTSACTVAVLPE-VPEAEQI
RF1_VESOH         SGIN----------VYSKLKFESGAHRVQRVPTTESQGRIHTSACTVAIMPE-VENIEEI
RF1_PSYWF         SGND----------VYGRLKFESGAHRVQRVPETESQGRVHTSACTVAVMPE-VEIDDTV
RF1_PSYCK         SGNS----------VYGRLKFESGVHRVQRVPDTESQGRVHTSACTVAVMPE-VEIDDTV
RF1_ACIAD         DGDG----------VYGRLKFESGAHRVQRVPATESQGRVHTSACTVAILPE-VDVDTTV
RF1_THIDA         VGEG----------AYSRLKFESGGHRVQRVPETESQGRIHTSACTVAVMPE-AAEVGEV
RF1_AZOSB         VGAG----------AYSRLKFESGGHRVQRIPVTETQGRIHTSACTVAVMPE-ADELAAV
RF1_NEIM0         IGLG----------AYSRLKFESGGHRVQRVPATESQGRIHTSACTVAVMPE-ADELEDI
RF1_CHRVO         VGQG----------AYSRLKFESGGHRVQRVPATETQGRIHTSACTVAVMAE-ADEIAEV
RF1_DECAR         AGNG----------AYSRLKFESGGHRVQRVPETETQGRIHTSACTVAVMPE-VDEVEDV
RF1_BORA1         DGDG----------AYGRLKFESGAHRVQRVPATEAQGRIHTSACTVAVMPE-ADEMNDI
RF1_POLSJ         DGPTDATG----VGVYGKLRFESGGHRVQRVPATETQGRIHTSACTVAVLPE-PDEAVAI
RF1_VEREI         DGEQ----------VYGTLKFESGGHRVQRVPATETQGRVHTSACTVAVMPE-PDPARAI
RF1_XYLFT         VGRG----------AYSRLKFESGTHRVQRVPATESQGRIHTSAATVAIIPE-ADEIADI
RF1_BUCAI         TGRG----------ACGRLKFESGGHRVQRVPETESQGRIHTSTCTVAVMPV-TPKTEKE
RF1_BUCBP         TGKG----------SYGKLKFESGGHRVQRVPKTESQGRVHTSTCIVAVIPV-VPKKEIE
RF1_BUCCC         IGIG----------ACGRLKFESGGHRVQRVPQTESQGRVHTSACTVAIMPE-VPKSKRI
RF1_BLOPB         PYRG----------AYSLLKFESGGHRVQRIPHTESQGRIHTSTCTIAVIPE-IPDIELP
RF1_BLOFL         PVHG----------SYGQLKFESGGHRVQRIPNTESQGRIHTSTCTIAVIPN-IPNAILP
RF1_WIGBR         CNKN----------AYNKLKFESGGHRVQRIPETESQGRIHTSTCTIAVMPE-MLDFKLP
RF1_GEOMG         EGQA----------VFAKLKYESGTHRVQRVPETEAQGRIHTSACTVAVLPE-AEDIE-I
RF1_PELPD         EGEG----------VFAKLKYESGTHRVQRVPETEAQGRIHTSACTVAIMAE-AEDVD-I
RF1_ARCB4         KGDH----------VYSKLKFEGGTHRVQRVPATESQGRVHTSAITVAVMPE-VDDVE-I
RF1_CAMFF         KGEG----------AYSRLKYEGGTHRVQRVPETESQGRVHTSAITVAIMPE-VEDSE-I
RF1_HELHP         KGNG----------AYSKLKFEGGTHRVQRVPETESQGRIHTSAITVAIMPE-VDDVE-I
RF1_WOLSU         KGNG----------VYSRLKYEGGTHRVQRVPETESQGRIHTSAITVAIMPE-VDDVE-V
RF1_SULNB         KGQG----------VYSQLKYEAGTHRVQRVPDTETQGRVHTSAITVAVIPE-VDDVE-V
RF1_TREDE         SGKY----------VYGSLRYESGVHRVQRVPETEGSGRIHTSAVTVAVLPEAEET--EI
RF1_TREPA         SGRD----------VYGSLRYESGVHRVQRVPSTEASGRIHTSAVTVAVLPEMEET--EV
RF1_CHLMU         SGTS----------VKRFLQYEAGTHRVQRVPETETQGRVHTSAVTIAVLPEPAEDDEEV
F8L7A9_SIMNZ      SGKN----------VHRFLQYEAGTHRVQRVPVTETQGRVHTSAITIAVLMEPGEN-EPI
RF1_PELLD         S----------GHDVYGTLKYESGVHRVQRVPETETQGRIHTSAASVAVLPEAEEVD--V
RF1_CHLCH         S----------GNNVFGTMKYESGVHRVQRVPDTEAQGRIHTSAVSVAVLPEAEEVD--V
RF1_PORGI         K----------GEGVYGILKYESGVHRVQRVPATETQGRIHTSAATVAVLPEAEEVD--V
RF1_PARD8         S----------GEKVYGTLKYESGVHRVQRVPATETQGRVHTSAATVAVLPEADEFD--V
RF1_SYNPW         K----------GESVFSELKFEAGVHRVQRVPATESQGRVHTSTATVAVMPEADPVE--V
RF1_SYNS3         K----------GDAVFSELKFEAGVHRVQRVPSTESQGRVHTSTATVAVMPEADPVE--V
RF1_PROMM         K----------GDAVFSQLKFEAGVHRVQRVPATESQGRVHTSTATVAVMPEADAVE--V
RF1_PROMA         K----------GKAVFSQLKFEAGVHRVQRVPATESQGRVHTSTATVAVMPEADPVE--V
RF1_PROMP         K----------GDSVYSQLKFEAGVHRVQRVPATESQGRVHTSTATVAVMPEADPVE--V
RF1_SYNY3         K----------GDRVYSQLKFEAGVHRVQRVPVTEAGGRVHTSTATVAIMPEVDDVE--V
RF1_SALRD         K----------GEDVYGTLKYEAGVHRVQRVPETESSGRIHTSAATVAVLPEAEEVD--V
RF1_ACIC1         RADGS-------EGAWSRLKFEGGVHRVQRVPVTESQGRIHTSAVGVLVMPEAEEVD--V
RF1_KINRD         KTRGAA-----AEGVWHRLKYEGGVHRVQRVPVTESQGRVHTSAVGVLVVPEAEEVE--V
RF1_NOCSJ         KAKGTP---EPGEAPYALLKFEGGVHRVQRVPVTESQGRVHTSAAGVLVLPEAEQVD--V
RF1_STRAW         KTKGGQGATEPGQGVWARMKYEGGVHRVQRVPSTESQGRIHTSAAGVLVTPEAEEVD--V
RF1_FRACC         KARGPAG---PGDGVYGRLRFEGGVHRVQRVPVTESAGRIHTSAAGVLVLPEAEEVD--V
RF1_ARTS2         KGNSND----PAEGVYARLKFEGGVHRVQRVPVTESQGRIHTSAAGVLVLPEVDEPEE-L
RF1_CLAMS         KGTSDD----PALGVWAHLKYEGGVHRVQRVPATESQGRIHTSAAGVLVIPEVEEVEE-V
RF1_BIFLO         RAKGTPA---PEDGVWASMKYEGGVHRVQRIPVTESQGRIQTSAAGVIVFPEADEDDDEI
RF1_COREF         RSRQPSR-----DGAWSQFKFEGGVHRVQRVPVTESQGRIQTSAAGVLVYPEPDEVED-V
RF1_MYCLE         SHKGASDG-DAVDGVWSRMKFEGGVHRVQRVPVTESQGRVHTSAAGVLVYPEPEEIGE-V
D6ZDA5_SEGRD      KRTGGDQ--SPANGVWAWLKHEGGVHRVQRVPATESQGRIHTSAAGVLAYPEPEDAPD-I
RF1_RUBXD         E----------GDGAYSVFKHEGGTHRVQRVPKTESQGRIHTSTATVAVLPEAEEVE--V
RF1_DEIRA         T----------GDFAFRALKWERGVHRVQRVPATESQGRIHTSTATVAVLPEAEPGE--V
RF1_DEIDV         S----------GEFAFRAFKWERGVHRVQRVPATESQGRIHTSTVTVAVLPEAEQGE--V
RF1_THET8         R----------GPGAYGTFKYESGVHRVQRVPVTETQGRIHTSTATVAVLPKAEEED--F
RF1_THEMA         K----------GKNAYGILKYESGVHRVQRVPVTESGGRIHTSTATVAVLPEIEEKD--I
RF1_CARHZ         EGKG----------VYSRMKFESGVHRVQRVPTTESGGRIHTSTATVAVLPE-AEEV-EV
RF1_MOOTA         EGQG----------VYSRLKFESGVHRVQRIPTTESGGRIHTSTATVAVLPE-AEEV-DV
RF1_CLOAB         KGNG----------AYSRMKYESGTHRVQRVPNTESSGRIHTSAATVAVLPE-VDDV-DI
RF1_CLONN         RGDC----------AYSKMKFESGVHRVQRVPDTESSGRIHTSTATVAVLPE-VDDV-DI
RF1_CLOPS         KGAG----------AYSKLKYESGAHRVQRVPDTESSGRIHTSTATVAVLPE-VDDV-EI
RF1_CLOB8         KGNG----------AYSKLKYESGVHRVQRVPDTESSGRIHTSTATVAVLPE-VDDV-EI
RF1_CLOK5         KGKD----------AYSRLKYESGTHRVQRVPDTESSGRIHTSTATVAVLPE-VDDV-DI
RF1_ALKOO         KGHG----------AYSRLKYESGVHRVQRIPSTESGGRIHTSTITVAVLPE-ADDV-DF
RF1_CLOD6         KGKG----------AYSRLKYESGVHRVQRIPSTESGGRIHTSTSTVAVLPE-VEDV-EV
RF1_CALS4         SGKG----------AYSRLKYESGVHRVQRIPTTEAGGRIHTSTATVAVLPE-AEEV-DV
RF1_LAWIP         QGDN----------VYSRLKFESGTHRVQRVPTTESQGRIHTSAATVAVLPE-AEDV-DI
RF1_SYNFM         NGQG----------AYSRLKFERGVHRVQRVPVTESQGRIHTSAVTVAVLPE-AEEV-DV
RF1_KORVE         EGRG----------AYSKLKYESGVHRVQRVPQTETQGRVHTSAVTVAVLPE-AEEV-DI
RF1_SOLUE         SGNK----------VYAKLKYESGVHRVQRVPVTEQQGRVHTSAITVAVLPE-ADEV-EV
RF1_SYMTH         NAEG----------AYSRLKYEGGVHRVQRVPVTESQGRIHTSTVTVAVMPE-MEEV-DI
RF1_CHLAA         HGEG----------AYSQLKYEGGVHRVQRVPATEARGRIHTSTATVAVLPE-VEET-EI
RF1_FUSNN         IGLG----------AYSRLKFESGVHRVQRVPKTEASGRIHTSTATVAVLPE-VEDIQEV
RF1_BDEBA         TGDS----------VFSKMKYESGVHRVQRVPKTEAAGRIHTSTVTVAVIPE-VEVS-EI
RF1_MYXXA         SGDA----------VFSSMKYESGVHRVQRVPATETQGRIHTSTITVSVMPE-AEDV-DV
RF1_BACP2         SGKG----------AYSKLKFENGAHRVQRVPETESGGRIHTSTATVAVLPE-AEE-VEI
RF1_BACCN         NGKG----------AYAKLKFENGAHRVQRVPETESGGRIHTSTATVAVLPE-AEE-VEI
RF1_BACHD         NGKG----------AYSKLKYENGAHRVQRVPQTESGGRIHTSTATVAVLPE-AEE-VEV
RF1_GEOTN         NGKG----------AYSKLKFENGAHRVQRVPETESGGRIHTSTATVACLPE-MEE-VEV
RF1_LISMO         NGND----------AFSRMKYENGAHRVQRVPETESGGRIHTSTATVAILPE-AEE-VEI
RF1_STAS1         SGNG----------AFSKLKYENGAHRVQRVPETESGGRIHTSTATVAVLPE-VED-VEI
RF1_LACS1         NGNS----------VWSKLKYESGAHRVQRIPVTESAGRVHTSTATVVVMPE-EED-VEI
RF1_LACSS         TGKN----------VYSKLKYENGAHRVQRIPKTESQGRVHTSTATVAVMPE-YDG-VDV
RF1_LACDA         TGNK----------VYSKLKYENGAHRVQRIPVTESAGRVHTSTATVAVMPE-YEQ-VDI
RF1_LACLA         SGPS----------VYSKLKYESGAHRVQRVPVTETQGRVHTSTATVLVMPE-VEE-FEM
RF1_MYCGE         NGTD----------VFAKLKFESGVHRVQRVPLTEAKGRVHTSTVTVAVLPQ-LEE-VEI
RF1_MYCGA         NGED----------VYSKMKFESGVHRVQRVPATEAKGRVHTSTITIAVLPQ-QDD-VEI
F6FHF2_MYCHI      SGKN----------VFSKMKFESGVHRVQRVPATESKGRVHTSTITVSVMPE-QDD-IEI
RF1_MYCMS         KGDR----------VYSKLKFESGAHRVQRVPKTEAKGRIQTSTATVAVLPE-MSE-VEI
RF1_MYCHJ         SGQK----------IYSKLKFESGVHRVQRVPATETMGRIHTSTATVTVMPK-IDEKIEI
RF1_PHYAS         SGQN----------IYSFLKYESGVHRVQRVPATEVQGRIHTSTAIVLVLPE-AKE-VEI
RF1_ONYPE         SGKN----------IYSFLKYESGVHRVQRVPATEAQGRIHTSTAVVLVVPE-AEE-LEL
                                    :: * * *****:* **  **::**:  :             

RF1_AGRFC         EIRPEDIRIDTMRASGAGGQHVNTTDSAVRITH--------LPTGLIVTSS-EKSQHQNR
RF1_SINMW         DIRSEDIRVDTMRSSGAGGQHVNTTDSAVRITH--------LPTGLVVTSS-EKSQHQNR
RF1_BARBK         EIRPEDIRIDTMRASGAGGQHVNTTDSAVRITH--------IPTGIMVVQA-EKSQHQNR
RF1_RUEPO         QIDPGDIRIDTMRSSGAGGQHVNTTDSAVRITH--------LPSGIVVTSS-EKSQHRNR
RF1_RHOS5         AIPAADIRIDTMRSSGAGGQHVNTTDSAVRITH--------LPTGIVVTSS-EKSQHRNR
RF1_CAUVC         EIKESDLRIDTYRSSGAGGQHVNKTDSAVRITH--------LPTGVVVTSS-EKSQHQNR
RF1_MARMM         ELDMGDVRVDTMRASGAGGQHVNKTDSAVRMTH--------IPTGLVVVCQ-EKSQHQNR
RF1_HYPNA         EVRADDIRIDTMRSSGAGGQHVNTTDSAVRITH--------LPTGIMVTSS-EKSQHVNR
RF1_SPHWW         HIDDKDLRIDVYRSSGPGGQSVNTTDSAVRITH--------LPTGLVVIQQDEKSQHKNK
RF1_ZYMMO         DIDERDLRIDIFRSSGPGGQSVNTTDSAVRITH--------IPSGIVVSQQDEKSQHKNK
RF1_SPHAL         AINDSDLKIDIYRASGAGGQHVNTTDSAIRITH--------IPTGLVVIQQDQRSQHKNR
RF1_GLUDA         QINDGDLRIDVYRASGAGGQHVNKTESAVRITH--------LPTGLVVAMQEEKSQHKNR
RF1_ACICJ         EVNEADLRIDVFRASGAGGQHVNKTESAVRITH--------LPTGIVVAMQEERSQHKNR
RF1_BRADU         DIKNDDLRIETMRAQGAGGQHVNKTESAIRITH--------IPTGIVVMMQDSRSQHKNR
RF1_WOLTR         KIEEKDLRIDVYRSSGPGGQSVNTTDSAVRVTH--------LPTEMVVIQQDEKSQHKNK
RF1_NEOSM         KINDKDLRIDVYRSSGPGGQSVNTTDSAVRITH--------IPTGIVVIQQDEKSQHKNR
RF1_RICTY         KIEDKDLRIDTYRSSGAGGQHVNTTDSAVRITH--------IPTGITVALQDEKSQHKNK
RF1_MAGSA         QLNDSDLRFDVYRSQGSGGQSVNTTDSAVRVTH--------IPTGLAVACQQEKSQHKNK
RF1_FRAP2         DINPADIKVDTFRASGAGGQHVNKTDSAIRITH--------IPTGVVVECQDQRSQHKNR
RF1_HAHCH         DINPADLRVDTYRASGAGGQHVNKTDSAIRITH--------LPSGIVVECQDERSQHKNR
RF1_SACD2         NINKADLRIDTFRASGAGGQHVNKTDSAIRLTH--------IPTGVVVECQDERSQHKNR
RF1_MARMS         IINKSDLRIDTFRASGAGGQHVNKTDSAIRLTH--------IPTGVVVECQEERSQHKNR
RF1_COXBU         KINPAELRIDTFRASGAGGQHVNRTDSAIRITH--------LPTGVVVECQDERSQHKNK
RF1_NITOC         DINPADLRVDTFRASGAGGQHVNKTDSAIRITH--------LASGIVVECQDERSQHKNR
RF1_ALKEH         TINPAELRVDTFRASGAGGQHVNKTDSAIRITH--------LPTGVVVECQSERSQHKNR
RF1_HALHL         EVNTADLRVDTFRSSGAGGQHVNTTDSAIRITH--------LPSGLVVECQDERSQNKNR
RF1_CHRSD         ELNSNDLRVDTFRSSGAGGQHVNTTDSAIRITH--------LPSGLVVECQEERSQHKNR
RF1_PSEPF         EINPADLRVDTYRSSGAGGQHVNTTDSAIRITH--------IPTGTVVECQEERSQHKNR
RF1_ECOLI         DINPADLRIDTFRSSGAGGQHVNTTDSAIRITH--------LPTGIVVECQDERSQHKNK
RF1_CROS8         DINPADLRIDTFRSSGAGGQHVNTTDSAIRITH--------LPTGIVVECQDERSQHKNK
RF1_SERP5         EINAGDLKIDTFRSSGAGGQHVNTTDSAIRITH--------LPTGIVVECQDERSQHKNK
RF1_SODGM         EINAGDLRIDTFRSSGAGGQHVNTTDSAIRITH--------LPTGLVVECQDERSQHKNK
RF1_HAEDU         EINPADLRIDTYRSSGAGGQHVNTTDSAVRITH--------LPTGIVVECQDERSQHKNK
RF1_SHESH         EINKGDLKVDTFRASGAGGQHVNKTDSAIRLTH--------IPSGIVVECQDQRSQHKNR
RF1_SHEFN         SINAADLKVDTFRASGAGGQHVNKTDSAIRITH--------IPSGIIVECQDQRSQHKNR
RF1_SHEAM         EINPSELRIDTFRASGAGGQHVNKTDSAIRITH--------LPTGTVVECQDERSQHKNK
RF1_COLP3         EINKADLKVDTFRASGAGGQHVNKTDSAIRITH--------IPTGVVVECQEQRSQHKNR
RF1_PSEA6         EVNKADLKIDTFRASGAGGQHVNKTDSAIRITH--------VPSGIVVECQDERSQHKNR
RF1_PHOPR         EINTGDLKIDTFRSSGAGGQHVNTTDSAIRITH--------LPTGIVVECQDERSQHKNK
RF1_AERS4         EINANDLKIDTFRASGAGGQHVNKTDSAIRITH--------LPTGLVVECQDERSQHKNR
RF1_VESOH         NININDVRIDTFRASGAGGQHVNKTDSAVRITH--------LPTGTVVECQDGRSQHKNK
RF1_PSYWF         ELNPADIRMDTFRSSGAGGQHVNTTDSAVRLTH--------IPTGVVAECQQERSQHKNR
RF1_PSYCK         DLNPADIRFDTFRSSGAGGQHVNTTDSAVRLTH--------IPTGTVVECQQERSQHKNR
RF1_ACIAD         EINPADLRIDTYRASGAGGQHINKTDSAVRITH--------VPTGVVVECQEERSQHKNK
RF1_THIDA         DINPADLRIDTFRASGAGGQHINKTDSAVRITH--------LPTGLVVECQDDRSQHRNR
RF1_AZOSB         EINPADLRIDTFRASGAGGQHINKTDSAVRITH--------LPTGLVVECQDDRSQHRNK
RF1_NEIM0         ELNPVDLRIDTFRASGAGGQHINKTDSAVRITH--------LPTGMVVECQDGRSQHANK
RF1_CHRVO         VLNPADLRIDTFRASGAGGQHINKTDSAVRITH--------IPTGIVAECQDGRSQHANK
RF1_DECAR         NLNPADLRIDTFRASGAGGQHINKTDSAVRITH--------LPTGIVAECQDGRSQHANK
RF1_BORA1         VINPADLRIDTFRASGAGGQHINKTDSAVRITH--------LPTGLVVECQDDRSQHRNK
RF1_POLSJ         QINPADLRIDTYRASGAGGQHINKTDSAVRITH--------IPTGIVAECQDDRSQHRNK
RF1_VEREI         ALNPAELRIDTFRASGAGGQHINKTDSAVRVVH--------LPTGIVAECQDGRSQHGNK
RF1_XYLFT         SINPADLKIDTFRSSGAGGQHVNKTESAIRITH--------LPTGVVVESQTERSQHANR
RF1_BUCAI         EINSSDLKIDTFRSSGAGGQHVNTTDSAIRITH--------IPTGNVVECQDERSQHKNK
RF1_BUCBP         KVNINDLKIDTFRSSGAGGQHVNTTDSAVRITH--------IPSGQVVECQDERSQHKNK
RF1_BUCCC         ILNTSDLKIDTFRSSGAGGQHVNTTDSAVRITH--------LPTGCVVECQDERSQHKNK
RF1_BLOPB         SIDPHDLRIDTFRSSGAGGQHVNTTDSAIRITH--------VPSGLVVECQDERSQHKNK
RF1_BLOFL         EINSNDLRIDTFRSSGAGGQHVNTTDSAIRITH--------IPSGLSVECQDERSQHKNK
RF1_WIGBR         KIKTSDLRIDTFRSSGAGGQHINTTDSAIRITH--------IPTNIVVECQDERSQHKNK
RF1_GEOMG         DINPVDLKIDVYRASGAGGQHVNKTESAVRITH--------LPTGIVVECQDERSQIKNR
RF1_PELPD         DINPTDLKIDVYRSSGAGGQHVNTTDSAVRITH--------LPTGTVVACQEERSQIKNR
RF1_ARCB4         EINENDLKIDVMRASGNGGQSVNTTDSAVRITH--------IPSGIVVTNQDQKSQHKNK
RF1_CAMFF         DINPNDLKIDVMRSSGHGGQSVNTTDSAVRVTH--------IPTGLVVVNQDGKSQHKNK
RF1_HELHP         NINPNDLKIDVFRSGGHGGQSVNTTDSAVRITH--------IPTGISVSMQDEKSQHKNK
RF1_WOLSU         NINPNDLKIDVFRSGGHGGQSVNTTDSAVRITH--------LPTGISVSMQDEKSQHKNK
RF1_SULNB         DIKPNEVKMDVYRSSGCGGQSVNTTDSAVRLTH--------IPTGIVVAIQDEKSQHKNR
RF1_TREDE         EINQEDLRIDVMRAGGPGGQCVNTTDSAVRITH--------IPTGLVVICQDEKSQIKNK
RF1_TREPA         DIRAEDVRVDVMRASGPGGQCVNTTDSAVRLTH--------LPTGIVVVCQDEKSQIKNK
RF1_CHLMU         FIDEKDLRIDTFRSSGAGGQHVNVTDSAVRITH--------IPTGVVVSCQDERSQHKNK
F8L7A9_SIMNZ      DIDESDLKIDTYRSSGAGGQHVNTTDSAVRITH--------MPTGVVVYCQEERSQHKNK
RF1_PELLD         EIRRDDLRFDTYRSGGKGGQNVNKVETAVRI--------THEPTGLVAACQEERSQLQNK
RF1_CHLCH         EIRRDDLRFDTYRSGGKGGQNVNKVETAVRI--------THMPTGIVAACQEERSQLQNK
RF1_PORGI         EINPADIEMQTSRSGGAGGQNVNKVETKVQL--------THKPTGMVVVCQQARSQIANR
RF1_PARD8         EINEGEIKWDTFRSGGAGGQNVNKVESGVRLRYVWKNPITGVSEEILIECTETRDQPKNK
RF1_SYNPW         QIEPADLEISTARSGGAGGQNVNKVETAVDL--------MHRPSGIRVFCTQERSQLQNR
RF1_SYNS3         QIDPRDLDISTARSGGAGGQNVNKVETAVDL--------MHKPTGIRVFCTQERSQMQNR
RF1_PROMM         QIDPSELEISTARSGGAGGQNVNKVETAVDL--------LHKPTGIRVFCTQQRSQLQNR
RF1_PROMA         KLEPTDLEISTARSGGAGGQNVNKVETAVDL--------LHKPTGIRVFCTQERSQLQNR
RF1_PROMP         KIDPTEIEIGTARSGGAGGQNVNKVETAIDL--------IHKPTGIRVFCTQERSQLQNR
RF1_SYNY3         KIDPKDIEMSTARSGGAGGQNVNKVETAVDL--------FHKPTGIRIFCTEERSQLQNR
RF1_SALRD         DINPSDLTIETFKATGPGGQSVNTTDSAVRI--------KHAPSGVEVSCQDEKSQHKNR
RF1_ACIC1         QIDPNDLRIDVFRSSGPGGQSVNTTDSAVRITH--------LPTGIVVSCQNEKSQLQNK
RF1_KINRD         AVDPNDLRVDVFRSSGPGGQSVNTTDSAVRITH--------LPTGVVATCQNEKSQLQNR
RF1_NOCSJ         QIDENDLRIDVFRSSGPGGQSVNTTDSAVRITH--------LPTGIVVSCQNEKSQLQNR
RF1_STRAW         EIHANDLRIDVYRSSGPGGQSVNTTDSAVRITH--------LPTGVVASCQNEKSQLQNK
RF1_FRACC         EIDPNDLRIDVFRSSGPGGQSVNTTDSAVRITH--------IPTGVVVSCQNEKSQLQNK
RF1_ARTS2         EINQNDLKIDVYRSSGPGGQSVNTTDSAVRITH--------LPTGIVVAMQNEKSQLQNR
RF1_CLAMS         PLDPNDLKIDVYRSSGPGGQSVNTTDSAVRITH--------LPTGIVVAMQNEKSQLQNR
RF1_BIFLO         EIDPKDLKIDIFMSSGPGGQSVNTTYSAVRMTH--------LPTGITVNMQDEKSQIQNR
RF1_COREF         EIDEKEIRVDVYRSSGKGGQGVNTTDSAVRITH--------LPTGIVVTCQKERSQIQNR
RF1_MYCLE         HIDESDLRIDVYRSSGKGGQGVNTTDSAVRITH--------LPTGVVVTCQNERSQLQNK
D6ZDA5_SEGRD      VIDETELRIDVYRSSGKGGQGVNTTDSAVRITH--------LPTGLVVTCQNERSQLQNK
RF1_RUBXD         EINPNDLEIDVYRSSGPGGQSVNTTDSAVRITH--------KPTGLVVTCQNEKSQLQNK
RF1_DEIRA         NLDLSEVRIDVFRSQGAGGQGVNTTDSAVRAVYR-----AGTPDEIMVICQDGRSQIKNR
RF1_DEIDV         QLDLSEVRIDVFRSQGAGGQGVNTTDSAVRAVYR-----AGTPDEIMVVCQDGRSQIKNR
RF1_THET8         ALNMDEIRIDVMRASGPGGQGVNTTDSAVRVVH--------LPTGIMVTCQDSRSQIKNR
RF1_THEMA         EIRPEDLKIETFRASGHGGQYVNKTESAVRITH--------LPTGIVVSCQNERSQYQNK
RF1_CARHZ         EINPNDLRIDVFCASGAGGQHVNKTESAVRITH--------IPTGIVVTCQDEKSQHKNK
RF1_MOOTA         EIKPEDLRVDIFCSSGPGGQSVNTTYSAVRITH--------LPTGLVVSCQDEKSQLKNK
RF1_CLOAB         EINPNDIRIDVFRASGHGGQCVNTTDSAVRITH--------LPTGIVVSCQDEKRQLKNK
RF1_CLONN         QIDPNDIRVDVFRASGHGGQCVNTTDSAVRMTH--------IPTGIVVSCQDEKSQLKNK
RF1_CLOPS         EINDKDIKIDVFRASGNGGQCVNTTDSAVRITH--------LPSGLVVSCQDEKSQLKNK
RF1_CLOB8         EVADKDVRIDVFRASGNGGQCVNTTDSAVRITH--------LPTGLVVSCQDEKSQLKNK
RF1_CLOK5         VVNQNDIRIDVFRASGHGGQCVNTTDSAVRITH--------LPTGLVVSCQDEKSQLKNK
RF1_ALKOO         ELDMNDIRVDVFRSSGNGGQSVNTTDSAVRVTH--------IPTGTVVSCQDEKSQLKNK
RF1_CLOD6         EINPNDLRIDVFRSSGNGGQSVNTTDSAVRVTH--------IPTGEVVSCQDGKSQLKNK
RF1_CALS4         EINPNDIKIDVFRSSGHGGQSVNTTDSAVRVTH--------IPTGIVVTCQDERSQIQNR
RF1_LAWIP         EIRPEELRFDVFRSSGPGGQSVNTTDSAVRVTH--------IPTGIVVTCQDEKSQHKNK
RF1_SYNFM         YIDPNDLRVDVFRSSGPGGQSVNTTDSAVRVTH--------IPSGLVVICQDEKSQHKNK
RF1_KORVE         KIEAKDIRIDTFCSSGPGGQSVNTTYSAVRITH--------LPTNTVVSCQDEKSQIKNR
RF1_SOLUE         KLEAKDIRIDTFCSSGPGGQSVNTTYSAVRITH--------LPTGLVVSCQDEKSQIKNR
RF1_SYMTH         EIKPEDLKIEVQRAGGAGGQHVNKTESAVRMTH--------LPTGIVVYCADERSQMQNR
RF1_CHLAA         EIKPEDLRIDVFRSAGHGGQGVNTTDSAVRIVYKPG-----TPEEIVVTCQDGRSQIQNR
RF1_FUSNN         TVDPKDLKIDTYRSGGAGGQHVNMTDSAVRITH--------LPTGIVVQCQDERSQLKNR
RF1_BDEBA         KIPMSDVRIETMRSQGSGGQSVNRTESAVRVVH--------LPTGIDVKCQEGKSQSTNR
RF1_MYXXA         QVNPADIEMQVMRSTGSGGQSVNTTDSAVRLIH--------HPTGIVVKCQQEKSQLKNR
RF1_BACP2         DIHEKDIRVDTFTSSGPGGQSVNTTMSAVRLTH--------LPTGVVVSCQDEKSQIKNK
RF1_BACCN         DIHEKDIRVDTFASSGPGGQSVNTTMSAVRLTH--------LPTGVVVSCQDEKSQIKNK
RF1_BACHD         DIHEKDIRVDTFASSGPGGQSVNTTMSAVRLTH--------LPTGIVVSCQDEKSQIKNK
RF1_GEOTN         EIHEKDIRVDTYASSGPGGQSVNTTMSAVRLTH--------IPTGIVVTCQDEKSQIKNK
RF1_LISMO         ELHDKDIRTDTFASTGAGGQSVNTTMSAVRLTH--------IPTGIVVSMQDERSQLKNK
RF1_STAS1         EVRNEDLKIDTYRSSGAGGQHVNTTDSAVRITH--------IPTGVIATS-SEKSQIQNR
RF1_LACS1         ELDPKDIRVDVYRSSGAGGQHINKTSSAVRMTH--------LPTGIVVAMQDQRSQQQNR
RF1_LACSS         ELEAKDIRVDVYRASGAGGQHINKTSSAVRMTH--------IPTGIVVAMQDQRSQQQNR
RF1_LACDA         DLDPKEIRVDVYRSSGAGGQHINKTSSAVRMTH--------LPTGIVVAMQDQRSQQQNR
RF1_LACLA         TIDQKDLRVDIYHASGAGGQNVNKVATAVRMVH--------LPTGIKVEMQEERTQQKNR
RF1_MYCGE         TINPSDLRIDTYRASGAGGQHVNRTESAVRITH--------LPTGIVVACQEGKSQFSNR
RF1_MYCGA         EINPADLRIDTYRASGAGGQHVNRTESAVRITH--------IPTGIVAACQEGKSQIANR
F6FHF2_MYCHI      NIDPSDLRIDVYRASGAGGQHVNKTESSVRITH--------LPTGIVVACQQEKSQIQNR
RF1_MYCMS         EIRSNDLRIDTYRASGAGGQHVNTTDSAVRITH--------LPTGIVVTSQDGRSQHDNK
RF1_MYCHJ         EINPSDLKIDTYRSSGAGGQSVNTTDSAVRITH--------IPTGIVVTSQDERSQIGNK
RF1_PHYAS         KIDWNDIRTDTFNSSGPGGQSVNTTKSAVRLSH--------LPSGISVACQEGKSQHENK
RF1_ONYPE         KIDWHDIRTDTFNSSGPGGQSVNTTKSAVRLTH--------IPSGISVACQEGKSQHENK
                   :   ::      : * *** :* . : :             .          : *  *:

RF1_AGRFC         AKAMQVLRSRLYDIERQKVDSERSADRKSQVGSGDRSERIRTYNFPQGRVTDHRI--NLT
RF1_SINMW         AKAMQVLRSRLYDMERQRADSERSADRRNQVGSGDRSERIRTYNFPQGRLTDHRI--NLT
RF1_BARBK         ARALQILRSRLFDIERQKAESERSASRKTQVGSGDRSERIRTYNFPQGRVTDHRI--NLT
RF1_RUEPO         EIAMQVLKTRLYDLERQRLDRERSASRSAQVGTGDRSERIRTYNFPQGRMTDHRI--NLT
RF1_RHOS5         EIAMQVLRARLYDLERQRLAEARSADRKAQVGSGDRSERIRTYNFPQGRMTDHRI--NLT
RF1_CAUVC         ARAMKNLKARLYDMQREALDSARSEARKSQVGSGDRSERIRTYNFPQGRVTDHRI--NLT
RF1_MARMM         ARAQEILKAKLYDMQREAANAERAAERKGQIGSGDRSERIRTYNYPQGRVSDHRI--NLT
RF1_HYPNA         EKAMDQLKIRLYERERAEKDAARSEARASQIGSGDRSQKVRTYNYPENRLTDHRI--GLT
RF1_SPHWW         AKALKVLRTRLYEMERERLASERAGARKSMVGSGDRSERIRTYNFPQGRVTDHRI--NLT
RF1_ZYMMO         AKAMKVLRARLYERERERLHSERAGQRKSMVGSGDRSERIRTYNFPQGRVTDHRI--NLT
RF1_SPHAL         AKAMQVLRARLYDLEREKLHSAEASARKSMVGSGDRSERIRTYNFPQGRVTDHRI--NLT
RF1_GLUDA         AKAMKILMARLYERERAAAHATRAADRKSQVGTGDRSERIRTYNFPQGRVTDHRI--NLT
RF1_ACICJ         AKAMKILRARLYEQTRAAAAAGRAADRKSQVGTGDRSERIRTYNFPQGRVTDHRI--NLT
RF1_BRADU         ASAMNILRSRIYDAERQRVDAARSAERKEKVGSGDRSERIRTYNFPQGRVTDHRI--NLT
RF1_WOLTR         AKALKVLRARLYEIERQKKEIERSTMRKSQIGSGDRSERIRTYNFPQSRITDHRI--NLT
RF1_NEOSM         AKAMKVLRVRLYEIERNKVQQEISSMRKSQIGSGERSEKTRTYNFPQGRITDHRI--NLT
RF1_RICTY         AKALKILRARLYEEKRRQKEQERSDSRRWQVGSGDRSERIRTYNFLHGRVSDHRI--NLT
RF1_MAGSA         ATALKLLRARLYERERSAKDAERAAARKSQVGSGDRSERIRTYNFPQGRVTDHRI--NMT
RF1_FRAP2         AAAMSMLKSKLLQAEIDKQQKEQSDTRKNLVGSGDRSERIRTYNYPQGRVTDHRI--NLT
RF1_HAHCH         AKAMSLLKAKLLSSAQEKQAKEQAQTRKSLVGSGDRSERIRTYNYPQGRITDHRI--NLT
RF1_SACD2         AKAMSLLASRLSMAQEEKAAAEQASARKSLVGSGDRSERIRTYNFPQGRVTDHRI--NLT
RF1_MARMS         AKAMSLLASRLQAAELEKAASEQSETRKSLVGSGDRSERIRTYNYPQGRVTDHRI--NLT
RF1_COXBU         ARAMSLLQSKLLAAERAKQDQEQAAKRKSLVGSGDRSERIRTYNFPQGRVTDHRI--NLT
RF1_NITOC         ARAMSLLRTKLKSEEEAKLVAEETATRRSLIGSGDRSERIRTYNFPQGRVTDHRI--NLT
RF1_ALKEH         AQALALLQARLKNAQQAEQSAQQTEQRRQLVGSGDRSERIRTYNFPQGRITDHRI--NLT
RF1_HALHL         AKAIALLQARLTEQERAKQQSERSEQRRLAVGSGDRSERIRTYNFPQGRVTDHRI--GLT
RF1_CHRSD         AKAMALLAARLKQSAVDAQRQQQADTRRSLVGSGDRSERIRTYNFPQGRITDHRI--NLT
RF1_PSEPF         ARAMAWLSAKLNDQQTAAAANAIASERKLLVGSGDRSERIRTYNFAQGRVTDHRV--NLT
RF1_ECOLI         AKALSVLGARIHAAEMAKRQQAEASTRRNLLGSGDRSDRNRTYNFPQGRVTDHRI--NLT
RF1_CROS8         AKALAVLGARIHAAEVAKRQQAEASTRRNLLGSGDRSDRNRTYNFPQGRVTDHRI--NLT
RF1_SERP5         AKAMSVLGARIRAAEMAKRQQAEASTRRNLLGTGDRSDRNRTYNFPQGRVTDHRI--NLT
RF1_SODGM         AKALAVLGARLRAAEVQRRQQEESSTRRNLLGSGDRSDRIRTYNFPQGRVTDHRI--GLT
RF1_HAEDU         AKALAVLASRIVQVEQERQAMAQADTRRNLLGTGDRSDKIRTYNYPQGRVTDHRI--NLT
RF1_SHESH         AQAMSVLTARIQAVEDEKRRSAEESTRRNLVGSGDRSERIRTYNFPQGRVSEHRI--NLT
RF1_SHEFN         AQAMSVLAARIQAVEDEKRRSAEETTRRSLVASGDRSERIRTYNYPQGRVSDHRI--NLT
RF1_SHEAM         ARAMSVLVARLQAAEDEKRRSAEATTRRNLVGSGDRSERIRTYNFPQGRVSDHRI--NLT
RF1_COLP3         AQAMSVLQARLQQAEDEKRRSEEESSRRNLVASGDRSERIRTYNFPQGRMSDHRI--NLT
RF1_PSEA6         AKAMAVLQSRLNKLEEEKRQAEETSTRRNLVASGDRSERIRTYNFPQGRVTDHRI--NLT
RF1_PHOPR         AKAMSVLAARITKAEEEKRHAEEASTRRNLLGSGDRSDRIRTYNYPQGRVSDHRI--TLT
RF1_AERS4         AKAMSVLSARLQAAEDERHRAAEQSTRRNLVGSGDRSERIRTYNYPQGRLSEHRI--NLT
RF1_VESOH         AQAMSVLASRILDAQQQEQQEQQSSTRKELIGSGDRSQRIRTYNYPQGRITDHRI--NLT
RF1_PSYWF         AKAMQMLIARIQQAKVQEQVDTADALRRNLVGSGDRSERIRTYNFPQGRMTDHRI--NLT
RF1_PSYCK         AQAMKMLISKIQQVKVQAQVDAADTIRRDLVGSGDRSERIRTYNFPQGRMTDHRI--NLT
RF1_ACIAD         AKAMALLVSRLENAKRAAQETATSEMRRDLVGSGDRSERIRTYNYPQGRMTDHRI--NLT
RF1_THIDA         AQAMSVLAARLKDREIQAQQASEASTRKSLIGSGDRSDRIRTYNFPQGRITDHRI--NLT
RF1_AZOSB         AQAMAVLAARLNDAQLRARQSAEAATRRSLIGSGDRSERIRTYNFPQGRVTDHRI--NLT
RF1_NEIM0         AQAMKVLAARLNDAQKREAQAKEAAERKSLIGSGDRSERIRTYNYPQGRVTDHRI--NLT
RF1_CHRVO         ASAMQVLAARIYDIQLREKNQKEAAERKSLIGSGDRSERIRTYNYPQGRITDHRI--NLT
RF1_DECAR         ASALKVLAARIKDVQVRAQQAHISSTRKSLIGSGDRSERIRTYNFPQGRITDHRI--NLT
RF1_BORA1         DRAMQVLAARLKDKELRERQSKEAAERKSLVGSGDRSERIRTYNYPQGRVTDHRI--NLT
RF1_POLSJ         AKALQVLSARIVEKDRSERAAKDAAMRKGLVGSGDRSDRIRTYNFPQGRLTDHRI--NLT
RF1_VEREI         ARALQVLQARLQEKERSERAAKEAALRKGLIGSGERSDRIRTYNFPQGRLTDHRI--QLT
RF1_XYLFT         DKAMKRLKAQLIESQRSQQATAEAMTRKLQVGSGDRSQRIRTYNFPQGRITDHRVE-NLT
RF1_BUCAI         AKALSILSARVYAAKLEKDRQESSSMRKILLGTGERSDRNRTYNFPQNRITDHRI--NLS
RF1_BUCBP         AKALSVLVSRIKAAELYNQRKKNAIQRRDLLGTGMRSDRNRTYNFAQNRVTDHRI--NLV
RF1_BUCCC         EKALSVLSAKIYSKMNAEKKLKNSLMRKSLLGTGERSDRNRTYNFSQNRVTDHRI--NLT
RF1_BLOPB         AKALSVLGSRLHAIEMKRRQQEVSCTRRNLLGTGDRSDRIRTYNFQQGRITDHRI--SFT
RF1_BLOFL         SKALSVLKSRLYAINIKQKQQEESNVRRNLIGTGDRSDRIRTYNFQQGRVTDHRI--AFT
RF1_WIGBR         SKAMLVLKSRLQANLLKNKKQKEEIIRKSLLGSGDRSDRIRTYNFPQGRITDHRI--NLT
RF1_GEOMG         SKAMKVLKSRILDGLQQEQNARIAADRKQQVGSGDRSERIRTYNFPQGRMTDHRI--GLT
RF1_PELPD         AKAMKVLKTRIMDSIQQEQNARMAADRKQQVGSGDRSERIRTYNFPQGRMTDHRI--GLT
RF1_ARCB4         DRALKVLKAKLYEIEMEKKMEAEGATRKEQVGTGDRSGRIRTYNYPQNRISDHRI--NLT
RF1_CAMFF         DAAIKVLKARLYDMQERERREKESKERKDQVGTGDRSGRIRTYNYPQNRISDHRI--NLT
RF1_HELHP         DKALKILKARLYEAELEAQNAQNKEARKTQVGSGDRSERIRTYNYPQNRLTDHRI--GLT
RF1_WOLSU         DKALKILKARLYEAELEAKLSENSAARKLQVGSGDRSERIRTYNYPQNRLTDHRI--GLT
RF1_SULNB         DKAMKVLKARVYESELQKQLDETAGQRKLQVGSGDRSEKIRTYNYPQNRLTDHRI--GLT
RF1_TREDE         AKAMRVLRSRLYDLEESKKQAERAQNRKSQVGSGDRSERIRTYNFPQNRVTDHRI--NLT
RF1_TREPA         AKAMRVLRSRVYDLEESKRQVARARERKSQVGSGDRSERIRTYNFPQNRVTDHRV--RVT
RF1_CHLMU         AKAMRVLKARIRDAEVQKREQEASAMRSAQVGSGDRSERIRTYNFPQNRVTDHRI--GLT
F8L7A9_SIMNZ      AKAMRVLAARLAEEKMRKAQQERASLRSSQVGSGDRSERIRTYNFSQNRLTDHRI--NLT
RF1_PELLD         ERAMKMLMAKLYDIKLQEQQQERADMRRTMVASGDRSAKIRTYNYPQSRVTDHRIGF--T
RF1_CHLCH         ERAMQMLRTKLYDIQLAEQQQQRADLRRTMVATGDRSAKIRTYNYPQSRVTDHRIGF--T
RF1_PORGI         ELAMQMLRSKLYDIELSKHNEAIAARRKTMVSTGDRSAKIRTYNYPQGRVTDHRINM--T
RF1_PARD8         ERALTRLRSFIYDKEHQKYLDDIASKRKTMVSTGDRSAKIRTYNYPQGRITDHRINY--T
RF1_SYNPW         ERAMEILRAKLYERQLAEANARESSARRAQVGTGDRSEKIRTYNAKDNRVTDHRLG---R
RF1_SYNS3         ERALEILRAKLYERQLAEANASERSARRSQVGTGDRSEKIRTYNAKDNRMTDHRLG---R
RF1_PROMM         ERAMEILRAKLLERQIAEANARESSTRRAQVGTGDRSEKIRTYNYKDNRTTDHRLG---R
RF1_PROMA         ERALEILRAKLLEREIEEANAKERSARLAQVGTGDRSEKIRTYNYKDNRTTDHRLG---V
RF1_PROMP         ERAMEILRAKLYEIQLKEANAKERSQRLMQVGSGDRSEKIRTYNFKDNRTTDHRLG---S
RF1_SYNY3         ERAMQILRAKLYDMMLQEQNDAISSNRRSQVGTGSRSEKIRTYNYKDNRVTDHRLG---R
RF1_SALRD         SKAMRVLRSRVYEKKREEQQAEREEARRSMVGSGDRSAKIRTYNFPQDRVTDHRLEGGQK
RF1_ACIC1         ETALRILRSRLLALAQEEAEAQAAAQRRSQVRTVDRSERIRTYNFPENRISDHRV--NYK
RF1_KINRD         EQAMRILRARLHALAQEAADAQASAARRSQVRTVDRSERVRTYNYGENRIADHRT--GFK
RF1_NOCSJ         EQAMRILRSRLLAAAQEKADAEAGEARRSQVRTVDRSERIRTYNFPENRISDHRT--GYK
RF1_STRAW         EQAMRILRSRLLAAAQEEAEREAADARRSQVRTVDRSEKIRTYNFPENRISDHRV--GFK
RF1_FRACC         ESALRILRARLLGAAREKAESEASLARASQVRTVDRSERVRTYNFAENRISDHRV--GYK
RF1_ARTS2         EAGMRVLRARILAHQQEQIDAENSAQRKSQIRTMDRSERIRTYNYPENRIADHRT--GYK
RF1_CLAMS         EAGMRVLRARVLAKQQEEIDAEASAVRRSQIRTMDRSERIRTYNFPENRIADHRT--GYK
RF1_BIFLO         AAALRVLKSRLLAMKHEQEAAEAADMRHSQVRSLDRSERIRTYNFPENRIVDHRT--NYK
RF1_COREF         ARAMQVLAARLQALQKEEADAEAAEGRASQIRTMDRSERIRTYNWPENRISDHRI--GFK
RF1_MYCLE         TRALQVLAARLQAMAEEQALANASADRASQIRTVDRSERIRTYNFPENRITDHRI--GYK
D6ZDA5_SEGRD      ARAMVVLAARLEQLREEKAAAEAASGRKEQIRTVDRSERIRTYNFPENRITDHRI--GYK
RF1_RUBXD         EQALRILRSRLLEREMRERQEREGQMRLAQFGSGDRSAKIRTYNFPQGRITDHRV--GLT
RF1_DEIRA         EKALQVLTARLAERERAAREAQERQERASQVGSGDRSEKIRTYNYPQNRVTDHRLEGEDK
RF1_DEIDV         EKALVVLASRLAERERAARDAQEARDRAAQVGSGERSEKIRTYNYPQNRVTDHRLEGDSK
RF1_THET8         EKALMILRSRLLEMKRAEEAERLRKTRLAQIGTGERSEKIRTYNFPQSRVTDHRI--GFT
RF1_THEMA         QTALRILRARLYQLQKEQKEREISQKRKSQIGTGERSEKIRTYNFPQNRVTDHRI--NYT
RF1_CARHZ         ERAMKILRARLLDKARQEQEAELASARKSQVGTGDRSERIRTYNFPQNRVTDHRI--GLT
RF1_MOOTA         EKAMRVLRARLLDMARAEREGELAEERRSQVGSGDRSERIRTYNFPQNRVTDHRI--GLT
RF1_CLOAB         EKAMKVLRARLYEKAEAERNAGIAENRRNQVGSGDRSERIRTYNFPQGRITDHRI--GLT
RF1_CLONN         EKAMKVLKARLYEKAEAERSASISADRKSQVGTGDRSERIRTYNYPQGRVTEHRI--GLT
RF1_CLOPS         EKAMKVLRARLFEQAEAERLAGIAEDRKSQVGTGDRSERIRTYNYPQGRVTDHRI--NMT
RF1_CLOB8         EKAMKVLKSRLYEQAERERAQGIAEDRKSQVGTGDRSERIRTYNYPQGRITDHRI--GLT
RF1_CLOK5         EKAMKVLKSRLYEKAQEERNASIAEDRKNQVGTGDRSERIRTYNYPQGRVTDHRI--GMT
RF1_ALKOO         EKALKILRARLLDVLIQEQQAEIAQDRKSQVGTGDRSERIRTYNFPQGRITDHRI--NVT
RF1_CLOD6         EQALKILKARLYDKALAEQHKDIAAERKSQVGTGDRSERIRTYNFPQGRISDHRI--NLT
RF1_CALS4         ERALKILRAKLYEMALKEQQREIAEARKSQVGTGERSERIRTYNFPQGRVTDHRI--GLT
RF1_LAWIP         AKALKVLSSRLLQIKQEQQEIEQADARRALVGSGDRSERIRTYNFPQGRVTDHRI--NLT
RF1_SYNFM         AKALKVLRARLLDQMQSEQEARIARDRKSQVGTGDRSERIRTYNFPQNRVSDHRI--NLT
RF1_KORVE         EKGMRVLRARLYEVEQQKQADALAKERKQQVGSGDRSEKIRTYNFPQNRVTDHRI--GYT
RF1_SOLUE         AKAERVLRSRLYELELEKQQAALGAERRTMVGSGDRSEKIRTYNFPQNRVSDHRI--GLT
RF1_SYMTH         EKALRVLRARVADYYAQQAKSEEEQLRRAQVGTGERSEKIRTYNFPQDRVTDHRI--GLT
RF1_CHLAA         ERAMTVLRARLYAREQEKRQREIGASRLAQVGSGERAEKIRTYNFPQDRITDHRI--GQN
RF1_FUSNN         EKAMKHLLTKLYEMEQEKQRSEVESERRLQVGTGDRAEKIRTYNFPDGRITDHRI--KLT
RF1_BDEBA         ERAFQILYAKLQQIEDEKARKEASDVRLEQIGTGDRSERIRTYNFPQTRITDHRI--GLT
RF1_MYXXA         TMAMRMLRAKLYDIEQERIRNERDSARRAQVGTGDRSEKIRTYNFPQDRLTDHRI--GLT
RF1_BACP2         EKAMKVLRARIYDKFQREAQAEYDQTRKSAVGTGDRSERIRTYNFPQNRVTDHRI--GLT
RF1_BACCN         EKAMKVLRARIYDKFRQEAQAEYDQNRKQAVGTGDRSERIRTYNFPQNRVTDHRI--GLT
RF1_BACHD         EKAMKVLRARIYDKFQQEAQAEYDQTRKSAVGTGDRSERIRTYNFPQSRVTDHRI--GLT
RF1_GEOTN         EKAMKVLRARIYDKYQQEARAEYDQTRKQAVGTGDRSERIRTYNFPQNRVTDHRI--GLT
RF1_LISMO         DKAMKVLRARVYDKFEREAREEYDANRKSAVGTGDRSERIRTYNYPQNRVTDHRI--GLT
RF1_STAS1         EKALKVLKARLFDMKLQEEQQKYAAQRKSAVGTGDRSERIRTYNYPQSRVTDHRI--GLT
RF1_LACS1         EKAMKILKARVYDYYAQQEQSEYDANRKSAVGTGDRSERIRTYNYPQNRVTDHRI--GLS
RF1_LACSS         VKAMKILQARVYDYYESQNQSEYDSSRKSAVGSGDRSERIRTYNYPQNRVTDHRI--GLT
RF1_LACDA         AKAMEILKSRVYDYYESQNRDKYDAKRKNAVGTGDRSERIRTYNYPQNRVTDHRI--GLT
RF1_LACLA         DKAIKLLNTKVFDYYQQIELDKQNAERKSTVGTGDRSERIRTYNFPQNRVTDHRI--GLT
RF1_MYCGE         DKAMKMLRAKLWENAQNKQLSTQADLRKSQVGSGERAEKIRTYNYPQNRITDHRI--KLT
RF1_MYCGA         ETAMKMLRSKLWEAAEKEKNDALSALRKNQVGSGDRAEKIRTYNYPQNRVTDHRI--NMS
F6FHF2_MYCHI      AFAMKMLRSKLWEHEQEKQSKEIAETVRKQIGRGFRCEKIRTYNYPQNRITDHRV--SLT
RF1_MYCMS         DIAMTMLRTKVYEAEVEKQQAQADATRKNAVGTGARSEKIRTYNYPQNRVTDHRV--GLT
RF1_MYCHJ         EIAMGILKSKIYNLELQKQQQKQSDFRKLA-GSGARSEKIRTYNYPQDRLTDHRI--NFS
RF1_PHYAS         EKAFTLLKARIYNQILNAKQEAENKHRKSLVGTGDRSEKIRTYNYPQNRITDHRI--GLT
RF1_ONYPE         DKAFTILKTRIYNQMLTAKQEEENKHRKNLVGTGERSEKIRTYNYPQNRITDHRI--GLT
                    .   *   :                        *. : ****  . *  :**      

RF1_AGRFC         LYKLDRVIEGE-IDELVDALIADYQAGQLAQLGEQQL--------
RF1_SINMW         IYKLDRVMEGE-IDEIVDALLADYQASQLALLGEKQN--------
RF1_BARBK         LYKLDRIMEGD-LDELINPLISNHQTALLTEINDNA---------
RF1_RUEPO         LYKLDAVMQGD-LDEVIDALAADGQARMLAEMGQ-----------
RF1_RHOS5         LYALPQIMAGD-LAEVIAALTAHDQAARLAEMEA-----------
RF1_CAUVC         LYNLARIMEGDALDDVINPLIAEDQAERLASLEESFS--------
RF1_MARMM         LYKLDDIVAGDGLDEVVAALIAEDQAARLAALEDDA---------
RF1_HYPNA         LYSLDRIITGDKLGDVIEALITEDQSRRLASLEAGA---------
RF1_SPHWW         LHRLSEILEGPGLDDLVGALIAEDEAERLAQLDG-----------
RF1_ZYMMO         LHRLPEILAGPGLDEVISALIAEDEAERLASLDD-----------
RF1_SPHAL         LHRLPEILEG-AMDELIDALIAEDQAQRLAGLGE-----------
RF1_GLUDA         AYKIDRVMMGE-FDEFVDALTQDEQASLLAAEGL-----------
RF1_ACICJ         LHKIDRVMLGE-FDEIIDALTEEDQAARLAAAGA-----------
RF1_BRADU         LYKLPQVIAGEALGELIDALTTEHQAAQLAAQGAAA---------
RF1_WOLTR         SHQLEQIIKEGELDEFIEVLISRNEAERLAGES------------
RF1_NEOSM         TYRINETVKEGELEPIIEALIRENEARMLAGVEVGFSGDKS----
RF1_RICTY         LYKIDEVVKHGQLDEFIEALIANDEAKKLSEL-------------
RF1_MAGSA         LYKIDAVMSGDALDELVEALVAADQAERLAEME------------
RF1_FRAP2         LYKLDEVM-EGSLDSIIQPLILEHQADLLATMSDE----------
RF1_HAHCH         LYKLEEVV-QGDLDPVIQPLLQEYQAEMLASISE-----------
RF1_SACD2         LYKLDEVM-QGALGDVIQPLVNEYQADQLAALSE-----------
RF1_MARMS         LYKLDEIV-AGELDSLINPLVNEFQAEQLAALSGDN---------
RF1_COXBU         LYQLDEVI-EGDLDPVIGPLIRELQAEQLAELSGE----------
RF1_NITOC         LYKLDEIL-QGNLDAIIDPLVAEHQADQLAALSD-----------
RF1_ALKEH         LYRLEEIL-QGDLDQLVEPLRTEHQADQLAALAGD----------
RF1_HALHL         LYKLEQVM-EGGMDELLDGLTQEHQAEALAEIAEDSG--------
RF1_CHRSD         LYKLGDVM-AGELGEVIDPLIHEYQAEQLSALQAS----------
RF1_PSEPF         LYSLDEIL-AGGVEAVIEPLLAEYQADQLAAIGE-----------
RF1_ECOLI         LYRLDEVM-EGKLDMLIEPIIQEHQADQLAALSEQE---------
RF1_CROS8         LYRLDEVM-EGKLDALIEPIIQEHQADQLAALAEQE---------
RF1_SERP5         LYRLDEVM-EGKLDMLIQPIVQEYQADQLAALSAEPE--------
RF1_SODGM         LYRLDEVI-EGKLDMLIQPIMQEYQADQLAALSETP---------
RF1_HAEDU         VYRLDEVM-NGKIDELIQPIITEYQADQLAALSDQA---------
RF1_SHESH         LYRLNEVM-EGELDAILEPLMLENQADMLAALSEE----------
RF1_SHEFN         LYRLNEVM-EGDLNVLLDPIMLEHQADMLAALADD----------
RF1_SHEAM         LYRLNEVM-EGDLNALIEPIVQEHQADLLAALADEQG--------
RF1_COLP3         LYRLNEIM-EGSLQLVMEPIMQENQADLLAELAEQH---------
RF1_PSEA6         LYRLDDVV-AGDLDAVLEPIRQEHQADLLASLSDEG---------
RF1_PHOPR         LYRLNEVM-EGDMDSLIQPVIQEHQADELAAMAEQN---------
RF1_AERS4         LYRLGEIM-EGDLDCIISPMIQEYQADQLASLAENS---------
RF1_VESOH         LYKLTEIM-EGNLSAIIKPLIIEQQTNQLTELNNT----------
RF1_PSYWF         LYKLDAIM-EGDLTELLDALNREHQADLMASIGGGDD--------
RF1_PSYCK         LYKLDSIM-EGDLDEILDALLREHQADLMASIGGA----------
RF1_ACIAD         LYKLDAIM-EGDLTELLDSLHREYQADQLAMLAQENGG-------
RF1_THIDA         LYKIDAVM-DGDLGELLDALAAEHQAAQLATLSGEG---------
RF1_AZOSB         LYKLDAVM-QGELDELLAALVLEHQAEQLAALAEEGL--------
RF1_NEIM0         LHKLDFVM-DGDLAEITDALIAEHQAELLAAMGD-----------
RF1_CHRVO         LYKLDYVM-DGDLAELTDALIAEQQAELLAALGD-----------
RF1_DECAR         LYKIAAIM-DGDMDELLGALAAEHQADLLAELAEQN---------
RF1_BORA1         LYKLQQIL-EGDLNELTGALLAEHQAEQLAALGEDI---------
RF1_POLSJ         LYKLLAIM-EGDLGDVITALQVARGAEQLAELETASNGF------
RF1_VEREI         LYQLQQLL-DGELDPMLQALGHAREAEQLQELERG----------
RF1_XYLFT         LYDLPNII-EGDLDPLIDRLRQEHQAEELARLSNAP---------
RF1_BUCAI         IYKLDEVL-QGKLDLLIDPIIQEYQADMLSSLSKSES--------
RF1_BUCBP         VYCLDEVL-DGKLDVLIEPIIQEHNADVLSNLSNIEFL-------
RF1_BUCCC         IYRLNEVL-LGKLDLLIEPLLQEHQADLLSIID------------
RF1_BLOPB         SYKLNEIM-NGELDLLIQPIIHQHQSDQLNKLLELE---------
RF1_BLOFL         SYKLHDIM-NGKLDILIQPIMCKHQATLLDQLTREK---------
RF1_WIGBR         IYKIDEVM-DGNLNILINPILEKYELEKIKEILK-----------
RF1_GEOMG         LYRLDALM-EGDIAEVVDSLRAHYQMEALKAQAEAA---------
RF1_PELPD         LYRLDAIM-AGDIAEIVDALRAHYQMEALKAQSEE----------
RF1_ARCB4         LYRLDYIMNDGLFGEVIDPLIADHQSKLIEANGL-----------
RF1_CAMFF         LYRLDAIMAAGLFDEIIDPLIAHYQAEAIANAGL-----------
RF1_HELHP         LYSLEEIMLGGLLDEFINPLIAHAQSQAMGNIEQ-----------
RF1_WOLSU         LYSLEEIMLSGNFDQVVDPIVAHYQAEMMKESED-----------
RF1_SULNB         LYALDDVMNNGNLKLVIDPLIAHAQTEAIQEAGL-----------
RF1_TREDE         LYKLDAVM-QGSLDELIDALCIAAREEMMKAADHHLEHK------
RF1_TREPA         LYKLDAVM-QGALDDIIEPLCIASRESVI----------------
RF1_CHLMU         LYNLDRVM-QGELDMITTALVSHAHRQLFGHEETN----------
F8L7A9_SIMNZ      LYKLDHCD-GRGLRRSLSSPC------------------------
RF1_PELLD         SHGLPHFM-QGEIGELIDALKMHDQTERLQEAARA----------
RF1_CHLCH         SHALPQIM-QGELHEVIEALIMHDQAERLKSELQ-----------
RF1_PORGI         VYNLSAVM-DGEVQPFIDALIIAENVERMKEAAL-----------
RF1_PARD8         IYNLSAFM-DGEIQDCLDHLIVAENAERLKESEL-----------
RF1_SYNPW         NFSLDPVL-QGQMEDVIGACIAEEQRSKLEALSRQSDD-------
RF1_SYNS3         NFSLDPVL-EGQMDDVIDACIAEEQRGKLADLSEQAD--------
RF1_PROMM         NFSLEPVL-TGQLEELIGACIAEEQRHQLEELSHQEED-------
RF1_PROMA         NFPLETVL-EGELDDLIGACIAEEQRLKMEKLGNQSEE-------
RF1_PROMP         NFALEPIL-AGQLDDVIYACLAQEQKRMLEDFNENEN--------
RF1_SYNY3         NFDLNTAL-EGEIHTIIESCISQDQQERLAELAEATNN-------
RF1_SALRD         NHSLQPIM-DGEIDPIIDALRAEEHAEKLANL-------------
RF1_ACIC1         AYNLDQVL-DGDLDGVIQALVDADAAARLAAAEQDPTRPVLSRQR
RF1_KINRD         AYNLDTVL-DGDLDPVIQSAIDADEAAQLAATSV-----------
RF1_NOCSJ         AYNLDQVL-DGDLQPVLDSCVEADLAARLEALEQ-----------
RF1_STRAW         AYNLDQVL-DGDLDAMIQACVDADSAAKLAAA-------------
RF1_FRACC         AHNLDQVL-DGELDEVLDALAAADLDARLAAQAS-----------
RF1_ARTS2         AYNLDQVM-NGDLEPVIQSAIEMDEQARLDAIGE-----------
RF1_CLAMS         AYNLDAVM-DGALDPVVESCIQADEEARLDALGTDA---------
RF1_BIFLO         AYNLDAVL-DGDLQAVIDSDIQADEADRLANQK------------
RF1_COREF         ANNLDAVL-NGELDDLFTALRAAERAERLEADN------------
RF1_MYCLE         AHNLDQVL-DGDLDALFDALSAADKQSRLQQV-------------
D6ZDA5_SEGRD      ANNLDMVL-EGDLEAMLSELRLKLKADE-----------------
RF1_RUBXD         VHNLEAVL-GGELEEFTKALAAKERADRLAASATGSPG-------
RF1_DEIRA         NHPLDAVM-AGGLAPVVSALARAQREEQLLAMSQEGAEDQHGAA-
RF1_DEIDV         NHPLDSVM-AGGLGPVVSALARDERERQLLAASAE--EARDGAA-
RF1_THET8         THDLEGVL-SGHLTPILEALKRADQERQLAALAEG----------
RF1_THEMA         SYRLQEIL-DGDLDEIISKLIEHDIENNLEEVLGIGASVEEK---
RF1_CARHZ         LHRLDAVL-EGDLDEIIDALITTDQAERLKQVDGNA---------
RF1_MOOTA         LHHLDQVL-AGELDEIIDALVTTDQAERLKNMEA-----------
RF1_CLOAB         IYKLEQFL-DGDIDEVINGLITAEQAEKMKEMGNTKD--------
RF1_CLONN         LYKLEAFL-DGDMEEVIDALITAEQAEKMKAMGNN----------
RF1_CLOPS         LYKLDSFL-EGDIDEILNALITEDQAQKMKAMGNTEF--------
RF1_CLOB8         LYKLDTFL-GGDIDEMINALITADQAEKMKLMGNTQM--------
RF1_CLOK5         LYKLDSFL-NGDIDEIIDALITEDQAQKMKSIGSR----------
RF1_ALKOO         LYRLDSFL-NGDIQEMIDALITTDQAEKLKEVNS-----------
RF1_CLOD6         LYKLDAFL-DGDIDEMIDALITVDQTEKMTAI-------------
RF1_CALS4         LYKLQEVL-DGELDEIIDALILNDQAEKLKNMTLN----------
RF1_LAWIP         LYSLIKVM-EGEIQEFIDALSTHAQTEALKMQATQIAS-------
RF1_SYNFM         LYKLDIIL-GGALDEIIDPLSTHFQAEALRREE------------
RF1_KORVE         VHQLSEFM-DGKINALIEALTTHYQAEKLKEQTT--AVS------
RF1_SOLUE         LHQLDFVM-EGKMDAIVDALTEFYQAQKLKQQAEKGPVS------
RF1_SYMTH         VHNIAAVM-DGEIDHIIDALAQHEQAALLAREEA-----------
RF1_CHLAA         FSNLPAVL-DGELDKIIEALIIYDNAERLRASGVST---------
RF1_FUSNN         VHQLEAFL-DGDIDEMIDALITFHQAELLSASEQ-----------
RF1_BDEBA         IHQLDQVM-SGSFELLIDPLIANFQAEALKKQVSA----------
RF1_MYXXA         VHNLPGVM-AGDVEDVITACRTFYQAEALKAQTAGGPKPSA----
RF1_BACP2         IQKLDQILEG-KLDEVIDALIMEDQARKLQNAK------------
RF1_BACCN         IQKLDQILQG-KLDDFINALVMEDQAKKMEAAE------------
RF1_BACHD         LQKLEQILQG-KLDEIIESLIVHEQAELMKQQED-----------
RF1_GEOTN         IQKLDLVLDG-QLDEIIEALILDDQSKKLEQANDAS---------
RF1_LISMO         IQKLDQIMEG-KLDEIIDALILEDQTSKLEHLNDAN---------
RF1_STAS1         LQKLDQIMEG-KLDEIIDALTLAEQTDKLKELNNGEL--------
RF1_LACS1         LNKLDRIMNG-ELEDVIDALVLFEQTKAMEKLENE----------
RF1_LACSS         LNKLDRIMNG-ELGDVIDALILFDQTEKLEQLQDGTAHLS-----
RF1_LACDA         LNKLDRIMNG-ELDEVIDALTVYYQTKQLEELAENA---------
RF1_LACLA         LQKLDSILSG-KMDEVIDALIVYDQTKKLEELNK-----------
RF1_MYCGE         INKLNTVILG-DLDEIIEALQADEKKQQLEKFIS-----------
RF1_MYCGA         LNSLDRFMMG-EIDEMIDALRSKEQEEKMKLIMNE----------
F6FHF2_MYCHI      LNKLNEIMIGGDLTEIHESLLNQQAEESLSFIFTENN--------
RF1_MYCMS         LNKLDQVMEG-NIDEFIIALINEEQRQKVAEQLEKNNE-------
RF1_MYCHJ         -TSLKPIIQG-SLNPIIEALLAQEKTELILQNYANK---------
RF1_PHYAS         LQKLDIIMEG-KLDFIIEPLIDATQKEKLVQSE------------
RF1_ONYPE         LQKLDIIMEG-KLDLVIEPLIHEAQKEQLAQS-------------
                     :        .