CLUSTAL format seed alignment for MF_00094

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RF2_ECO57             ------------------------------------------------------------
RF2_ECOLI             ------------------------------------------------------------
RF2_SALTY             ------------------------------------------------------------
RF2_HAEIN             ------------------------------------------------------------
RF2_PASMU             ------------------------------------------------------------
RF2_AERHH             ------------------------------------------------------------
RF2_AERS4             ------------------------------------------------------------
Q0VP01_ALCBS          ------------------------------------------------------------
RF2_JANMA             ------------------------------------------------------------
C3X1D4_OXAFO          ------------------------------------------------------------
RF2_BORPA             ------------------------------------------------------------
RF2_NEIMA             ------------------------------------------------------------
RF2_BUCAI             ------------------------------------------------------------
RF2_BUCAP             ------------------------------------------------------------
RF2_BUCBP             ------------------------------------------------------------
RF2_RICBR             ------------------------------------------------------------
RF2_RICCN             ------------------------------------------------------------
RF2_CAUVC             ------------------------------------------------------------
RF2_ROSDO             ------------------------------------------------------------
Q5GSZ0_WOLTR          ------------------------------------------------------------
RF2_NEOSM             ------------------------------------------------------------
PRFB2_ARATH           MLSLIIRRSRSRFIIHGIKISCNSLSAVDSSSSVLVSRRTFSSTPALSYFGFNYGKISNL
M2R3G2_CERS8          -----------------------------------------------------------M
RF2_BACSU             ------------------------------------------------------------
RF2_LISIN             ------------------------------------------------------------
RF2_STAAN             ------------------------------------------------------------
RF2_LACPL             ------------------------------------------------------------
RF2_STRGC             ------------------------------------------------------------
RF2_LACLA             ------------------------------------------------------------
E7FX65_ERYRH          ------------------------------------------------------------
R4S0H9_PHYAS          ------------------------------------------------------------
B3R0C2_PHYMT          ------------------------------------------------------------
RF2_THEMA             ------------------------------------------------------------
RF2_THEM4             ------------------------------------------------------------
RF2_CLOP1             ------------------------------------------------------------
RF2_LEPIC             ------------------------------------------------------------
M6TI43_LEPIR          ------------------------------------------------------------
RF2_LEPBJ             ------------------------------------------------------------
I4B5R7_TURPD          ------------------------------------------------------------
RF2_NITSB             ------------------------------------------------------------
RF2_WOLSU             ------------------------------------------------------------
RF2_HELP2             ------------------------------------------------------------
RF2_HELPJ             ------------------------------------------------------------
RF2_HELHP             ------------------------------------------------------------
RF2_CAMC1             ------------------------------------------------------------
A7GZF0_CAMC5          ------------------------------------------------------------
RF2_CAMJE             ------------------------------------------------------------
RF2_CAMLR             ------------------------------------------------------------
RF2_SULDN             ------------------------------------------------------------
Q2S1N4_SALRD          ------------------------------------------------------------
G2SG74_RHOMG          ------------------------------------------------------------
A0M2C7_GRAFK          ------------------------------------------------------------
E6SVF9_BACT6          ------------------------------------------------------------
RF2_TREPA             ------------------------------------------------------------
RF2_BORBU             ------------------------------------------------------------
RF2_CHLTR             ------------------------------------------------------------
RF2_CHLMU             ------------------------------------------------------------
RF2_CHLPN             ------------------------------------------------------------
RF2_CHLAB             ------------------------------------------------------------
RF2_THET8             ------------------------------------------------------------
B4UIK0_ANASK          ------------------------------------------------------------
RF2_MYCSJ             ------------------------------------------------------------
RF2_MYCS2             ------------------------------------------------------------
RF2_MYCTU             ------------------------------------------------------------
RF2_NOCFA             ------------------------------------------------------------
RF2_RHOE4             ------------------------------------------------------------
RF2_CORDI             ------------------------------------------------------------
RF2_KINRD             ------------------------------------------------------------
RF2_STRAW             ------------------------------------------------------------
RF2_SACEN             ------------------------------------------------------------
RF2_SALAI             ------------------------------------------------------------
RF2_PSECP             ------------------------------------------------------------
RF2_ARTS2             ------------------------------------------------------------
RF2_BEUC1             ------------------------------------------------------------
Q8G536_BIFLO          ------------------------------------------------------------
A0A0G0MTZ5_9BACT      ------------------------------------------------------------
PRFB1_ARATH           -------------------------------MSMELTVLGPLAGRSFAIAGKPKLLLLRP
K3ZTA0_SETIT          --------------------------------MVDCPRLLLPAARVAAAVHYPRCTARSS
Q7VE10_PROMA          ------------------------------------------------------------
Q017H4_OSTTA          ----------------------------------------MIRARALCASGRSALNALAR
S4XGF3_SORCE          ------------------------------------------------------------
                                                                                  

RF2_ECO57             ------------------------------------------------MFEINPVNNRIQ
RF2_ECOLI             ------------------------------------------------MFEINPVNNRIQ
RF2_SALTY             ------------------------------------------------MFEINPVNNRIQ
RF2_HAEIN             ------------------------------------------------MFEINPVKNKII
RF2_PASMU             ------------------------------------------------MFEINPIRNKIS
RF2_AERHH             ------------------------------------------------MFEVNPVLNKLK
RF2_AERS4             ------------------------------------------------MFEVNPVLNKLK
Q0VP01_ALCBS          ------------------------------------------------------------
RF2_JANMA             ----------------------------------------------MEAERLNSLESLLA
C3X1D4_OXAFO          ------------------------------------------------------------
RF2_BORPA             ----------------------------------------------MEAERQNQLVARLE
RF2_NEIMA             ----------------------------------------------MEAEVINQLNNTLN
RF2_BUCAI             ------------------------------------------------MIENNMTTNQIN
RF2_BUCAP             -------------------------------------------------MEINIITNKIN
RF2_BUCBP             -----------------------------------------------MFKNNNIINDRIT
RF2_RICBR             --------------------------------------------------MRAEIENYVK
RF2_RICCN             --------------------------------------------------MRAEIENYVK
RF2_CAUVC             --------------------------------------------------MSRPLRPTS-
RF2_ROSDO             --------------------------------------------------MRADVQNTIE
Q5GSZ0_WOLTR          ------------------------------------------------------------
RF2_NEOSM             --------------------------------------------------MDFETQVVLH
PRFB2_ARATH           NQRFGNYAYSGSSFASSTRSLSSEAVAVAATCDGLTVERIIANQWPILDENEGDWKSHAA
M2R3G2_CERS8          LRNALVARSNYRSLSCQASKFTYASLLYSRLRTRQYAAATPKAAAVQARERLTAIRNGLQ
RF2_BACSU             -------------------------------------------------MELSEIRAELE
RF2_LISIN             -------------------------------------------------MELAEIRNELE
RF2_STAAN             -------------------------------------------------MELSEIKRNID
RF2_LACPL             -------------------------------------------MKEGSFVELSEYKHLIE
RF2_STRGC             -------------------------------------------------MDISEIRQKID
RF2_LACLA             -------------------------------------------------MELSEIRNLLE
E7FX65_ERYRH          ------------------------------------------------------------
R4S0H9_PHYAS          -------------------------------------------------MEKYEINQHLE
B3R0C2_PHYMT          -------------------------------------------------MEKYEINLILD
RF2_THEMA             -----------------------------------------------MGMISFETKTKIE
RF2_THEM4             -------------------------------------------------MIDYELKQRID
RF2_CLOP1             -------------------------------------------------MELENQLSKLH
RF2_LEPIC             ----------------------------------------------MEVKSAKELKRISK
M6TI43_LEPIR          --------------------------------------------MIMEVKSAKELKRVSK
RF2_LEPBJ             ----------------------------------------------MEVKSAKELKRVSK
I4B5R7_TURPD          -----------------------------------------------MAQSLKEVKGSLA
RF2_NITSB             -------------------------------------------------MDSYEYSELLK
RF2_WOLSU             -------------------------------------------------MDSYEYGELLK
RF2_HELP2             -------------------------------------------------MDNYTYSELLK
RF2_HELPJ             -------------------------------------------------MDNYTYSELLK
RF2_HELHP             -------------------------------------------------MDSYEYGELLK
RF2_CAMC1             -------------------------------------------------MDSYEYNELLK
A7GZF0_CAMC5          -------------------------------------------------MDNYEYTELLK
RF2_CAMJE             -------------------------------------------------MDNYEFSELLK
RF2_CAMLR             -------------------------------------------------MDNYEYSELLK
RF2_SULDN             -------------------------------------------------MDNYEYTELLK
Q2S1N4_SALRD          ---------------------------------------------MKSYSDEDLEQLAE-
G2SG74_RHOMG          -------------------------------------------------MQEKIQSLLE-
A0M2C7_GRAFK          ------------------------------------------------------------
E6SVF9_BACT6          -----------------------------------------------MITAEQLKDIKE-
RF2_TREPA             -------------------------------------------------MVHKSPPSRR-
RF2_BORBU             -------------------------------------------------MKEKINTLLK-
RF2_CHLTR             -------------------------------------------------MHENFDKRLEL
RF2_CHLMU             -------------------------------------------------MHENFDKRLEL
RF2_CHLPN             -------------------------------------------------MQENLDKRLEA
RF2_CHLAB             -------------------------------------------------MHESLDKRLEG
RF2_THET8             -------------------------------------------MRLASQSAILVKVWTWN
B4UIK0_ANASK          --------------------------------------------------MASPTAERIA
RF2_MYCSJ             --------------------------------------------------MDPDRQADIA
RF2_MYCS2             --------------------------------------------------MDPDRQADIA
RF2_MYCTU             --------------------------------------------------MDPDRQADIA
RF2_NOCFA             --------------------------------------------------MHPDVSADLA
RF2_RHOE4             --------------------------------------------------MHPDVIADLN
RF2_CORDI             --------------------------------------------------MRPETQSAVT
RF2_KINRD             --------------------------------------------------MAIDFPSEIS
RF2_STRAW             -------------------------------------------------MAVVDVSEELK
RF2_SACEN             --------------------------------------------------MNPDVAADLK
RF2_SALAI             -------------------------------------------------MTDADFAEQLK
RF2_PSECP             -------------------------------------------------MANIDFSAEIR
RF2_ARTS2             -------------------------------------------------MAQIDFSAEIR
RF2_BEUC1             --------------------------------------------------MATDFPAEIS
Q8G536_BIFLO          -------------------------------------------------MAEFDFTQAIG
A0A0G0MTZ5_9BACT      ----------------------------------------------------------MD
PRFB1_ARATH           TNLPLLRLSLPLSLPNFSSSSRFNSPIVFAAQESNLSVSNENETSEWLMQDFYTLRKDVE
K3ZTA0_SETIT          FNPGRSPFSVCFSRRRRNP---IPVQSASAGTGSQSSVADEPEAAEWAMQDFYALRKEVE
Q7VE10_PROMA          ------------------------------------------------------------
Q017H4_OSTTA          DLK-------------------------SNSRLVQASSANARTNSSFDFETVGAVRRRLG
S4XGF3_SORCE          ------------------------------------------------------------
                                                                                  

RF2_ECO57             DLTERSDVLRGYLDYDAKKERLEEVNAELEQPDVWN-EPE---RAQALGKERSSLEAVVD
RF2_ECOLI             DLTERSDVLRGYLDYDAKKERLEEVNAELEQPDVWN-EPE---RAQALGKERSSLEAVVD
RF2_SALTY             DLTERTNVLRGYLDYDAKKERLEEVNAELEQPDVWN-EPE---RAQALGKERSSLEAIVD
RF2_HAEIN             DLSDRTSVLRGYLDFDAKVERLEEVNGELEQPDVWN-DPD---KAQALGKERVSLEQVVN
RF2_PASMU             DLTERTQVLRGYLDFDAKVERLEEVNAELEQPDVWN-EPE---KAQALGKERVALEGVVN
RF2_AERHH             ELSERTELLRGYLDYDAKKERLEEVNAELEQPDVWN-EPE---RAQALGKERVALENVVG
RF2_AERS4             ELSERTELLRGYFDYDAKKERLEEVNAELEQPDVWN-EPE---RAQALGKERVSLENVVG
Q0VP01_ALCBS          -MSKRS---GGIFDYVQKSERLTEVERELESPDVWN-DPP---YAQALGKERSQLEGVVK
RF2_JANMA             DLTTRATELRRYLDFDVKSEKLDQVNGELEDPDVWN-DQK---RAQDLGKEKKSLEAIVH
C3X1D4_OXAFO          ----MKPPYGGIFDFAAKSDKLEQVNAELEDPAVWN-DPK---KAQELGREKKSLENVVL
RF2_BORPA             DYAEREQALRRYLDYDAKSERLQVVNAELEDPAIWN-DPK---HAQDLGREKKSLEDVVE
RF2_NEIMA             DLEKRSEDIRVYMDYQGKKDRLEEVIGLSEDPELWN-DPK---RAQEIGKERKILEGIVL
RF2_BUCAI             SLNRRVQDLKRYLDYNKKKSRVLEIDLELSSPKTWT-EQI---SIKKLNKEKYLLNSIIQ
RF2_BUCAP             KLIQRKKDLKRYLDYVAKSTRILEIDLELSSTEIWK-KKE---YVHNLNKEKNLLNIIIN
RF2_BUCBP             NLVSQINKLKRRLDYDIKKNRLLEINMELKLPETWK-HPS---LIKKINKEKNQLISVVT
RF2_RICBR             KIEQSLELLRRSLDVETSAARLAELEELAASPDLWN-DQA---NAQKLLREKSNLEEQLG
RF2_RICCN             KIEQSLELLWRSLDVEASTERLNALEELTADPSLWN-DQA---NAQKLLREKSNLEEKLN
RF2_CAUVC             --SSPWDCSGGVFDWDVALRKLDELNARVEDPTLWD-RPS---EAQAVSRERANLAAKVE
RF2_ROSDO             KIQKSLDLLAQRLDVETAPYRLEEFNARVEDPTLWD-DPD---AAQKLMRERQMLVDAMA
Q5GSZ0_WOLTR          -------------------MRLEKLESQTADGNLWQ-DNQ---KAQEVLKEYSKIKNDVE
RF2_NEOSM             NLKKSVEVIRRQLDIEKKHSRLEEIQALVDSPTLWE-DQS---RAQLLLKEKSQIETSLK
PRFB2_ARATH           AIAQSIQVIKRRLQWKKLLVRLKVLSAELNKSDLWD-DPT---HAGKISREHGSLTGKMK
M2R3G2_CERS8          DVSELLKDINEHADWAGVQAELQKLQDVLKDDTTWVHDTA---TALKTQTRVAQLEKQME
RF2_BACSU             NMASRLADFRGSLDLESKEARIAELDEQMADPEFWN-DQQ---KAQTVINEANGLKDYVN
RF2_LISIN             KTAQQIKDFRGSLDLDSMEVRIAELEDQMLDPNFWN-DQQ---AAQKVINESNGYKETYQ
RF2_STAAN             KYNQDLTQIRGSLDLENKETNIQEYEEMMAEPNFWD-NQT---KAQDIIDKNNALKAIVN
RF2_LACPL             EMQSAVDDFRGSLDLDALNESIQENEARMAEPGFWD-DQA---AAQKVIDENNVLKGKYD
RF2_STRGC             ANREKLASFRGSLDLEGLEEEIAILENKMTEPDFWD-DNI---AAQKTSQELNELKQTYE
RF2_LACLA             GYAEKINGFRESLDLERLEEEIALLENDMAQPEFWN-DQA---AAQKVIDESNALKAKYD
E7FX65_ERYRH          ---------MIHFDLAQKEAKIKELESEMVEDGFWD-DHR---HSSQHIQKLNQLKKVVE
R4S0H9_PHYAS          NIAQNLRDLKEAINLSESYQTLNQINELMQKKDFWD-DPK---KAVATSQKFNDLQEKIN
B3R0C2_PHYMT          NLKKILDDLEIGMNLNKQKKRLKDLNHLINLSNFWE-NFE---KAKKINQEFKSLNEKIY
RF2_THEMA             ELEKKYKDVLSVVNEDEINKELEEVEKKLTDPSVWD-DQK---KAREYTQKLKRLKNISE
RF2_THEM4             EVKKRYEDIVKVFHPEDKKKELEELEKLMGESDFWN-DQK---RAKEISQNAQRIRKIID
RF2_CLOP1             ELKNNLKEMGASLCLASLEKKSAELELKMQEAGFWD-DVQ---KAQEVTQEAKRVKDKID
RF2_LEPIC             ELQENFLNRWKLLNLEQDKDRLKSLTEKAEDPNLWN-NPE---EARLVSQKKNELEKKLN
M6TI43_LEPIR          ELQENFLNRWKLLNLEQDKDRLKSLTEKAEDPNLWN-NPE---EARIVSQKKNELEKKLI
RF2_LEPBJ             ELQENFLNRWKLLNLEQDKDRLKALNEKSEDPDLWN-NPE---EARIVSQKKNELEKKLT
I4B5R7_TURPD          ALRDQIDARYTELNLKDVEAELGDLNKKMEDPRLFA-DDSRVGEVRELQTRIAVLERKIS
RF2_NITSB             KLEQKIENIKNIIKPDLITKRLKEIEQLENSPDFWN-DAK---KAGEIQKEKNRLSRILE
RF2_WOLSU             ELSTKRDNIAKIIKPDSIENRLGEIEALEHSEGFWN-DAT---KAGEVQKEKRKLERILK
RF2_HELP2             SLQNKCDNIALIIKPEKIKQELERIEKEQEDPNFWQ-DVL---KARDTNKEKVRLNRLLE
RF2_HELPJ             SLQNKCDNIALIIKPEKIKQELERIEKEQEDPNFWQ-DVL---KARDTNKEKVRLNRLLE
RF2_HELHP             TLHNKCENIAKILNPTSLQKQLKDIENLEQDEHFWN-DSK---RAAEVAKQKRKCERMLQ
RF2_CAMC1             KLQTKVENIGSIVKPDDIKARLKEIEAIEQDPDFWQ-DIA---RAGALNKEKTKISNMLA
A7GZF0_CAMC5          RLNTKVENIGSIIKPQSIKERLQEIERLEHEPDFWQ-DIA---KAGALNKEKTKISNMLA
RF2_CAMJE             TLKNKVGNIASIIKPENIQTRLKEIEELENSPSFWS-DVK---QAGIIGKEKTKITNLLK
RF2_CAMLR             KLKNKVGNIASIIKPEEIKARLKEIENLENSPSFWS-DVK---QAGIIGKEKTKISNLLK
RF2_SULDN             NLSKKMSNITGVVEPDKLYKRVAQIDELENSQDFWN-DSS---NAALVQKDKTQCERKLK
Q2S1N4_SALRD          ----RVEALGGYLDVDGRRMTVEELNQERMDPDFWD-DPD---RAREIEKRIAREEEWIE
G2SG74_RHOMG          ----RVDTLGRFLDIPGRKEKIAKLNEERLAPGFWD-NPE---RAREIEKQIAEEEAWVA
A0M2C7_GRAFK          ---------------------MEE---KTFAPDFWD-DPK---KAEQIMKEVNAEKSWVG
E6SVF9_BACT6          ----RTEALNRYLDIEGKKIQVEEEQLRTQAPGFWE-DQK---AAEAQMKKVKGLQQWIS
RF2_TREPA             ----ACRKYGGVFDVAAYEARIATLEAAAAAPDFWS-ERA---RAEALLAELKTLRATLE
RF2_BORBU             ----HAEDIWRKLCKNEIQAKIEKYEKEINQKNFWN-DPK---RAQKVIKAQSILKNKID
RF2_CHLTR             LLEGLALTRRSLFDPEGKENELKELEQQAVQDGFWD-DVV---RAGKISERIARLKQQLS
RF2_CHLMU             LLEGLSLTRRFLFDPEEKETELKNLEQLSIQDSFWD-DVS---RAGRISEKIARLKQQLL
RF2_CHLPN             LRTEISLAARSLFDLDKKQKELQVLEEESSEENFWQ-DSV---HAGKISEQIVSLRRQIQ
RF2_CHLAB             LLTGLALAGRSL-DLEGKRQELSILEEQTLKEDFWQ-DVT---SAGKVSERIVSLKRQIA
RF2_THET8             ASRNAWKASGGIFDIPQKETRLKELERRLEDPSLWN-DPE---AARKVSQEAARLRRTVD
B4UIK0_ANASK          ELSRRLEALRGSLDVERKELRVAEISKLSEDPAFWTDNVK----AQALLKEKAQLEQVTQ
RF2_MYCSJ             ALAATLTTVERVLDVDGLRDRIQKLEQEASDPNLWD-DQS---RAQKVTSELSHAQNELR
RF2_MYCS2             ALDTTLTTVERVLDVDGLRNRIEQLEKDASDPNLWD-DQT---RAQKVTSDLSHAQNELR
RF2_MYCTU             ALDCTLTTVERVLDVEGLRSRIEKLEHEASDPHLWD-DQT---RAQRVTSELSHTQGELR
RF2_NOCFA             ELDATLKTVESVLDIEELRRRIDELEHQAADPDLWN-DQD---HAQRVTSELSHAQGELR
RF2_RHOE4             ALDTTLRTCESVVDVEELRRRIDELEHQAADPGLWN-DQE---HAQQVTSQLSHAQAELR
RF2_CORDI             QLDSTLTTIEKVMNPEDLESRVRELEQQASDPTLWD-DPD---TAQKVTTELSSVQAKLK
RF2_KINRD             ALRTTYASIREVSDLDALRKELADLNDEAAAPSLWD-DPE---HAQTVTSRLSAVQAELD
RF2_STRAW             SLSSTMESIEAVLDLDKLRADIAVLEEQAAAPSLWD-DPE---AAQKITSKLSHLQAEVR
RF2_SACEN             ELSTTLEGIESVMDLDALRAKIAELEEEAARPDLWD-DVE---HAQRVSSQLVHRQSELR
RF2_SALAI             DLDTTLRNIESVLDIDRLRADKARLEEAASAPDLWD-DQA---RAQQVTSQLSYVNGEIT
RF2_PSECP             ALRATYESIERVTDMEALREDIAELSERAGEPDLWD-DPA---AAQKITSRLSHRQSELE
RF2_ARTS2             ALRATYSSIENVSNVEELKEDIAELSERAGEPNLWD-DPA---AAQKITSRLSHRQSELE
RF2_BEUC1             ALRGTLEQITAVTDPDALRARIAELSEAAAAPDLWD-DPD---AAQKVTSRLSHTQSELE
Q8G536_BIFLO          EARAKYESIAKALDVDRLKADIKDLETQAAAPGLWD-DPE---NAQKITSRLSAAESQLK
A0A0G0MTZ5_9BACT      DLKSRFEKISQSFDRDKMQGEIRALEAQMMQPGFWD-DRQ---RAEVVSRQLSDKNKTLE
PRFB1_ARATH           IASARVEEIRASANLQQLEQEITNLESKATDTSFWD-DRT---KAQETLSSLNDLKDRMR
K3ZTA0_SETIT          LAIERVSEVRQSAGLEQLKEEIASLEKKSADSSLWD-DPS---KAQEILVSLTELKDRVK
Q7VE10_PROMA          -------MLRTVFDVPVLNALQVDLEQIAAQPDFWN-DQQ---KARKQMRQLDEVKDQLT
Q017H4_OSTTA          ELERRVDSALEIADVKGLKMRFESLDERSSAGDLWE-DAN---KARVVMAELAGVREELD
S4XGF3_SORCE          --------------------MLQDLTQTTLSSGFWN-DQE---KAQAVLRKRAQVEAKLE
                                                        :                         

RF2_ECO57             TLDQMKQGLEDVSGLLELAVEADDE----ETFNEAVAELDALEEKLAQLEFRRMFSGEYD
RF2_ECOLI             TLDQMKQGLEDVSGLLELAVEADDE----ETFNEAVAELDALEEKLAQLEFRRMFSGEYD
RF2_SALTY             TLDQMTQGLDDVSGLLELAVEADDE----ETFNEAVAELNTLEEKLAQLEFRRMFSGEYD
RF2_HAEIN             TIKNLEQGLEDVDGLLELAIEAEDE----DTFNEAVAELDELEQQLEKLEFRRMFSGEHD
RF2_PASMU             TIHTLDQGLEDVEGLLELAIEAEDE----ATFHEAVAELEELEQQLAKLEFRRMFSGQHD
RF2_AERHH             TIDTLTQGADDVAMLVELAVEGEDE----DTFNEAVAEADVLETKLVDLEFRRMFSGQHD
RF2_AERS4             TIDVLTQGAEDVEMLVSLAVEGEDE----DTFNEAVAEADVLETKLVDLEFRRMFSGQHD
Q0VP01_ALCBS          TIDDASQGLEDTSALLDLVVEEGDE----DTLSEVESDLRDLEKMVADLEFRRMFSGQMD
RF2_JANMA             TLIKIDSELNDARDLFEMAREEKDE----DTIVAIENDAQELLKLVEGMEFRRMFSNPMD
C3X1D4_OXAFO          SLSHIKSALTDAGELFEMAKEEQDD----ETLKAVEADVSELQDRIEKLEFRRMFSNPMD
RF2_BORPA             TLTELGSGLADSCELVELALADSDD----ATLEAIEHDVDRFQEKLETLEFRRMFANPAD
RF2_NEIMA             TLDNIATGIEDNRMLIEMTVEENDE----EGFAAVQEDVAGLEKQMADLEFKRMFNQPAD
RF2_BUCAI             NINEIEENIKEVVIFLELAIETQDN----LVFKESLLEIQKIEQEIKKLEFYRMFSKKND
RF2_BUCAP             KINNIEKNIKEMIIFLDLAIETKDN----AIIQEISEEIKKIAEKIQELEFYRMFSNQHD
RF2_BUCBP             QITKIDNDVQELIDILNLENSNNIN----SILDNVLYEFKNIEKSIHELEKCSMFLGKYD
RF2_RICBR             AYNKIRSNLKDALELEEMAEAENDL----EIMQQVEKDLQSLSTIAAKFETECLFSGEAD
RF2_RICCN             AFNKLKSNLKDALELEEMAEAENDL----ETLSQIEQDLKNLSIIAAKFETECLFSGEAD
RF2_CAUVC             AVQSIERDLKDALEYAELAEMESDE----DSLNDARAQLKSLKERAGRAELEALLSGEAD
RF2_ROSDO             THDSIKQEMADNIELIELGEMEDDA----DVVSDAENALRALEETAAKKELEALLDGEAD
Q5GSZ0_WOLTR          SFSKLESDYNDAISLMKSAIDENDE----EFFSEVENELVKLEKLIKRKETDFLFTDEAD
RF2_NEOSM             EFKELSIQLDDLIEMIELASKDHEE----ETMKDLERELLLLKEKIQKKEIECLFSGEAD
PRFB2_ARATH           GVMTFERELLEHIDMLKLAKEENDS----ELESETLKALIDMRRVSKEKELEALLSADND
M2R3G2_CERS8          TYQRIHTSHDALQDLASLAEETEDE----QMLDEIAPELEELQTTTDRYLISLWLSEPVD
RF2_BACSU             SYKKLNESHEELQMTHDLLKEEPDT----DLQLELEKELKSLTKEFNEFELQLLLSEPYD
RF2_LISIN             AFHALEEEQESMEISLELLKEEADE----DLQAELEKDIKAYVATISEFELKLMLSDPYD
RF2_STAAN             GYKTLQAEVDDMDATWDLLQEEFDE----EMKEDLEQEVINFKAKVDEYELQLLLDGPHD
RF2_LACPL             TFKQLADEVGDLAVAYELLSEEPDA----EMQAEFETDFQHAEHDLQQYRLNLLLDGPYD
RF2_STRGC             NFHQMTDLFDESEILLDFLAE--DD----SVQEELEEKLAELEKMMTSYEMTLLLSEPYD
RF2_LACLA             NYQAMNNMLEEAQTMLEMLQEEADE----EMQAELEEMTIALGQKIESYELEIMLNQPYD
E7FX65_ERYRH          THHDLLERLMSCSDSILLLKEEADE----EFQNSLEVEVKEIQKEMESFSVLVLLSHDYD
R4S0H9_PHYAS          TLKHLETNHQDLVTFLDLESN--QN----NETAFLEEEIKKLIDAVLNFKIKVFLNQPYD
B3R0C2_PHYMT          KMQKFHEEYRDLLSLLKITKE--NT----DDFLFLEQTLLSLKKNIQDFEINILLNQTYD
RF2_THEMA             DLKRVRSLFEDLEVAIELSDE--DQ----EMAQHVEEIVQELEGAVKKLELEIILNGKYD
RF2_THEM4             DMVDIENKLEDLEAGLELLEE--DA----TFLDTIKQLIDDIERKVKTFELELILNEKFD
RF2_CLOP1             KFKNLNERIDDVEVLKELMEEN-DE----ETAKEIISEVKALSKEIDTLKIETILSGEYD
RF2_LEPIC             PWFTIQQDILDFPDLVDLTLDEKGE----NGVGELSSEYNRLQEKFEELELLGALKNPED
M6TI43_LEPIR          PWFNIQQDILDFPDLVDLTLDEKGE----NGVGELSSEYNRLQEKFEELELLGALKNPED
RF2_LEPBJ             PWFTIQQDILDFPDLVELTLDEKGE----NGIGELSMEYNRLQEKFEELELLGALKNSED
I4B5R7_TURPD          SWKALKAEIADALEYAEIAEMENAE----NMAAELEQRGTDARATFDKLDLESLLTGPDD
RF2_NITSB             KFEEARSSVEDAKDLFEMATEEEDT----ETLNMLFEEAPTLEEKVNKIEIETMLSGEND
RF2_WOLSU             KYEEANQAINDAKELFEIATQDNDE----ETLGLLFEESGHLEKEIKSVEIEVMLSGEHD
RF2_HELP2             TYQKTKDSLDESVELFELAQNDNDE----VTLSLLYEEAPTLEHSVQKVEIEIMLSGEND
RF2_HELPJ             TYQKMKNSLDESVELFELAQNDSDE----VTLSLLYEEAPTLEHSVQKVEIEIMLSGEND
RF2_HELHP             TYTNTKQEIDDALELYEIAMSEEDS----RTLELLFEQAPSLLSHIQKVEIEVMLSGEND
RF2_CAMC1             KFSDANQAVSDAKELFELANSENDE----ETINSLFEDAKNLDEKIVNLEISMLLSGEDD
A7GZF0_CAMC5          KFTNAKAAVDDAKELYELANSESDE----ETLNSLFDDATELENKITALEISMLLSGEDD
RF2_CAMJE             NYENAFNALNDASELFDLANSENDT----ETLEALFNDAPKLEDTITSLEISMLLSGEND
RF2_CAMLR             NYENAFNALNDASELFDLANSENDL----DTIQALFDDAPNLEDLIVSLEISMLLSGEND
RF2_SULDN             KYNLAKNAIDDAKELYEMAKEENDE----DLIAECFNGAQHIEDLIRTMEIEVLLSEETD
Q2S1N4_SALRD          AWEDVKEQAEDIETLQLLSEEE-GE----DMSDEIDAEARKLEQKLDRLELESLLDDPDD
G2SG74_RHOMG          AWEQLRRQADDVQTLLELQQEEPDA----NLEEEIAREVARLEQQLDELELRSLLTDPDD
A0M2C7_GRAFK          DYEKAETLVEDLEVIYDFYKED--E----ATAEDVQQRNDKAVELIEDLEFKNMLSEEGD
E6SVF9_BACT6          GYNGVKTLTDEVQLAFDFYKDE--L----VSEEEVDEAFAKASAAVEALELKNMLREEAD
RF2_TREPA             PWRALRRESADLRALYELAREAQDA----SLEPELSSLFSDISARFEEASLTRLLHEEVD
RF2_BORBU             PWEELINKIKDLSDLCEIAENEKD-------TNGLEIEFNTLEKQYKDLLTISYFKEELD
RF2_CHLTR             EFNELKNKVSAIQFFLEDEESSKDL----EMQKELEKEFVFCEKKITEWETLRLLSGELD
RF2_CHLMU             EYNELKNKINSIKFFLEDEESSKDL----EIQKELEKEFIFCEKKIAEWETLRLLAGELD
RF2_CHLPN             EYQELKSKIDAIEFFLEDADALEDP----AICEDLEKEFLFCEKKLAVWETQRLLSGEAD
RF2_CHLAB             HYEEFKVRVENLAFFLNDGDVSADP----ELREDLEKEFTICEHILSEWETQRLLSGEVD
RF2_THET8             TFRSLESDLQGLLELMEELPAE--------EREALKPELEEAAKKLDELYHQTLLNFPHA
B4UIK0_ANASK          ACAAVRRALDDAQALSELAEEARDD----ATRAEAAEAAEAVGRQLEGLELQKMLSGPHD
RF2_MYCSJ             RVEELRQRVEDLPVLYEMAAEEEGQD-AENAGAEADAELAKLRVDIEAMEVRTLLSGEYD
RF2_MYCS2             RVEGLRQRLDDLPVLYELAAEAGGP----DEVAEADAELAKLREDIEAMEVRTLLSGEYD
RF2_MYCTU             RVEELRRRLDDLPVLYELAAEEAGAA-AADAVAEADAELKSLRADIEATEVRTLLSGEYD
RF2_NOCFA             RVEDLRRRLEDLPVLYELAEGEEGEA-RTAALEEADAERAALHSDVEAMEVRTLLSGEYD
RF2_RHOE4             RIVALRERLDEMPILYELAE-DEG----PDAVADADAERASLRDDIAAMEVKTMLSGEYD
RF2_CORDI             KLSTLRQRIDDLPVMYELADEEGE-----DALALADEELAELTADVEALEVKTMLSGEYD
RF2_KINRD             RIEKMGGRIDDLEVLVELSEDEHDA----DSLAEAETELNEVKEQLAQLEVRTLLSGEYD
RF2_STRAW             KAEALRGRIDDLSVLFEMAEEEDDP----DTRAEAESELTAVKKALDEMEVRTLLSGEYD
RF2_SACEN             KIKDLRQRVEDLEVLYELSEDEGDD----SGLAEADSERTKLKKDLEALEVRTLLSGDYD
RF2_SALAI             KLTDLRSRLDDTQVLLELAEAESDP----GVLTEVAAEITGLAKSIDEMEVRTLLSGEYD
RF2_PSECP             RLTTLASRIDDLEVLVELGQDEGDA----DSMGEAAAELESIQKALKNLEVVTLLSGEYD
RF2_ARTS2             RLNTLVSRIDDLEVLVELGQDEDDA----DSMGEAAAELESIRKSLKDLEVVTLLSGEFD
RF2_BEUC1             RLDTLRSRIDDLETLVQLAAEEDDA----DTLAEAEAELTKIRTSMGELEVRTLLAGEYD
Q8G536_BIFLO          RLNSASQRIDDVETLVELGHEEGDQ----DSLDEAQSEIGEIQKDLDQMEIQTLLDGEYD
A0A0G0MTZ5_9BACT      TLESLEQNLDE--------------------------------KLLKEFELKTFLSGPHD
PRFB1_ARATH           LLSEFKTMVEDAETIVKLTEEMDS--TDVSLLEEAMGIIKELNKSLDKFELTQLLSGPYD
K3ZTA0_SETIT          LLNDFKSQVEEAETIVKLTEELDS--IDTGLLEEASNIIKSFNKALDNFETTQLLSGPYD
Q7VE10_PROMA          KLANWNAAIEDAKVSLELYELEP----DNEMIEEAQIGLCQLKTELDLWELERLLSGPYD
Q017H4_OSTTA          AARAFEEHVSDAKTALELAEVGESDNEMSEMLCEAMASVEALDEALEQWELRRLLGGKYD
S4XGF3_SORCE          MAQKLGREIEDLAEYLELGAAEG----DEGVIADADAQADAIAARLRKAELDRMLSGPAD
                                                                            :     

RF2_ECO57             SADCYLDIQAGSGGTEAQDWASMLERMYLRWAE-SRGFKTEIIEESEGEVAGIKSVTIKI
RF2_ECOLI             SADCYLDIQAGSGGTEAQDWASMLERMYLRWAE-SRGFKTEIIEESEGEVAGIKSVTIKI
RF2_SALTY             SADCYLDIQAGSGGTEAQDWASMLLRMYLRWAE-ARGFKTEVIEESEGEVAGIKSATIKI
RF2_HAEIN             ACDCYVDLQAGSGGTEAQDWTEMLLRMYLRWAE-SKGFKTELMEVSDGDVAGLKSATIKV
RF2_PASMU             AADCYVDLQAGSGGTEAQDWTEMLLRMYLRWAE-SKGFKTELMEVSDGDVAGIKSATIKV
RF2_AERHH             PSDCYIDIQSGSGGTEAQDWANMVLRMYLRWGD-AHGYKPELIECSEGDVAGIKSATIKF
RF2_AERS4             GSDCYIDIQSGSGGTEAQDWANMVLRMYLRWGD-AHGYKPELIELSDGDVAGIKSATVKF
Q0VP01_ALCBS          PCSAYLDIQSGSGGTEAQDWAEMMLRMYLRWGE-AHGFKTELVEASAGDVAGIKSATVRF
RF2_JANMA             ANNCFIDIQAGAGGTEAQDWASMLLRQYLRYCE-RKGFKVEILEQSDGEVAGIKTATLKV
C3X1D4_OXAFO          PCNCFVDIQAGAGGTEAQDWASMILRQYLRYCE-RKGFNATILEQSDGEIAGIKTATIKV
RF2_BORPA             PLNCFVDIQAGAGGTEAQDWASMLLRQYLKYAE-RKGFKAEILEESEGDVAGLKSATIKI
RF2_NEIMA             PNNCFIDITAGAGGTEAEDWAGMLFRMYSRYAE-RKGFKIEILEEDDGEIAGINRATIRV
RF2_BUCAI             HYDCYIDIQSGSGGTDAQDWSKMLLRMYLRWAD-KKGFHTEIIDESIGEIVGIKSSTIKV
RF2_BUCAP             HCNCYIDVQAGSGGVDAQDWSKILLRMYLKWSD-KKGFKTEIIEESTGEIVGIKSSTIKV
RF2_BUCBP             YLSCYVDIQSGSGGVEAQDWASMLLRMYVRWAE-SKKFKIDIIEQTYGEVVGIKSATIEV
RF2_RICBR             SNNCFLEINAGAGGTESHDWASIMMRMYLRFAE-RLGFKTEIINMINGEEAGIKSCTIRI
RF2_RICCN             GNNCFLEINAGAGGTESHDWASIMMRMYLRFAE-RLGFKTEIINMINGEEAGIKSCTIRI
RF2_CAUVC             GNDCYVEINSGAGGTESCDWAGILLRMYTRWAN-AHGMTTELIEETDGDQAGIKSATLLV
RF2_ROSDO             SNDTFLEVNAGAGGTESCDWASMLARMYVRWAE-KKGYKVELQSMSDGDEAGIKSATYKI
Q5GSZ0_WOLTR          NNDCFLEIHSGAGGTESNDWAEMLMRMYIRWAEIYHNFKVEVVEKLEGDSIGIKSAIIKI
RF2_NEOSM             GNDCLLEIQSGAGGTESNDWAMMLLRMYTRWAEIYHKFQVQIVDKVEGEETGIKSCTLKV
PRFB2_ARATH           PCSCYIEVQAGAGGTESNDWAAMVMEMYKTWAQ-RRKFSVTVVDEAPGEIAGIKRATIKV
M2R3G2_CERS8          AKSAYIEIHAGSGGTEACDWASMLARMYTKWAH-SRDYTVQIIDETPGDAAGIKSTTMLI
RF2_BACSU             KNNAILELHPGAGGTESQDWGSMLLRMYTRWGE-RRGFKVETLDYLPGDEAGIKSVTLLI
RF2_LISIN             KNNAILELHPGAGGTESQDWGSMLLRMYQRWSE-KKGFKVEMLDYQAGDEAGIKSVTLLI
RF2_STAAN             ANNAILELHPGAGGTESQDWANMLFRMYQRYCE-KKGFKVETVDYLPGDEAGIKSVTLLI
RF2_LACPL             RNNAILEIHPGAGGTESQDWGAMLLRMYTRWAA-SHNFKVETVDYQAGDEAGIKSVTLLI
RF2_STRGC             NNNAILEIHPGSGGTEAQDWGDMLLRMYTRFGN-AKGFKVEVLDYQAGDEAGIKSVTLSF
RF2_LACLA             HMNAVLEIHPGSGGTESQDWGSMLMRMYTRWGE-AHGFKVEILDYQDGDVAGLKSVALRF
E7FX65_ERYRH          QKNAIVEIHPGAGGTESQDFAEMLYRMYTRWAQ-DHGFKISVLNYLDGDEAGLKSVSFSV
R4S0H9_PHYAS          NNNAILIFHPGAGGTESQDWCEMLFRMYQKYAQ-KKNFKTEILDYQSGEEAGIKSATLLV
B3R0C2_PHYMT          KKNAILILHPGAGGIESQDWCEMLLRMYQKYAQ-KKNFKIVVLDYQVGDVAGLKSVSLLI
RF2_THEMA             PNNAYLSVHPGAGGTESQDWAQMLLRMYMRWAE-RKGFDVEIVEFQPGEEAGIKDATILI
RF2_THEM4             SSNAYLSIHPGAGGTESQDWASMLLRMYMRWAE-RRGFDVQIVDYQPGEEAGIKSAMLYI
RF2_CLOP1             RNDAILTLHTGVGGSDANDWTEMLLRMYTRWCE-KKGYSLETIDYLPGDEAGVKSVTLKV
RF2_LEPIC             LKPAFLNIHPGAGGTESQDWAEMLLRMYTRYFE-KKGYQYSLIDVQAGDGAGIKNATLHV
M6TI43_LEPIR          LKPAFLNIHPGAGGTESQDWAEMLLRMYTRYFE-KKGYQYSLIDVQAGDGAGIKNATLHV
RF2_LEPBJ             LKPAFLNIHPGAGGTESQDWAEMLLRMYIRYFE-KKGYQYSLIDIQAGDGAGIKNVTLHV
I4B5R7_TURPD          MNNAFVNIHPGAGGTESQDWADMLTRAYMRYGE-KAGFNVELIDYQEGEEAGIKNATILV
RF2_NITSB             DKNAIVTIHPGAGGTESQDWASILYRMYLRWAE-RHGFKVEVLDYQEGEEAGIKDVSFII
RF2_WOLSU             GSNAIITIHPGAGGTESQDWASILYRMYLRWAE-RRGFKVEVLDYQEGEEAGIKDASFII
RF2_HELP2             ASNAIITIQPGAGGTESQDWASILYRMYLRWAE-RRGFKSEILDYQDGEEAGIKGVAFII
RF2_HELPJ             ASNAIITIQPGAGGTESQDWASILYRMYLRWAE-RKSFKSEILDYQDGEEAGIKGVAFII
RF2_HELHP             GSNAIITIQPGAGGTESQDWASILYRMYLRWSE-RRGFKVELLDYQDGEEAGIKGVAFII
RF2_CAMC1             GKNAIVSIHPGAGGTESNDWASMLYRMYLRFCE-REGFKVETLDFQEGEEAGLKDVSFIV
A7GZF0_CAMC5          NKNAIISIHPGAGGTESNDWASMLYRMYLRFCE-REGFKVETLDFQEGDEAGLKDVSFIV
RF2_CAMJE             GKNAIVSIHPGAGGTESNDWASILYRMYLRFCE-REGFKVETLDFQEGEEAGLKDVSFLV
RF2_CAMLR             GKNAIVSIHPGAGGTESNDWASMLYRMYLRFCE-REGFKVETLDFQEGEEAGLKDVSFLV
RF2_SULDN             GNNAILSIHPGAGGTESQDWASILLRMYKRFAE-RRGWSVEVLDYQAGDEAGIKDVSLLI
Q2S1N4_SALRD          ERDAIVEINPGAGGTESQDWAEMLLRMYMRWAE-DQDYDVELVHQQPGEEAGIKSATLNV
G2SG74_RHOMG          HRNAILTIHPGAGGTESQDWAEMLLRMYTRWGE-RHGYDVELLEYQAGDVAGIKSATLRI
A0M2C7_GRAFK          SMSAVLQITAGAGGTESCDWAEMLMRMYLMWAE-KRKYKIRELNYQAGDVAGIKTVTLEI
E6SVF9_BACT6          QMDCVLKINSGAGGTESQDWANMLMRMYLRYAE-THGYKAAIANLQEGDEAGIKTCTIEI
RF2_TREPA             RLDAFVTIHSGAGGVEACDWAQMLMRMYTRWAE-RRSFCVHIVDLLESE-GGVKSVTLKI
RF2_BORBU             ANNAFLTIHSGAGGTEACDWVAMLYRMYSRYAE-RKKYKTELIDLLEAE-GGIKSVTIEI
RF2_CHLTR             RNSCFLSINAGAGGTESCDWVEMLLRMYMRWAS-SHSWRIEVIDRLDGEVAGIKHITLKL
RF2_CHLMU             RNSCFLSINAGAGGTESCDWVEMLFRMYSRWAN-SHGWKVEVIDRLDGEVAGIKHITLKL
RF2_CHLPN             KNSCFLTINAGAGGTESCDWVEMLFRMYSRWAT-KHQWALEVVDRLDGEVVGIKHVTVKF
RF2_CHLAB             KNPCFLTINAGAGGTESCDWVEMLFRMYCRWAA-QHQWKVEVIDRQEGDVAGIKHVTVKF
RF2_THET8             EKNAILTIQPGAGGTEACDWAEMLLRMYTRFAE-RQGFQVEVVDLTPGPEAGIDYAQILV
B4UIK0_ANASK          AAGAIVEVKSGAGGVEAMDWAAMLYRMYVRYCE-RRGWEVEPADLVAGEEAGISSASFIV
RF2_MYCSJ             EREAVVTIRSGAGGVDAADWAEMLMRMYIRWAE-QHDYPVEVFDTSYAEEAGIKSATFAV
RF2_MYCS2             EREAVVTIRSGAGGVDAADWAEMLMRMYIRWAE-KHDYPVEIFDTSYAEEAGIKSATFAV
RF2_MYCTU             EREALVTIRSGAGGVDAADWAEMLMRMYIRWAE-QHKYPVEVFDTSYAEEAGIKSATFAV
RF2_NOCFA             KREALVNIRSGAGGVDAADWAEMLMRMYIRWAD-RHGYPVEVYDTSYAEEAGIKSATFAV
RF2_RHOE4             ERDALINIRSGAGGIDAADWAEMLMRMYIRWAE-KHDYGVEVYDTSYAEEAGLKSATFAI
RF2_CORDI             SREAVINIRSGAGGVDAADWAEMLMRMYIRWAE-KNDHKVDIYDISYAEEAGIKSATFVV
RF2_KINRD             SREAIVTIRSEAGGVDAADFAEMLMRMYLRWAE-RRGYKSEVYDTSYAEEAGIKSATFKV
RF2_STRAW             SREALVNIRAEAGGVDAADFAEKLQRMYLRWAE-QRGYKTEIYETSYAEEAGIKSTTFAV
RF2_SACEN             QREAVVTIRAEAGGVDAADFAEMLMRMYVRWAE-RHEYPVEVYDTSYAEEAGLKSATFRV
RF2_SALAI             SREALVAIRAGAGGVDAADFAEMLLRMYLRWAE-RHGYPTEVYETSYAEEAGLKSATFTV
RF2_PSECP             EREAVVSIRAGAGGVDAADFAEMLMRMYLRWAE-RHGYPTTVMDTSYAEEAGLKSATFEV
RF2_ARTS2             EREAVVTIRAGAGGVDAADFAEMLLRMYLRWAE-RHGYPTTIMDTSYAEEAGLKSATFEV
RF2_BEUC1             SREAVVTIRSGAGGVDAADFAEMLLRMYLRWAE-RKGYPTQVLDTSYAEEAGLKSATFEV
Q8G536_BIFLO          ERSAVVTIRSGAGGVDAADFAQMLLRMYLRYCE-RNGFKAKVMDTSYAEEAGIKSATFQV
A0A0G0MTZ5_9BACT      SSEAILSIHSGTGGVEAMDWAGMLYRMYQRYFE-RKNWKFELTDESLGEEAGYKSVSMIV
PRFB1_ARATH           KEGAVVYITAGAGGTDAQDWADMLLRMYMRWGE-KQRYKTKVVEMSNGEEAGIKSATLEI
K3ZTA0_SETIT          KEGAVINISAGAGGTDAQDWADMLLRMYVRWGE-KQRYKTRVVEKSPGEEAGIKSATVEL
Q7VE10_PROMA          KEGAVLAINAGAGGTDAQDWAQMLLRMYMRWAE-SHGMKVILSELSEGEEAGIKSATIEI
Q017H4_OSTTA          ALGAVVQIYAGAGGLDAQDWTEMLERMYIGWCE-KRGYGVRVTERQEGEGGGLKTATLEV
S4XGF3_SORCE          RGNAIVSIHPGAGGTDAKDWASMLLRMYLRFCE-RRGYKTEIIDYQDGDEAGIDAVTFTV
                           : . .  ** :: *:   : . *  :                .   * .     .

RF2_ECO57             SGDYAYGWLRTETGVHRLVRKSPFDSGGRRHTSFSSAFVYPEV--D-DDIDIEINPADLR
RF2_ECOLI             SGDYAYGWLRTETGVHRLVRKSPFDSGGRRHTSFSSAFVYPEV--D-DDIDIEINPADLR
RF2_SALTY             SGEYAYGWLRTETGVHRLVRKSPFDSGGRRHTSFSSAFVYPEV--D-DDIDIDINPADLR
RF2_HAEIN             SGEYAFGWLRTETGIHRLVRKSPFDSNNRRHTSFSAAFVYPEI--D-DDIDIEINPADLR
RF2_PASMU             SGEYAFGWLRTETGIHRLVRKSPFDSNNRRHTSFSAAFVYPEI--D-DDIDIDINPADLR
RF2_AERHH             TGEYAFGWLRTETGVHRLVRKSPFDSGGRRHTSFCSVFVYPEI--D-DDIDIEINPADLR
RF2_AERS4             TGEYAFGWLRTETGVHRLVRKSPFDSGGRRHTSFCSVFVYPEI--D-DDIDIEINPADLR
Q0VP01_ALCBS          EGDYAYGWLRTETGVHRLVRKSPFDSGGRRHTSFSSVFVSPEV--D-DDIDIEIDLGNMR
RF2_JANMA             EGDYAYGFLRTETGVHRLVRKSPFDSANGRHTSFSSLFVYPEV--D-DSIEIDINPADVR
C3X1D4_OXAFO          EGDYAYGYLRTETGVHRLVRKSPFDSANGRHTSFCSLFVYPEV--D-DSIEIDINPADVR
RF2_BORPA             EGEYAFGYLRTETGVHRLVRKSPFDSSGGRHTSFASVFVYPEV--D-ESFEVEVNPADLR
RF2_NEIMA             EGEYAYGLLRTETGVHRLVRYSPFDSNNKRHTSFASVFVYPEI--D-DSIEIEINPADLR
RF2_BUCAI             SGEYAFGWFRTETGIHRLIRKSPFDSGKRRHTSFSSIFIYPDI--N-EKIDININYSDLR
RF2_BUCAP             SGQYAFGWLRTETGIHRLIRKSPFDSGKRRHTSFSSIFIYPDI--E-DKINIEINPSDLR
RF2_BUCBP             LGKYAFGWFRTETGIHRLVRKSPFNAHHRRHTSFSSVYVYPIL--D-DAINVDINTRDLK
RF2_RICBR             IGRRAYGWLKTEAGVHRLVRISPFNAAGKRMTSFASSWVYPEI--D-DNIAITIEDKDLR
RF2_RICCN             IGKRAYGWFKTETGVHRLVRISPFNAAGKRMTSFASSWVYPEI--D-DNIAITIEDKDLR
RF2_CAUVC             KGANAYGWLKTEAGVHRLVRISPYDSSARRHTSFASAWVYPVV--D-DNIEIEINPSDVR
RF2_ROSDO             TGLNAYGWLKSESGVHRLVRISPFDSAAKRHTSFSSVWVYPVV--D-DNIDIEVNPADIR
Q5GSZ0_WOLTR          IGEKAYGWAKSESGIHRLVRISPFDANSKRHTSFVSIGVTPVI--E-DSIDIAVDEGTLK
RF2_NEOSM             MGKNAYGWARTETGVHRLVRISPFDANAKRHTSFAKIFVSPCI--E-GEINISIDEKDLK
PRFB2_ARATH           NGEYAYGYAKAEVGVHRLVRISPFDSGKRRHTSFAAVAVIPILG-D-GSTRVEINDSDLR
M2R3G2_CERS8          EGPYAYGYAQYETGVHRLVRLSPFDKSNARHTSFASVRVSPCLDED-SNVDIEINPADLR
RF2_BACSU             KGHNAYGYLKAEKGVHRLVRISPFDSSGRRHTSFVSCEVMPEFN---DEIDIDIRTEDIK
RF2_LISIN             KGHNAYGYLKAEKGVHRLVRISPFDSSGRRHTSFVSVDVMPELD---DEIEIEVRTEDLK
RF2_STAAN             KGHNAYGYLKAEKGVHRLVRISPFDSSGRRHTSFASCDVIPDFN--NDEIEIEINPDDIT
RF2_LACPL             SGHNAYGYLRSEKGVHRLVRISPFDAAGRRHTSFASVDVMPELD---DTVDVDIRPEDLK
RF2_STRGC             EGPHAYGLLKSEMGVHRLVRISPFDSAKRRHTSFTSVEVMPELD---DTIEVEIREDDIK
RF2_LACLA             VGRNAYGFLRGEKGVHRLVRISPFDSANRRHTSFTSVDVMPELD---DSIEVDVRDADVK
E7FX65_ERYRH          SGMFAYGYLKAEKGVHRLVRISPFDSSGRRHTSFASVDVAPEFD---NSIEITILPEDID
R4S0H9_PHYAS          KGAYAYGYLKAEKGVHRLVRVSPFDTNAKRHTSFVSCDVLPEIK---EKIKIDLRQEDLK
B3R0C2_PHYMT          KGVYAYGYLKSEKGVHRLVRISPFDSNSKRHTSFTSCDVLPEIN---ENIEIKIKEEELK
RF2_THEMA             KGEYAYGYLKHESGVHRLVRISPFDAARRRHTSFASVNVIPEID---DDVDIEIRPEDLK
RF2_THEM4             KGEYVYGYLKYERGVHRLVRISPFDANKRRHTSFASVNVMPEIE---DDIDVEINPEDLR
RF2_CLOP1             KGEFAYGYLKAEKGIHRLVRISPFNANGKRQTSFASVEVLPELT---SDQDIEINPVDLR
RF2_LEPIC             IGDFAFGFLKGENGVHRLVRISPFDANKRRHTSFVSVHVSPEID---DDIDIKIEEKDIR
M6TI43_LEPIR          IGDFAFGFLKGENGIHRLVRISPFDANKRRHTSFVSVHVSPEID---DDIDIKIEEKDIR
RF2_LEPBJ             VGDFAFGFLKGENGIHRLVRISPFDANKRRHTSFVSVHVSPEID---DEIDIKIEEKDIR
I4B5R7_TURPD          SGPNAYGYLKAENGIHRLVRISPFDSNKRRHTSFAAVHVSPEIS---DDVEIEVLEKDLR
RF2_NITSB             KGENAYGYLKAENGIHRLVRISPFDSNARRHTSFASVMVSPEVD---DDINIVIEDKDIR
RF2_WOLSU             KGENAYGYLKVENGIHRLVRISPFDANAKRHTSFTSVMVSPEVD---DDIDIEIEEKDLR
RF2_HELP2             KGENAYGYLKNENGVHRLVRISPFDANAKRHTSFASVQISPELD---DDIDIEIDEKDVR
RF2_HELPJ             KGENAYGYLKNENGVHRLVRISPFDANAKRHTSFASVQISPELD---DDIDIEIDEKDVR
RF2_HELHP             KGENAYGYAKSENGVHRLVRISPFDANAKRHTSFASVQVSPELD---DDINIEIEDKDIR
RF2_CAMC1             KGENAYGYFKAENGIHRLVRTSPFDSAGRRHTSFSSVMVSPEVD---DDIEIEIEEKDLK
A7GZF0_CAMC5          KGENAYGYLKAENGIHRLVRTSPFDSAGRRHTSFSSVMVSPEID---DDIEIEIEEKDLK
RF2_CAMJE             KGENAYGYLKAENGIHRLVRTSPFDSAGRRHTSFSSVMVSPELD---DDIEIEIEEKDIR
RF2_CAMLR             KGENAYGYLKAENGIHRLVRTSPFDSAGRRHTSFSSVMVSPELD---DDIEIEIEDKDIR
RF2_SULDN             SGENAYGYLKVENGIHRLVRISPFDSNAKRHTSFSSVMVSPEVD---DDINIVIEDRDIR
Q2S1N4_SALRD          QGRHAYGRLKSETGVHRLVRISPFDADSRRHTSFASVFVYPEVD---DSIGVDLSEGEIE
G2SG74_RHOMG          AGPYAYGYLKGESGVHRLVRISPFDASGRRHTSFASVFVYPEID---DSIEVDIRPDEIE
A0M2C7_GRAFK          EGEYAFGWLKGENGVHRLVRISPFDSNAKRHTSFASAYIYPLVD---DSIEIDINPSDLS
E6SVF9_BACT6          SGDYAYGYLKGENGVHRLVRVSPYNAQGKRMTSFASVFVTPLVD---DTIEVDIKVANIS
RF2_TREPA             CGSHAFGFLKGETGVHRLVRISPFDSAARRHTSFTSTYVFPVLD---DHVEVHIRSEDMR
RF2_BORBU             KGEYAYGLLKSEVGIHRLIRISPFDAAKKRHTSFASVFVDPVID---DKIEITIKPEDIR
RF2_CHLTR             VGEYAYGYAKAESGVHRLVRISPFDSNAKRHTSFASVEVFPEID---DKIEVEIRPGDIR
RF2_CHLMU             IGEYAYGYAKAESGVHRLVRISPFDSNAKRHTSFASVEVFPEID---DKIEVEIRPGDIR
RF2_CHLPN             SGMYAYGYAKAERGVHRLVRISPFDSNGKRHTSFASVDVFPEID---DQIKIEIRPNDLR
RF2_CHLAB             SGDYAYGYAKAERGVHRLVRISPFDSNAKRHTSFASVDVYPEID---DEIEIDIRPNDLR
RF2_THET8             KGENAYGLLSPEAGVHRLVRPSPFDASGRRHTSFAGVEVIPEVD---EEVEVVLKPEELR
B4UIK0_ANASK          RGDHPYGWLKAEKGVHRLVRISPFDQNARRQTSFAAVDVTPEIE---DDIVIDIKEADVR
RF2_MYCSJ             HAPYAYGTLSVEQGTHRLVRISPFDNQSRRQTSFADVEVLPVV---ETTDHIDVPETDLR
RF2_MYCS2             HAPFAYGTLSVEQGTHRLVRISPFDNQSRRQTSFADVEVLPVV---ETTDHIEIPENDIR
RF2_MYCTU             HAPFAYGTLSVEQGTHRLVRISPFDNQSRRQTSFAEVEVLPVV---ETTDHIDIPEGDVR
RF2_NOCFA             KTPYAYGTLSVEMGTHRLVRISPFDNQGRRQTSFAEVEVLPVV---ETTDHIEVPETEIR
RF2_RHOE4             KGPYTYGTLSVEMGTHRLVRISPFDNQGRRQTSFAEVEVLPVV---ETTDHIEINENDIR
RF2_CORDI             HGEYMYGQLSVEQGAHRLVRISPFDNQGRRQTSFAEIEVLPVV---EQTDHIDIPDSEVR
RF2_KINRD             AAPYAYGTLSVEQGTHRLVRISPFDNQGRRQTSFAGVEVLPVV---AETDHVDVPENEVR
RF2_STRAW             QVPYAYGTLSVEQGTHRLVRISPFDNQGRRQTSFAGVEILPVV---ETTDHIEIDESELR
RF2_SACEN             NAPYAYGTLSVEQGTHRLVRISPFDNQGRRQTSFAGVEVLPVV---EETDHVEIPEKDIR
RF2_SALAI             KVPYAYGTLSVESGTHRLVRISPFDNQGRRQTSFAGVEVLPVV---EQTDHIDIPENEMR
RF2_PSECP             KAPYAFGTLSVEAGTHRLVRISPFDNQGRRQTSFAAVEVIPLI---EQTDSIDIPDNEIR
RF2_ARTS2             NAPYAYGTLSVEAGTHRLVRISPFDNQGRRQTSFAAVEVIPLI---EQTDSIDIPDNEIR
RF2_BEUC1             KVPYAFGTLSVEAGTHRLVRISPFDNQGRRQTSFAAVEVIPLI---EQTDHIDIPETDIR
Q8G536_BIFLO          DAPYAYGRLSVEGGTHRLVRISPFDNQGRRQTSFAAVEVVPLV---EATDHIDIPDTDIR
A0A0G0MTZ5_9BACT      HAPLSYGYLKGEAGTHRLVRQSPFNADKLRQTSFALVEVLPVI---ENME-MEIKDEDIE
PRFB1_ARATH           EGRYAYGYISGEKGTHRIVRQSPFNSKGLRQTSFSGVEVMPLLP--EEAVGIEIPEEDLD
K3ZTA0_SETIT          EGRYAYGYLSGEKGTHRIVRQSPFNAKGLRQTSFAGVEVMPLLP--EESMAVEIPEEDLE
Q7VE10_PROMA          EGRYAYGYLQNEKGTHRLVRISPFNANGKRQTSFAGIEVMPQL---EEDVHLEIPEKDLE
Q017H4_OSTTA          DGRHAYGYLSSEKGTHRLVRQSPFNKDAARQTSFAAVDVIPLLQ--DEDE-VKVPEGDLE
S4XGF3_SORCE          TGDAAYGYLRSEAGVHRLVRMSPFNADHTRQTAFAAVEITPDS---DDEINIQVNEKDIE
                           :*    * * **::* **::    * *:*    : *          : :    : 

RF2_ECO57             IDVYRASGAGGQHVNRTESAVRITHI--------PTG-------IVTQCQNDRSQHKNKD
RF2_ECOLI             IDVYRTSGAGGQHVNRTESAVRITHI--------PTG-------IVTQCQNDRSQHKNKD
RF2_SALTY             IDVYRASGAGGQHVNRTESAVRITHI--------PTG-------IVTQCQNDRSQHKNKD
RF2_HAEIN             IDVYRASGAGGQHVNKTESAVRITHM--------PSG-------IVVQCQNDRSQHKNKD
RF2_PASMU             IDVYRASGAGGQHVNKTESAVRITHI--------PSG-------IVVQCQNDRSQHKNKD
RF2_AERHH             IDVYRASGAGGQHVNRTESAVRITHI--------PTG-------VVVQCQNDRSQHKNKD
RF2_AERS4             IDVYRASGAGGQHVNRTESAVRITHI--------PTG-------VVVQCQNDRSQHKNKD
Q0VP01_ALCBS          VDTYRASGAGGQHVNRTDSAVRLTYL--------FKDDGGTEHTVVTQCQSERSQHQNKD
RF2_JANMA             IDTYRASGAGGQHINKTDSAVRLTHG--------PSG-------IVVQCQNDRSQHRNKA
C3X1D4_OXAFO          VDTYRASGAGGQHINKTDSAVRLTHI--------PTG-------IVVQCQNDRSQHRNRA
RF2_BORPA             IDTYRASGAGGQHINKTDSAVRITHA--------PSG-------IVVQCQNDRSQHRNRA
RF2_NEIMA             IDTYRASGAGGQHINKTDSAVRITHE--------PTG-------IVVQCQNDRSQHANKA
RF2_BUCAI             IDVYRASGAGGQHVNRTESAVRITHL--------PTN-------IVTQCQNNRSQHKNKE
RF2_BUCAP             IDVYRASGAGGQHVNRTESAVRITHL--------PTN-------IVTQCQNNRSQHKNKE
RF2_BUCBP             IDVYRASGAGGQHVNKTESAVRIRHL--------PTG-------IVVQCQNDRSQHKNKD
RF2_RICBR             IDTFRASGAGGQHVNTTDSAVRITHI--------PTG-------TVTQCQSDRSQHKNKA
RF2_RICCN             IDTFRASGAGGQHVNTTDSAVRITHI--------PTG-------TVTQCQSDRSQHKNKA
RF2_CAUVC             TDTYRASGAGGQHINKTDSAVRLTHI--------PTG-------IAVACQAGRSQHQNRE
RF2_ROSDO             IDTYRSSGAGGQHVNTTDSAVRITHH--------PTG-------IVVTSSE-KSQHQNRD
Q5GSZ0_WOLTR          IDTYRASGAGGQHVNKTESAVRVTHI--------PTG-------VIVQCQNNRSQHQNKN
RF2_NEOSM             IDTYRASGAGGQHVNKTESAIRITHL--------PSK-------IVVQSQSSRSQHQNKA
PRFB2_ARATH           IERFRSGGAGGQHANTTDSAVRIVHI--------PTG-------ITATCQNERSQHSNKA
M2R3G2_CERS8          ITTMRSQGAGGQHVNKTESAVRIVHV--------PSG-------IIVACQQERSQHRNRM
RF2_BACSU             VDTYRASGAGGQHVNTTDSAVRITHL--------PTN-------VVVTCQTERSQIKNRE
RF2_LISIN             IDTYRATGAGGQHINTTDSAVRMTHI--------PSG-------IVVTCQSERSQLKNRE
RF2_STAAN             VDTFRASGAGGQHINKTESAIRITHH--------PSG-------IVVNNQNERSQIKNRE
RF2_LACPL             IDVYRASGAGGQHVNKTSSAVRITHV--------PTG-------IVVASQAQRSQLQNRQ
RF2_STRGC             MDTFRSGGAGGQNVNKVSTGVRLTHI--------PTG-------IVVQSTVDRTQYGNRD
RF2_LACLA             MDTFRSGGAGGQNVNKVSTGVRLTHI--------PTG-------IVVQSTMDRTQYGNRD
E7FX65_ERYRH          VDTMRATGAGGQHVNKTDSAVRITHK--------KTG-------IVVTCQAGRSQLQNRE
R4S0H9_PHYAS          FDFFRSSGAGGQHVNTTDSAVRITHL--------PTG-------LVVSCQNERSQNQNRE
B3R0C2_PHYMT          IDVFRSSGAGGQHVNTTDSAVRLTHL--------PTN-------IVINCQNERSQTRNKE
RF2_THEMA             IETFRASGHGGQYVNKTESAVRITHL--------PTG-------IVVSCQNERSQHQNKQ
RF2_THEM4             IDTYRASGAGGQYVNKTESAVRITHI--------PTG-------IVVTCQTERSQLQNKE
RF2_CLOP1             IDTYRAGGAGGQHVNKTESAVRITHI--------PTG-------IVVQCQNERSQFSNRD
RF2_LEPIC             VDVYRSSGAGGQHVNTTDSAVRITHM--------PSG-------IVVACQNERSQIKNRD
M6TI43_LEPIR          VDVYRSSGAGGQHVNTTDSAVRITHM--------PSG-------IVVACQNERSQIKNRD
RF2_LEPBJ             VDVYRSSGAGGQHVNTTDSAVRITHL--------PSG-------IVVACQNERSQIKNRD
I4B5R7_TURPD          IDVYRASGAGGQHVNKTESAVRMTHL--------PTG-------VVVSSQTQRSQIQNRL
RF2_NITSB             VDTYRASGAGGQHVNKTDSAIRITHI--------PTG-------IVVQCQNDRSQHKNRA
RF2_WOLSU             LDTYRASGAGGQHVNKTESAIRITHI--------PTG-------IVVQCQNDRSQHKNKA
RF2_HELP2             YDYYRASGAGGQHVNKTESAVRITHF--------PTG-------IVVQCQNDRSQHKNKA
RF2_HELPJ             YDYYRASGAGGQHVNKTESAVRITHF--------PTG-------IVVQCQNDRSQHKNKA
RF2_HELHP             IDTYRASGAGGQHVNKTESAIRITHF--------PTG-------IVVQCQNDRSQHKNKA
RF2_CAMC1             IDTYRASGAGGQHVNKTESAIRITHI--------PTG-------IVVQCQNDRSQHKNRA
A7GZF0_CAMC5          IDTYRASGAGGQHVNKTESAIRITHM--------PTG-------IVVQCQNDRSQHKNRA
RF2_CAMJE             IDYYRASGAGGQHVNKTESAVRITHF--------PTG-------IVVQCQNDRSQHKNKA
RF2_CAMLR             IDYYRASGAGGQHVNKTESAVRITHM--------PSG-------IVVQCQNDRSQHKNKA
RF2_SULDN             VDTYRSSGAGGQHVNKTESAIRITHI--------ATG-------VVVQCQNDRSQHKNRA
Q2S1N4_SALRD          LQTFRSGGKGGQHVNKVETGVRLIWTGTLS-NGEETT-------VRAACTQERSQHQNRR
G2SG74_RHOMG          MQTFRSGGKGGQNVNKVETGVRLIWHGKLS-NGEEAR-------VVAECTEERSQLQNRQ
A0M2C7_GRAFK          WETMRSSGAGGQNVNKVETAVRLRH--------EPTG-------IVIENSETRSQLENKN
E6SVF9_BACT6          WDTFRSSGAGGQNVNKVESGVRLRYQFKDPYTGEEEE-------ILIENTETRDQPKNRE
RF2_TREPA             VDTYRSGGAGGQHVNKTDSAVRITHL--------PTG-------IVVTCQNERSQISNRA
RF2_BORBU             IDTYRASGAGGQHVNKTSSAVRITHI--------ETG-------IVTQSQSDRSQHKNKD
RF2_CHLTR             IDTYRSSGAGGQHVNVTDSAVRITHF--------PTG-------IVVSCQNERSQIQNRE
RF2_CHLMU             IDTYRSSGAGGQHVNVTDSAVRITHF--------PTG-------IVVSCQSERSQIQNRE
RF2_CHLPN             IDTFRSSGAGGQHVNVTESAVRITHL--------PSG-------VVVSCQNERSQIQNRE
RF2_CHLAB             IDTFRSSGAGGQHVNVTDSAVRITHI--------PTG-------IMVSCQRERSQIQNRE
RF2_THET8             IDVMRASGPGGQGVNTTDSAVRVVHL--------PTG-------ITVTCQTTRSQIKNKE
B4UIK0_ANASK          IDTYRSSGAGGQKVNKTDSAVRMTHL--------PTG-------IVVAVQNERSQQKNRS
RF2_MYCSJ             VDVYRSSGPGGQSVNTTDSAVRLTHI--------PTG-------IVVTCQNEKSQLQNKV
RF2_MYCS2             VDVYRSSGPGGQSVNTTDSAVRLTHI--------PTG-------IVVTCQNEKSQLQNKV
RF2_MYCTU             VDVYRSSGPGGQSVNTTDSAVRLTHI--------PSG-------IVVTCQNEKSQLQNKI
RF2_NOCFA             VDVYRSSGPGGQSVNTTDSAVRITHI--------PTG-------IVVTCQNEKSQLQNKI
RF2_RHOE4             VDVYRSSGPGGQSVNTTDSAVRLTHI--------PTG-------IVVTCQNEKSQLQNKV
RF2_CORDI             VDVYRSSGPGGQSVNTTDSAVRLTHI--------PTG-------IVVTCQNEKSQIQNKA
RF2_KINRD             VDVYRSSGPGGQSVNTTDSAVRLTHL--------PTG-------IVVTCQNEKSQLQNKA
RF2_STRAW             VDVYRSSGPGGQGVNTTDSAVRLTHL--------PTG-------IVVSCQNERSQIQNKA
RF2_SACEN             VDVFRSSGPGGQSVNTTDSAVRITHI--------PTG-------IVVSCQNEKSQLQNKA
RF2_SALAI             TDVYRSSGPGGQSVNTTDSAVRITHI--------PTG-------IVVTCQNEKSQLQNKA
RF2_PSECP             VDVFRSSGPGGQSVNTTDSAVRLTHI--------PTG-------VVVSMQNEKSQLQNRA
RF2_ARTS2             VDVFRSSGPGGQSVNTTDSAVRLTHI--------PTG-------TVVSMQNEKSQLQNRA
RF2_BEUC1             IDVFRSSGPGGQSVNTTDSAVRITHL--------PTG-------IVVSMQNEKSQIQNRA
Q8G536_BIFLO          VDTYCSSGPGGQGVNTTYSAVRITHL--------PTG-------IVVTMQDERSQIQNRA
A0A0G0MTZ5_9BACT      FAAFRSGGHGGQNVNKVSTAVRLKHI--------PTG-------ITVTAQTERSQLQNRE
PRFB1_ARATH           ISFTRAGGKGGQNVNKVETAVRITHI--------PTG-------VAVRCTEERSQLANKT
K3ZTA0_SETIT          ISFTRAGGKGGQNVNKVETAVRMVHI--------PTG-------IAVRCSEERSQLANKI
Q7VE10_PROMA          VTTSRSGGAGGQNVNKVETAVRILHI--------PTG-------LAVRCTQERSQLQNKE
Q017H4_OSTTA          ITTMRSSGAGGQNVNKLETAVRIKHV--------PTG-------ISVKAEEHRTQALNRQ
S4XGF3_SORCE          ITTMRAGGKGGQNVNKVETAVRLRHL--------PTG-------LNIVCRAERSQHQNRA
                           : * ***  *   :.:*:                             : *  *: 

RF2_ECO57             QAMKQMKAKLYELEMQKK-NAEKQAMEDNKSDIGWGSQIRSYVLDDSR-IKDLRTGVETR
RF2_ECOLI             QAMKQMKAKLYELEMQKK-NAEKQAMEDNKSDIGWGSQIRSYVLDDSR-IKDLRTGVETR
RF2_SALTY             QAMKQMKAKLYELEMQKK-NAEKQAMEDTKSDIGWGSQIRSYVLDDSR-IKDLRTGVETR
RF2_HAEIN             QAMKQLKAKLYELELQKK-NADKQAMEDNKSDIGWGSQIRSYVLDDSR-IKDLRTGVENR
RF2_PASMU             QCMKQLKAKLYEMELQKK-NADKQAMEDNKSDIGWGSQIRSYVLDDSR-IKDLRTGVENR
RF2_AERHH             QCMKQLKAKLYELEIQKQ-NAEKQALEETKSDIGWGSQIRSYVLDDAR-IKDLRTGVETR
RF2_AERS4             QCMKQLKAKLYELEIQKQ-NAEKQALEETKSDIGWGSQIRSYVLDDAR-IKDLRTGVETR
Q0VP01_ALCBS          KAMKMMQAKVYELEMQRR-NAEKQALENSKADIGWGSQIRSYVLDDAR-IKDLRTGVENR
RF2_JANMA             EAWDMLKAKLFELEMRNR-MSEQQKLEDSKTDVGWGHQIRSYVLDQSR-IKDLRTNFETG
C3X1D4_OXAFO          DAWEMLKSRLYELELRKR-MAEQQKLEDSKTDVGWGHQIRSYVLDSSR-IKDLRTSHETG
RF2_BORPA             EAMQMLKSKLYELEMRNR-MTEQQKLEDSKTDVGWGHQIRSYVLDQSR-IKDLRTNVEIS
RF2_NEIMA             AAMEMLKSKLYELEMRKR-NEEKQALEEGKSDVGWGSQIRSYVLDSSR-IKDLRTGYEVG
RF2_BUCAI             QAMKQMQSKLYEIQMRKK-QEEKQKIEQNKSDITWGNQIRSYILDNSK-IKDLRTGVEKN
RF2_BUCAP             QAIKQMKSKLYEMKIKEK-KEKQKKIEKNKSDISWGNQIRSYILDNSK-IKDLRTGVEKY
RF2_BUCBP             QAMKQLKAKLYEQLINEK-KCQQKILENNKLNIGWGHQIRSYTLDNSR-IKDLRTGVESK
RF2_RICBR             QAMKMLQAKLYELEMQKR-TDSVNEQNAAKTDNSWGHQIRSYVLQPYQMVKDLRTDYETS
RF2_RICCN             QAMKMLQAKLYELEMQKR-TDSVNEQNAAKTDNSWGHQIRSYVLQPYHMVKDLRTDYETS
RF2_CAUVC             EAWKMLRARLYEAELQKR-EAAQQALEDQKTDIGWGHQIRSYVLQPYQMVKDLRTNVETS
RF2_ROSDO             IAMKALKSRLYQLELDRR-NAAINEAHENKGDAGWGNQIRSYVLQPYQMVKDLRTNFETS
Q5GSZ0_WOLTR          EALKLLKGRLYQIKLEKK-EQKMAEEYGKKCGIGWGNQIRSYVMHPYQMVKDLRTGYEVG
RF2_NEOSM             EAMQMLKSRLYEIELRKK-EEKLNAARNVEDSIGWGYQIRSYVLHPYQMIKDLRTGHEVG
PRFB2_ARATH           SAMAVLQSRLDQLEMARQ-TAMNAQHTQSLTEISWGNQIRTYVLHPYRMVKDLRTNYEVS
M2R3G2_CERS8          LALSVLKSKLFELELQKR-QQAKADLHNALPENAWGSQIRSYTLQPYQLIKDTRTGYEAG
RF2_BACSU             RAMKMLKAKLYQRRIEEQ-QAELDEIRGEQKEIGWGSQIRSYVFHPYSMVKDHRTNTEMG
RF2_LISIN             QAMKMLKTKLYQKEQEEK-ERELAEIRGEQKEIGWGSQIRSYVFHPYSMVKDHRTNYETG
RF2_STAAN             AAMKMLKSKLYQLKLEEQ-AREMAEIRGEQKEIGWGSQIRSYVFHPYSMVKDHRTNEETG
RF2_LACPL             TALNMLRAKLYEREEEKK-AKERAAIQGEQMDIGWGSQIRSYVFHPYTMVKDHRTNYESH
RF2_STRGC             RAMKMLQAKLYQLEQEKK-AAEVDSLKGDKKEISWGSQIRSYVFTPYTMVKDHRTSYEVA
RF2_LACLA             KAMAMLKSKLYQLEMDKK-QAEVDELRGDQSEISWGSQIRSYVFMPYQLVKDTRTGYETG
E7FX65_ERYRH          EALMMLKSKLYQREIEEK-QAQLAAIKGEHKLIEWGSQIRSYVAHPYTMVKDHRTKFETS
R4S0H9_PHYAS          KALQMLKIKLFQLADKKQKEEHAKNFQGEQKEIGWGSQIRSYVFHPYKMVKDHRTNQEIF
B3R0C2_PHYMT          RALQILKTKLFQREIKKQ-EINLKLIQGVQKEISWGNQIRSYIFHPYQLVKDHRTNVESY
RF2_THEMA             TALKILKAKLYQLEMEKK-RREIQEIQGELKDISWGNQIRSYIFHPYTMVKDHRTGVETA
RF2_THEM4             TAMKVLKARLYQLELEKR-QKQLEEIQGELKDISWGNQIRSYVFQPYTMVKDHRTNVETG
RF2_CLOP1             TAMGMLKSKLIELKERAH-KEKIEDLTGELKDMGWGSQIRSYVFHPYSMVKDHRTNVETS
RF2_LEPIC             TAFKMLKARLYELEQEKA-KEELEKKSGEKKDITWGSQIRSYVFHPYNLVKDHRTDHETG
M6TI43_LEPIR          TAFKMLKARLYELEQEKA-KEELEKKSGEKK-------------------------TSPG
RF2_LEPBJ             TAFKMLKARLYEMEQEKA-KEELEKKSGEKKDIAWGSQIRSYVFHPYNLVKDHRTDHETG
I4B5R7_TURPD          TCMKMLKARLYEMARAEK-EAEIESRSGERKDISWGNQIRSYVFHPYSMVKDLRTGEETS
RF2_NITSB             TAMKMLKSRLYELELEKK-RAEQEGI--EKSDIGWGHQIRSYVLAPYQQVKDTRSNKAYS
RF2_WOLSU             TAFKMLKSRLYELELAKR-SAEYDSM--EKSEIGWGHQIRSYVLAPYQQVKDTRSNIAYS
RF2_HELP2             SALKMLKSKLYELELEKQ-QNSTKNE--EKSEIGWGHQIRSYVLAPYQQVKDARSNIAYS
RF2_HELPJ             SALKMLKSKLYELELEKQ-QSSAKNE--EKSEIGWGHQIRSYVLAPYQQVKDARSNIAYS
RF2_HELHP             TAMKMLKSKLYELELQKN-Q-EGASQ--EKSEIGWGHQIRSYVLAPYQQVKDLRTQFATS
RF2_CAMC1             TAMKMLKSRLYELELMKQ-QEASNSV--EKSEIGWGHQIRSYVLFPYQQVKDNRSGEAYS
A7GZF0_CAMC5          TAMKMLKSRLYELELMKQ-QEASNSV--EKSEIGWGHQIRSYVLFPYQQVKDNRSGQAFS
RF2_CAMJE             TAFKMLKSRLYELELMKQ-QDSANTG--EKSEIGWGHQIRSYVLFPYQQVKDNRSGEAFS
RF2_CAMLR             TAFKMLKSRLYELELMKQ-QDEANSS--EKSEIGWGHQIRSYVLFPYQQVKDTRSNEAFS
RF2_SULDN             TAMKMLKSRLYELELENQ-KAEIAGI--AKSEIGWGHQIRSYVMQPYQQIKDTRSNIAYS
Q2S1N4_SALRD          RAREMLKSRIYQAERELK-EEEKERLESSKKSIEWGSQIRSYVLHPYKMVNDHRTDTKRN
G2SG74_RHOMG          RALTMLKSRIYQLEREIR-EAEKRKRESQKKKIEWGSQIRSYVFQPYTMVNDHRTETKVT
A0M2C7_GRAFK          KAMQLLKSQLFEIELQKK-QEQRREIEDSKMKIEWGSQIRNYVMHPYKLVKDVRTAEETG
E6SVF9_BACT6          NAMRQLRSILYDKELQHR-MAEQAKVEAGKKKIEWGSQIRSYVFDDRR-VKDHRTNFQTS
RF2_TREPA             TALSLLRARLYAYERQKK-QQEHQRFASEKKDISWGNQIRSYVFHPYTMVKDHRSKCETG
RF2_BORBU             LAMKVLKSRLYEYYKSKE-DEKNKSKQDTKKEISWGNQIRSYVFQPYNLVKDHRTKFENS
RF2_CHLTR             ACMNMLRARIYQKLLQER-LEKQNIDRKNKKEISWGSQIRNYVFQPYTLVKDVRTGYEVG
RF2_CHLMU             ACMNMLRARIYQKLLQER-LEKQNTNRKEKKEISWGSQIRNYVFQPYTLVKDVRTGYEVG
RF2_CHLPN             SCMKMLQAKLYQQVLQER-LEKQSLDRKDKKEIAWGSQIRNYVFQPYTLVKDVRTGHETG
RF2_CHLAB             SCMKMLRARMYQQILQER-LEKQLLDRKNKKEIAWGSQIRNYVFQPYTLVKDVRTGHETG
RF2_THET8             LALKILKARLYELERKKR-EEELKALRGEVRPIEWGSQIRSYVLDKNY-VKDHRTGLMRH
B4UIK0_ANASK          VAWKILRAKLYDLEEKKR-AAARDAAEALKKDIDFGSQIRSYVLQPYQMVKDLRTGVETG
RF2_MYCSJ             AAMRVLQAKLLARKKQEE-RAALDALKGDGGSS-WGNQMRSYVLHPYQMVKDLRTEYEVG
RF2_MYCS2             SAMRVLQAKLLERKRLEE-RAELDALKGDGGSS-WGNQMRSYVLHPYQMVKDLRTEYEVG
RF2_MYCTU             AAMRVLQAKLLERKRLEE-RAELDALKADGGSS-WGNQMRSYVLHPYQMVKDLRTEYEVG
RF2_NOCFA             SAMRVLQAKLLERKRQEE-RAEMDALKTNEGAS-WGNQMRSYVLHPYQMVKDLRTNYEVN
RF2_RHOE4             SAMRVLQAKLLAVKRQEE-RAEMDALKGDSGSS-WGNQMRSYVLHPYQMVKDLRTEYEVN
RF2_CORDI             SAMRVLQAKLLERKRQEE-RAELDALGAGGNAS-WGNQMRSYVLHPYQMVKDLRTNYEVN
RF2_KINRD             AAMRVLQAKLLEKARKDR-QAELDALKGDDSGS-WGNQMRSYVLHPYQMVKDLRTNYEVG
RF2_STRAW             SAMNVLQAKLLDRRRQEE-QAKMDALKGDGGNS-WGNQMRSYVLHPYQMVKDLRTEYEVG
RF2_SACEN             AALRVLQSKLLAKKKEQE-RAELDALK-DSGSS-WGNQMRSYVLHPYQMVKDLRTEFEVG
RF2_SALAI             SALRVLQARLLERKRQEE-QAKLQGLKTDAAGS-WGDQMRSYVLHPYQMVKDLRTEQETG
RF2_PSECP             AAMRVLQSRLLLLKKEQE-DAEKKALAGDVKAS-WGDQMRSYVLNPYQMVKDLRTEHEVG
RF2_ARTS2             AALRVLQSRLLLLKKEQE-DAEKKAFAGDVKAS-WGDQMRSYVLNPYQMVKDLRTEHEVG
RF2_BEUC1             AAMRVLQSRLLLAMQEEE-NAKKKELAGDVKAS-WGDQMRSYVLQPYQMVKDLRTEHEVG
Q8G536_BIFLO          SAMAVLQSRLLVLRHEEE-AKKKKELAGDIKAS-WGDQMRSYVLHPYQMVKDLRTGYETS
A0A0G0MTZ5_9BACT      NALKLLRAKLWVLQQAEK-NAQTQSLKGTTQAS-WGTQIRSYVLHPYHMVKDLRTLVETS
PRFB1_ARATH           RALIRLKAKLMVIAEEQR-ATEIKEIRGDAVKAEWGQQIRNYVFHPYKLVKDVRTGHETS
K3ZTA0_SETIT          KALSRLKAKLLVIAEEQR-ASEIKQIRGDMVKAEWGQQIRNYVFHPYKLVKDVRTGCETS
Q7VE10_PROMA          KAMALLKAKLMIIAQEQR-AAEIADIRGDIVEAAWGNQIRNYVFHPYQMVKDLRSGTESN
Q017H4_OSTTA          AAMLRIKAKLTALAEEAR-VADIAELRGDIVKAEWGQQIRNYVLHPYKMVKDVRTGVETS
S4XGF3_SORCE          MAMKVLKAKLYEMELQKR-EAEVQAYNAAKSAINFGSQIRNYVLAPYRLVKDVRTSTEAT
                       .   ::  :                                                  

RF2_ECO57             N--TQAVLDGSL-DQFIEASLKAGL----------------
RF2_ECOLI             N--TQAVLDGSL-DQFIEASLKAGL----------------
RF2_SALTY             N--TQAVLDGSL-DQFIEASLKAGL----------------
RF2_HAEIN             N--TQAVLDGDL-DRFIEASLKAGL----------------
RF2_PASMU             N--TQAVLDGDL-DRFIEASLKAGL----------------
RF2_AERHH             N--TQAVLDGDL-DKFIEASLKSGL----------------
RF2_AERS4             N--TQAVLDGDL-DKFIEASLKSGL----------------
Q0VP01_ALCBS          N--TQAVLDGAL-DPFIEASLKAGL----------------
RF2_JANMA             N--TKAVLDGDL-DDFIAASLKQGV----------------
C3X1D4_OXAFO          N--TKAVLDGDL-DDFIIESLKQGV----------------
RF2_BORPA             N--TQKVLDGDL-DPFIQASLKQGV----------------
RF2_NEIMA             N--TKAVLDGDL-DGFIEASLKQGV----------------
RF2_BUCAI             H--VQSVLDGDL-DDFIEQSLIMGL----------------
RF2_BUCAP             N--VQSVLDGDL-DDFIEQSLIMGL----------------
RF2_BUCBP             N--IQSVLDGGL-DLFVECSLRNGL----------------
RF2_RICBR             D--TKGVLDGDL-EEFVSASLAMNAGSKK------------
RF2_RICCN             D--TKGVLDGDL-EEFVSAHLAMNVGGKK------------
RF2_CAUVC             D--TQGVLDGDL-DAFMAASLA-QRVGHTRDGGEAS-----
RF2_ROSDO             D--TKGVLDGDL-DGFMAATLALDASGKTRAEAQNG-----
Q5GSZ0_WOLTR          N--INSIFDGNI-DCFIVNVLTNKN----------------
RF2_NEOSM             N--ITSVLDGDL-DSFIIATISNNS----------------
PRFB2_ARATH           D--PDSVLEGDL-DGFILSFLSSSLDKDDPEH---------
M2R3G2_CERS8          SGAVQRALDGEI-TGFMEASLRKYKKKL-------------
RF2_BACSU             N--VQAVMDGDI-DTFIDAYLRSKLS---------------
RF2_LISIN             N--IQAVMDGDL-DDFINAYLRSRIG---------------
RF2_STAAN             K--VDAVMDGDI-GPFIESYLRQTMSHD-------------
RF2_LACPL             H--GQAVMDGDL-DPFMDAYLQWKLAQRNPQ----------
RF2_STRGC             Q--VDKVMDGDL-DGFIDAYLKWRLN---------------
RF2_LACLA             Q--ISNVMDGEL-DGFINAYLRWNL----------------
E7FX65_ERYRH          Q--YGDVLDGDI-DDFIEAFLKMNVGV--------------
R4S0H9_PHYAS          Q--LEQVMDGNI-DVFINGYLTKIPFVKNNL----------
B3R0C2_PHYMT          Q--IESVIDGDL-DLFISSFLKKNI----------------
RF2_THEMA             N--VDAVMDGDI-DMFIEAELVYFARRSS------------
RF2_THEM4             N--IDAVMDGDI-DIFIESELIFFAKSKNKK----------
RF2_CLOP1             N--VNGVMDGDI-DNFIIAYLNS------------------
RF2_LEPIC             N--VAAVMDGDI-EPFILAYLKTL-----------------
M6TI43_LEPIR          V--LRFVVTSSI-PTIL------------------------
RF2_LEPBJ             N--VAAVMDGDI-EPFILAYLKTL-----------------
I4B5R7_TURPD          Q--VQNVMDGDF-GPFIDAFLRNKKRN--------------
RF2_NITSB             N--VEAILDGDI-DKIIEDVLIAEAEKESK-----------
RF2_WOLSU             N--IEAILDGDL-DELLEGVLISQFDQPGE-----------
RF2_HELP2             N--VEAILDGDI-DAILEGVLIAKA----------------
RF2_HELPJ             N--VEAILDGDI-DAILEGVLIAKA----------------
RF2_HELHP             D--TSGVLDGDI-DEIIESVLVHTSAKDN------------
RF2_CAMC1             Q--TDAILDGDI-KKMIEGVLIAQKAEA-------------
A7GZF0_CAMC5          Q--TDAILDGDI-KKMIEGVLISQKSTDQS-----------
RF2_CAMJE             Q--VDNILDGDI-KKMIEGVLIALKAE--------------
RF2_CAMLR             Q--VDNILDGDI-KKMIEGVLIAQKAQD-------------
RF2_SULDN             N--VSAILDGDI-DKMIEDVLISQNRS--------------
Q2S1N4_SALRD          D--AEAVLEGEL-DPFIKAYLLKGKKDRDTSPV--------
G2SG74_RHOMG          D--VQAVMDGDL-DPFIRAYLLSQVNEAA------------
A0M2C7_GRAFK          N--VDDVMNGNI-DAFLKSFLMMMGQRNED-----------
E6SVF9_BACT6          D--VNGVMDGKI-DGFIKAYLMEFAGSAE------------
RF2_TREPA             N--IHAVMDGAL-EPFIRSYLEFLCTSTQCVEPQ-------
RF2_BORBU             N--TTSVMDGNI-DNFIEEYLKWKSLN--------------
RF2_CHLTR             N--IQAMMDGELLDAFIKAYLVDYGEIT-------------
RF2_CHLMU             N--IQAMMDGELLDAFIKAYLADYGEIT-------------
RF2_CHLPN             N--VQAMLDGELLDEFIKAYLAEFGEVS-------------
RF2_CHLAB             N--VQAMMDGELLDDFVKAYLAEYGEIS-------------
RF2_THET8             D--PENVLDGDL-MDLIWAGLEWKAGRRQGTEEVEAE----
B4UIK0_ANASK          K--VDDVLDGDL-DPFIQPYLMGVRRTDRAVDE--------
RF2_MYCSJ             N--PSAVLDGDI-DGFLEAGIRWRNRRDDD-----------
RF2_MYCS2             N--PASVLDGDI-DGFLEAGIRWRNRKDDD-----------
RF2_MYCTU             N--PAAVLDGDL-DGFLEAGIRWRNRRNDD-----------
RF2_NOCFA             N--PSAVLNGDI-DGFIESGIRWRMRESQAS----------
RF2_RHOE4             N--PSAVLDGDI-DGFLEAGIRWRMSENQSA----------
RF2_CORDI             D--PQKVLDGDI-DGLLEAGIRWRMAEQQGQN---------
RF2_KINRD             N--TSSIFDGEI-DSFLEAGIRWRKQGES------------
RF2_STRAW             N--PEAVFNGEI-EGFLEAGIRWRKQQEK------------
RF2_SACEN             N--PDAVLDGQI-DGFLEAGIRWRRQQDAA-----------
RF2_SALAI             S--PSSVFDGEL-DAFIEAGIRWRKQQQLSGDNV-------
RF2_PSECP             N--TSAVFDGEI-DDFIDAGIRWRTDNRNAEK---------
RF2_ARTS2             N--TSAVFDGEI-DDFIDAGIRWRTDNRNAAN---------
RF2_BEUC1             N--PSAVFDGDI-DDFIEAGIRWRRQQQTVRESATA-----
Q8G536_BIFLO          Q--TQAVFDGDI-NAFIEAGIRWRHEQRRAAETEE------
A0A0G0MTZ5_9BACT      N--TESVLDGDL-NQFIDAEIRKG-----------------
PRFB1_ARATH           D--ITSVMDGDL-DPFIKAYLKHKYTLAMASAVTN------
K3ZTA0_SETIT          D--ITGVMDGEL-DPFIRAYLKYKLTAAASS----------
Q7VE10_PROMA          D--VESVMNGDL-DLFIQSLLLQGLENQDNERDS-------
Q017H4_OSTTA          D--VTRVLNGGL-DEYMNGYLRWKASKNESE----------
S4XGF3_SORCE          D--VDAVLDGDL-EGFIEAYLLAAAGGSLRKGGSVAEDDAP
                             . . :    :