CLUSTAL format seed alignment for MF_00095

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

SFSA_NOSS1      ---------------------------MTDWLYRYPPLYTGILLKRYKRFFADVQLT---
SFSA_TRIV2      ---------------------------MIDWLYSYPPLYPGILLKRYKRFFADVQLA---
SFSA_NOSP7      ---------------------------MMDWLYRYPPLYPGILLKRYKRFFADVQLT---
SFSA_CYAP4      ---------------------------MAEWIYQYPPLLAGTLLQRYKRFFADIELE---
SFSA_SYNE7      ---------------------------MPQRLYTYPPLLRGRLLQRYKRFFADIELD---
SFSA_SYNP6      ---------------------------MPQRLYTYPPLLRGRLLQRYKRFFADIELD---
SFSA_ACAM1      ---------------------------MADWLYQYPPLLAGTLIKRYKRFLADIELD---
SFSA_CROS5      --------------------------MNTDFVYTFPPLIPGILKRRYKRFLADIELE---
SFSA_RIPO1      --------------------------MTSNLIYPYPTLIPGVLRQRYKRFFADIELA---
SFSA_MICAN      --------------------------MTSLLVHTYPSLVKGILIKRYKRFFADIQLD---
SFSA_SYNP2      -----------------------MTATTQPFVYRYPGLIPGILRKRYKRFLADIELA---
SFSA_SYNY3      ----------------------------MDFLYPYPPLISGILVKRYKRFLADVELD---
SFSA_TRIEI      -----------------MICYPIIMNNQLKFSYKYPSLEPGILIKRYKRFLADIELK---
SFSA_GLOVI      ----------------------------MSVLFEYPPLVRGILRRRYKRFFAEVELE---
SFSA_THEVB      --------------------------MTPPFCWYYPPLQEGILCRRYQRFFAEIELT---
SFSA_SYNJB      ----------------------MECGDGPVPYRFSSPLHRGVLRSRYKRFLADVELE---
SFSA_SYNJA      ----------------------MPAQEGPPPYCFSTPLRRGVLRSRYRRFFAEVELE---
SFSA_PROMA      --------------------------MIGKTITNFSPLTEGILLKRYKRFLADVELD---
SFSA_PROM4      --------------------------MIGKSLLTFSTLNEGILLKRYKRFLADVELD---
SFSA_PROM1      ------------------------MIEIGKTIIKFPPLIEGILIKRYKRFLADIELD---
SFSA_PROMT      ------------------------MIEIGETIIKFPPLKEGILIKRYKRFLADIELD---
SFSA_PROM3      ------------------MTEAIPKGSLGSPLLTFPPLEEGVLVKRYKRFLADVELV---
SFSA_PROMM      --------------------------MLGSPLLTFPPLDEGILVKRYKRFLADVELV---
SFSA_SYNS3      --------------------------MTGTSILQFPVLSEGVLLKRYKRFLADVELK---
SFSA_SYNSC      ---------------------MTGLSSPGDALLRFEPLTEGVLLKRYKRFLADVELS---
SFSA_PARMW      ---------------------MTGCTTPGDALLSFEPLEEGVLIKRYKRFLADVELS---
SFSA_SYNS9      -----------------------------MPLLEFEPLQEGVLIKRYKRFLADIELS---
SFSA_SYNPW      --------------------------MTGTPLLSFEPLTEGILLKRYKRFLADIELE---
SFSA_SYNR3      --------------------------MPSVEVLRFEPLLEGVLQRRWKRFLSEVELA---
SFSA_PROMS      ---------------------------MNDRIIDFDPLIEGVLIKRYKRFLADIELE---
SFSA_PROM0      ---------------------------MNDRIIDFDPLIEGVLIKRYKRYLADIALE---
SFSA_PROM2      ---------------------------MNDRIIEFDPLIEGVLIKRYKRFLADIKLE---
SFSA_PROM9      ---------------------------MNDRIIEFDPLIEGVLINRYKRFLADIELE---
SFSA_PROM5      ---------------------------MDDRIINFEPLIEGVLIKRYKRFLSDIKLD---
SFSA_PROMP      ---------------------------MNDRIIEFEPLIEGILIKRYKRFLADIQIE---
SFSA_ECO8A      -------------------------------MEFSPPLQRATLIQRYKRFLADVITP---
SFSA_ECOHS      -------------------------------MEFSPPLQRATLIQRYKRFLADVITP---
SFSA_ECOSE      -------------------------------MEFSPPLQRATLIQRYKRFLADVITP---
SFSA_ECOLI      -------------------------------MEFSPPLQRATLIQRYKRFLADVITP---
SFSA_ECODH      -------------------------------MEFSPPLQRATLIQRYKRFLADVITP---
SFSA_ECOBW      -------------------------------MEFSPPLQRATLIQRYKRFLADVITP---
SFSA_ECOLC      -------------------------------MEFSPPLQRATLIQRYKRFLADVITP---
SFSA_ECO55      -------------------------------MEFSPPLQRATLIQRYKRFLADVITP---
SFSA_ECO5E      -------------------------------MEFSPPLQRATLIQRYKRFLADVITP---
SFSA_ECO57      -------------------------------MEFSPPLQRATLIQRYKRFLADVITP---
SFSA_ECO24      -------------------------------MEFSPPLQRATLIQRYKRFLADVITP---
SFSA_SHIDS      -------------------------------MEFSPPLQLATLIQRYKRFLADVITP---
SFSA_SHIBS      -------------------------------MEFSPLLQRATLIQRYKRFLADVITP---
SFSA_SHISS      -------------------------------MEFSPPLQRATLIQRYKRFLADVITP---
SFSA_SHIB3      -------------------------------MEFSPPLQRATLIQRYKRFLADVITP---
SFSA_SHIFL      -------------------------------MEFSPPLQRATLIQRYKRFLADVITP---
SFSA_SHIF8      -------------------------------MEFSPPLQRATLIQRYKRFLADVITP---
SFSA_ECOSM      -------------------------------MEFSPPLQRATLIQRYKRFLADVITP---
SFSA_ECO7I      -------------------------------MEFSPPLQRATLIQRYKRFLADVITP---
SFSA_ECOUT      -------------------------------MEFSPPLQRATLIQRYKRFLADVITP---
SFSA_ECO27      -------------------------------MEFSPPLQRATLIQRYKRFLADVITP---
SFSA_ECO81      -------------------------------MEFSPPLQRATLIQRYKRFLADVITP---
SFSA_ECOK1      -------------------------------MEFSPPLQRATLIQRYKRFLADVITP---
SFSA_ECO45      -------------------------------MEFSPPLQRATLIQRYKRFLADVITP---
SFSA_ECOL6      -------------------------------MEFSPPLQRATLIQRYKRFLADVITP---
SFSA_ECOL5      -------------------------------MEFSPPLQRATLIQRYKRFLADVITP---
SFSA_ECOLU      -------------------------------MEFSPPLQRATLIQRYKRFLADVITP---
SFSA_ESCF3      -------------------------------MQFFPPLQRATLIQRYKRFLADVITP---
SFSA_CITK8      -------------------------------MQFSPPLQRATLIQRYKRFLADVITP---
SFSA_SALPA      -------------------------------MLFSPPLQRATLIQRYKRFLADVITP---
SFSA_SALPK      -------------------------------MLFSPPLQRATLIQRYKRFLADVITP---
SFSA_SALCH      -------------------------------MLFSPPLQRATLIQRYKRFLADVITP---
SFSA_SALA4      -------------------------------MLFSPPLQRATLIQRYKRFLADVITP---
SFSA_SALG2      -------------------------------MLFSPPLQRATLIQRYKRFLADVITP---
SFSA_SALDC      -------------------------------MLFSPPLQRATLIQRYKRFLADVITP---
SFSA_SALEP      -------------------------------MLFSPPLQRATLIQRYKRFLADVITP---
SFSA_SALHS      -------------------------------MLFSPPLQRATLIQRYKRFLADVITP---
SFSA_SALNS      -------------------------------MLFSPPLQRATLIQRYKRFLADVITP---
SFSA_SALPB      -------------------------------MLFSPPLQRATLIQRYKRFLADVITP---
SFSA_SALSV      -------------------------------MLFSPPLQRATLIQRYKRFLADVITP---
SFSA_SALTY      -------------------------------MLFSPPLQRATLIQRYKRFLADVITP---
SFSA_SALTI      -------------------------------MLFSPPLQRATLIQRYKRFLADVITP---
SFSA_SALAR      -------------------------------MLFSPPLQRATLIQRYKRFLADVITL---
SFSA_KLEP3      -------------------------------MQFDPPLQPAILLKRYKRFLADVITP---
SFSA_KLEP7      -------------------------------MQFDPPLQPAILLKRYKRFLADVVTP---
SFSA_ENT38      -------------------------------MKFSPALQSATLILRYKRFLADVVTP---
SFSA_CROS8      -------------------------------MEFTPALQPARLIQRYKRFLADVVTP---
SFSA_PECAS      -------------------------------MDYTPRLQPARLIKRYKRFLADVVTP---
SFSA_PECCP      -------------------------------MDYTPRLQPARLIKRYKRFLADVVTP---
SFSA_YERPE      ------------------------------MLQFTPPLQPATLILRYKRFLADIVTP---
SFSA_YERPP      ------------------------------MLQFTPPLQPATLILRYKRFLADIVTP---
SFSA_YERPA      ------------------------------MLQFTPPLQPATLILRYKRFLADIVTP---
SFSA_YERPN      ------------------------------MLQFTPPLQPATLILRYKRFLADIVTP---
SFSA_YERPS      ------------------------------MLQFTPPLQPATLILRYKRFLADIVTP---
SFSA_YERP3      ------------------------MPANAPLLQFTPPLQPATLILRYKRFLADIVTP---
SFSA_YERE8      ------------------------------MLSFNPRLQPATLIKRYKRFLADIVTP---
SFSA_PHOLL      -------------------------------MEFHPPLQSATLIRRYKRFLADVITP---
SFSA_SERP5      -------------------------------MIFSPPLHHATLIKRYKRFLADVITP---
SFSA_EDWI9      -------------------------------MQFTTPLQSAILIKRYKRFLADVRRP---
SFSA_SODGM      -------------------------------MLFEPALKPARLIQRYKRFLADVVTP---
SFSA_ACTP2      --------------------------------MQFPSLSCGILIKRYKRFLADILLP---
SFSA_ACTP7      --------------------------------MQFPSLSCGILIKRYKRFLADILLP---
SFSA_ACTPJ      --------------------------------MQFPSLSCGILIKRYKRFLADILLP---
SFSA_ACTSZ      --------------------------------MQLPLLQPAIFIRRYKRFMADVELP---
SFSA_MANSM      --------------------------------MRLPPLQAAKFIRRYKRFMADVELA---
SFSA_HAEI8      --------------------------------MQLPALQSAKLIRRYKRFLADIELP---
SFSA_HAEIE      --------------------------------MQLPALQSAKLIRRYKRFLADIELP---
SFSA_HAEIG      --------------------------------MQLPALQSAKLIRRYKRFLADIELP---
SFSA_HAEIN      --------------------------------MQLPALQSATLIRRYKRFLADIELP---
SFSA_PASMU      --------------------------------MQLPPLQSATLIRRYKRFLADVQLD---
SFSA_HAES1      --------------------------------MQLPNLQSATLLRRYKRFLADVELN---
SFSA_HISS2      --------------------------------MQLPNLQSATLLRRYKRFLADVELN---
SFSA_PSYIN      ---------------------------------MFENLQKAILIRRYKRFLADIELH---
SFSA_AERHH      -------------------------------MIFDPPLQSGQLVSRYKRFLTDVQLD---
SFSA_AERS4      -------------------------------MIFDPPLQSGQLISRYKRFLTDVRLD---
SFSA_ALIF1      -------------------------------MKFEPELESGKLIKRYKRFLADIKLD---
SFSA_ALIFM      -------------------------------MKFEPELESGKLIKRYKRFLADIKLE---
SFSA_ALISL      -------------------------------MKFEAKLESGILIRRYKRFLTDIKLP---
SFSA_PHOPR      -------------------------------MKFDPPLQSATLIKRYKRFLTDIELP---
SFSA_VIBCB      -------------------------------MQFKPALESATLLKRYKRFLADIELD---
SFSA_VIBPA      -------------------------------MQFKPALESATLLKRYKRFLADIEFD---
SFSA_VIBA3      -------------------------------MHFNPPLEPATLIKRYKRFLTDIQLP---
SFSA_VIBVU      -------------------------------MHFEPALDCALLQKRYKRFLADVTYQ---
SFSA_VIBVY      -------------------------------MHFEPALDCALLQKRYKRFLADVTYQ---
SFSA_VIBCH      -------------------------------MHFSPPLQKGTLLKRYKRFLADVTLE---
SFSA_VIBC3      -------------------------------MHFSPPLQKGTLLKRYKRFLADVALE---
SFSA_PROMH      -------------------------------MKFEQPLQSATLLKRYKRFLADVVTA---
SFSA_COLP3      ---------------------------------MILQVQPAKLIKRYKRFLADIELN---
SFSA_PSET1      -------------------------------MKYQPALQSATLLKRYKRFLADLQLS---
SFSA_IDILO      -------------------------------MQFNKPLRQGVLQKRYKRFLADIDFG---
SFSA_SHEB8      -------------------------------MEFTPPLQQGILLRRYKRFLADVQLS---
SFSA_SHEB2      -------------------------------MEFTPPLQQGILLRRYKRFLADVQLS---
SFSA_SHEB5      -------------------------------MEFTPRLQQGILLRRYKRFLADVQLS---
SFSA_SHEB9      -------------------------------MEFTPPLQQGILLRRYKRFLADVQLS---
SFSA_SHEPC      -------------------------------MQFEPALQQGRLVKRYKRFLADIKLA---
SFSA_SHESW      -------------------------------MQFEPALQQGRLVKRYKRFLADIKLA---
SFSA_SHESM      -------------------------------MHFSPALKPGKLLKRYKRFLADVQLE---
SFSA_SHESR      -------------------------------MHFSPALKPGKLLKRYKRFLADVQLE---
SFSA_SHESA      -------------------------------MHFSPALKSGKLLKRYKRFLADIQLE---
SFSA_SHEON      -------------------------------MHFTPALKPGKLLKRYKRFLADVQLE---
SFSA_SHEDO      -------------------------------MQYSPNLAHGTLLRRYKRFLADVLLD---
SFSA_SHEFN      -------------------------------MKFTPELESGVLIKRYKRFLADIMLP---
SFSA_SHEHH      -------------------------------MEFSSAFESGVLLQRYKRFLTDITLD---
SFSA_SHEPA      -------------------------------MEFSPAFETGVLVQRYKRFLTDITLD---
SFSA_SHEPW      -------------------------------MKFTPEFASGLLIQRYKRFLTDITLE---
SFSA_SHESH      -------------------------------MQFTPPFEQGVLLRRYKRFLTDIRLS---
SFSA_SHEWM      -------------------------------MEFTPSFEQGTLIKRYKRFLTDIRLE---
SFSA_SHELP      -------------------------------MIFIPPFEQGKLLRRYKRFLADVLLD---
SFSA_SHEAM      -------------------------------MEYPAPLSSAVLITRYKRFLADVTLE---
SFSA_HAHCH      -------------------------------MKIDIVPTPGRLLKRYKRFLADIQLP---
SFSA_ALTMD      -------------------------------MKFSPSLLRGTLIKRYKRFFADVELE---
SFSA_PSEA6      -------------------------------MQFYNSLIEGILVKRYKRFLTDVTLL---
SFSA_MARN8      -------------------------------MKFSEPLVEGRLIRRYKRFLADVQLP---
SFSA_MARMS      ------------MRVAVFDCDGFHKKFWSPVVKFPTPLIEGKLIKRYKRFLSDIELP---
SFSA_AZOVD      -------------------------------MRFDPPLEEGHLLRRYKRFFADIETP---
SFSA_PSEMY      -------------------------------MRFDPPLEEGRLLRRYKRFLADIETA---
SFSA_PSEAE      -------------------------------MRFEQPLEEGRLLRRYKRFLADIESA---
SFSA_PSEA8      -------------------------------MRFEQPLEEGRLLRRYKRFLADIESA---
SFSA_PSEAB      -------------------------------MRFEQPLEEGRLLRRYKRFLADIESA---
SFSA_PSEA7      -------------------------------MRFDPPLEEGRLLRRYKRFLADIESA---
SFSA_PSEP1      -------------------------------MRFSPSLEQGRLLRRYKRFLADIELA---
SFSA_PSEPK      -------------------------------MRFSPSLEQGRLLRRYKRFLADIELA---
SFSA_PSEPG      -------------------------------MRFFPPLEQGRLLRRYKRFLADIELT---
SFSA_PSEPW      -------------------------------MVFFPPLEQGRLLRRYKRFLADIELA---
SFSA_PSEE4      -------------------------------MVFFPELEQARLLRRYKRFLADIELA---
SFSA_PSEF5      -------------------------------MRFDPPLEEGRLLRRYKRFLADIETT---
SFSA_PSEFS      -------------------------------MRFNPPLEEARLIRRYKRFLTDIETV---
SFSA_PSEPF      -------------------------------MRFHPPLEEGRLIRRYKRFLADIETV---
SFSA_PSE14      -------------------------------MRFAPQLEQGRLLIRYKRFLADIETD---
SFSA_PSEU2      -------------------------------MRFSPQLEQGRLLVRYKRFLADIETD---
SFSA_PSESM      -------------------------------MRFSPELEQGRLLVRYKRFLADIETD---
SFSA_SACD2      -------------------------------MKFEYPLIPATLLRRYKRFLADVELS---
SFSA_TERTT      -------------------------------MLFEPPLISATLVRRYKRFLADVVLA---
SFSA_ALCBS      -------------------------------MKFDPPLETVTLLRRYKRFMADVVRA---
SFSA_ACIF2      --------------------------------MNLPPLTPATLIRRYKRFLADCALA---
SFSA_ACIF5      --------------------------------MNLPPLTPATLIRRYKRFLADCALA---
SFSA_RHIME      -------------------------------MNFPRPLVPATLVQRYKRFLFDAILA---
SFSA_SINMW      -------------------------------MKFTGPLVPATLVQRYKRFLFDAILT---
SFSA_AGRFC      -------------------------------MLFTPPLIPATLISRYKRFLFDAVLE---
SFSA_AGRRK      -------------------------------MLFNPPLVPARLIARYKRFLFDAELE---
SFSA_AGRVS      -------------------------------MTFDPPLVAATLVRRYKRFLFDAVLE---
SFSA_BRUAB      -------------------------------MLFPTPLISGRLERRYKRFLADVTLD---
SFSA_BRUSI      -------------------------------MLFPTPLISGRLERRYKRFLADVTLD---
SFSA_BRUC2      -------------------------------MLFPTPLISGRLERRYKRFLADVTLD---
SFSA_BRUA2      -------------------------------MLFPTPLISGRLERRYKRFLADVTLD---
SFSA_BRUA1      -------------------------------MLFPTPLISGRLERRYKRFLADVTLD---
SFSA_BRUO2      -------------------------------MLFPTPLISGRLERRYKRFLADVTLD---
SFSA_BRUSU      -------------------------------MLFPTPLISGRLERRYKRFLADVTLD---
SFSA_BRUME      -------------------------------MLFPTPLISGRLERRYKRFLADVTLD---
SFSA_BRUMB      -------------------------------MLFPTPLISGRLERRYKRFLADVTLD---
SFSA_BRUA4      -------------------------------MIFQTPLVTGRLERRYKRFLADVTLD---
SFSA_CHESB      -------------------------------MIFPSPLTEARLIRRYKRFLADVVLA---
SFSA_BARHE      -------------------------------MFFIHKLFPAKLIRRYKRFLADVKRE---
SFSA_BARQU      -------------------------------MLFIPKLFPAKLIRRYKRFLADVKRD---
SFSA_BART1      -------------------------------MHFIPKLFPAKLIRRYKRFLADVKQD---
SFSA_DINSH      -------------------------------MRFQTPLVPARLVRRYNRFLSDAVLED--
SFSA_JANSC      -------------------------------MRFPTPLVPARLLRRYKRFLSDAVLED--
SFSA_ROSDO      -------------------------------MRFQTELVPARLTRRYKRFLADCVLDA--
SFSA_RUEPO      -------------------------------MRFQTTLVPARLIRRYKRFLADCQLE---
SFSA_RUEST      -------------------------------MRFPTPLIPATLIKRYKRFLADCRLE---
SFSA_AZOC5      -------------------------------MRFPVPLVPARLVRRYKRFLADAVLE---
SFSA_XANP2      -------------------------------MRFPTPLIQGRLIRRYKRFLADVVLA---
SFSA_RHOCS      -------------------------------MRFPTPLIPATLVRRYKRFLADVLLP---
SFSA_MAGSA      -------------------------------MRFAAPLVRATLIKRYKRFMADVRFD---
SFSA_RHORT      -------------------------------MLFPTPLVEGRLVKRYMRFLADVILD---
SFSA_CAUVC      -------------------------------MLLPQPLIHGRLVSRYKRFFADLVLD---
SFSA_CAUVN      -------------------------------MLLPQPLIHGRLVSRYKRFFADLVLD---
SFSA_CAUSK      -------------------------------MLLPQPMARGVIVQRYKRFFIDLVLD---
SFSA_PHEZH      -------------------------------MDFPSPLIRGRLVSRYKRFFADVVLD---
SFSA_METC4      -------------------------------MRFPTPLIEGRLVRRYKRFLADVRLP---
SFSA_METEP      -------------------------------MRFPTPLIEGRLVRRYKRFLADVTLA---
SFSA_METPB      -------------------------------MRFPSPLIEGRLVRRYKRFLADVALA---
SFSA_METRJ      -------------------------------MQFAAPLVPGRLVQRYKRFLADIDTD---
SFSA_METNO      -------------------------------MRFPSPLTEGRLVRRYKRFLADVELA---
SFSA_METS4      ----------------------------MPALRFPSRLTEGRLVRRYKRFLADVELA---
SFSA_MARMM      -------------------------------MKFPTDLIEGRLVKRYKRFFADVELA---
SFSA_NITOC      -------------------------------MSFDQILLPGILRRRYQRFFADVALE---
SFSA_CHRSD      -------------------------------MQY-TELVPGTLIRRYKRFLADVALA---
SFSA_MAGMM      -------------------------------MEYPTPLTPARMVQRYKRFLSDVTLA---
SFSA_ALKEH      -------------------------------MIFDTPLQGGQLIRRYKRFLADITLD---
SFSA_HALHL      -------------------------------MEFEQVLTEARLVRRYRRFLADVEDA---
SFSA_THISH      -------------------------------MEFEPALIEVTLLRRYKRFLADVRTP---
SFSA_CITBB      -------------------------------MKLPQPLFQGTLIRRYQRFLADVELD---
SFSA_GEOSM      -------------------------------MKLPQPLFQGTLIRRYQRFLADVELE---
SFSA_GEOMG      -------------------------------MRLPTPLYPGTLVRRYQRFLADVQLA---
SFSA_GEOSL      -------------------------------MILPRPLYSGTLIRRYQRFLADVRLD---
SFSA_PELPD      -------------------------------MRLP-PLIAGTLVRRYKRFLADVILE---
SFSA_GEODF      -------------------------------MYLMPPLIPAVLIRRYQRFLADFQLE---
SFSA_GEOUR      -------------------------------MQLPIPLFPATLIRRYKRFLADFELE---
SFSA_SYNC1      -------------------------------MKLPAPLIEGRLVRRYKRFLADVELA---
SFSA_DESPS      -------------------------------MDFSQGLTPARLIRRYKRFLADVEIE---
SFSA_BDEBA      -------------------------------MKFHSKLQEGIFLKRYKRFFADIEFQ---
SFSA_PELUB      -------------------------------MEFTKALIKGKLIKRYKRFFADVKIG---
SFSA_DESVH      --------------------------MRKILLPYPAGCATGTFVRRVKRFSVEMTRDG--
SFSA_DESVV      --------------------------MRKILLPYPAGCATGTFVRRVKRFSVEMTRDG--
SFSA_OLEA2      -------------------------MSDSPLIAFPRGCITGTFIRRVKRFSVEMETAGAG
SFSA_MARSD      --------------------------MSEPLIFYPQGCCRAIFIRRYKRFTVEAMLDG--
SFSA_LAWIP      --------------------------MEKTIIYFPKGCVIGRFVKRYKRFFVNVLVDG--
SFSA_SYNFM      MTDSAKPQNPDPGHESRRVAPLAGSPRSPFLIEFPEDSFTAVFLGREKRFLVEAERNG--
SFSA_ALKMQ      -----------------------------MKIYIEGEKIRGTFQKRVNRFIAEVKVGSQL
SFSA_NATTJ      -----------------------------MIYNFIDSLIEGKFQKRLNRFVCNVEVNGES
SFSA_ACET2      -------------------------------MRIEGELVKAKFVKRLNRFVALVEVDGVQ
SFSA_CARHZ      ------------------------------MEFNFTP-IPAVFCKKLNRFVGEVVLQGEK
SFSA_DESRM      --------------------MNGLNNHASNIEIVLPELIEAVFVERVNRFVGMVQVAGHI
SFSA_ARCFU      -----------------------------MKLFEIENAVDCRIIGRVNRFVVDVEVDGRR
SFSA_PYRFU      -----------------------------MKLMEVSPLFPCIFLRRVNRFVGLVRIKERI
SFSA_AQUAE      --------------------------------MKLPPLMPAIFVKRLNRFVGKVFLNGKI
SFSA_THEM4      ----------------------------MMNIIKIDNTQSGIFLERINKYLAKIYLNENV
SFSA_METST      --------------------------------MIIDNLTIGKYISRPNRFTIEFKDKDKA
SFSA_THEP1      ------------------------------MRLILPADTEGIFLERKSRFTGVALVEGKK
SFSA_THESQ      ------------------------------MRLILPADTEGIFLERKSRFTGVALVEGKK
SFSA_THEMA      ------------------------------MRLILPADTEGIFLERKSRFTGVALVEGKK
SFSA_THENN      ------------------------------MKLEIPFDEEGIFLERKTRFTGIVSVGKER
SFSA_METTH      ----------------------------MMVAMIIENPLRGSYIERPNRFTVAVYVDGER
SFSA_METBU      -------------------------MVRNDLVMEIPWDIEATLLSRPNRFLGIVEMDEST
SFSA_THEAC      -------------------------------MRFEG-LIGARILKRINRFAVQIDVEGRT
SFSA_THEVO      -------------------------------MEFTD-LLPCTVVERVNRFLVNVKLNDKI
SFSA_PICTO      ------------------MSPFIKRGHGFMVLSFEN-LIDAVIVSRINRFVVKCMVNNEE
SFSA_SULAC      -----------------------MTTSSFVVYDFDTPLFEDIVKERINRFVV-ITQSGK-
SFSA_SULTO      ----------------------------MIVYSFPT-LYEEIVKARINRFTV-VTESEK-
SFSA_SULIA      --------MKERDSRNQIGDLPFRVKEGFSVYEFIEQLYEANVVERINRFLVKVTFNGKE
SFSA_SULIK      --------MKERDSRNQIGDLPFRVKEGFSVYEFIEQLYEANVVERINRFLVKVTFNGKE
SFSA_SULIM      --------MKERDSRNQIGDLPFRVKEGFSVYEFIEQLYEANVVERINRFLVKVTFNGKE
SFSA_SULIL      --------MNERDSRNQIGDLPFRVKEGFSVYEFIEQLYEAHVVERINRFLVKVTFNGKE
SFSA_SACS2      --------MNESNSQDLTRVSPFYIKEGFSVYEFTEKLFEAYVIERINRFLVKVTLDGEE
SFSA_PYRAE      -----------------------MGIPGGEILQLPTPDVEGVFLKRLNRFAGVALIGGRE
SFSA_PYRAR      -----------------------------MYFPLEEPDAYGDFVRRLNRFAGIAVIGGRE
SFSA_PYRIL      -----------------------------MYFPIEKPDVWGIFKKRLNRFVGLAEIDGVE
SFSA_PYRNV      --------------------------MAHVCLPLDEPDARGVFKRRLNRFVGVAEIGGAD
SFSA_PYRCJ      -----------------------------MHFPLPQPDVSATFKRRLNRFLGVAEVEGEE
SFSA_CALMQ      ----------------------------MLGFTINKPDVEGVFIKRINRFLGIGLINGVE
SFSA_CLOB8      --------------------------------MKYNNILKGKFILRPNRFIAYVEID-GN
SFSA_RUMCH      --------------------------------MKYKNIKRGIFIERPNRFIAHVEID-SV
SFSA_DESHD      --------------------------------MKYTNIREGQFLSRPNRFIAKVEID-GK
SFSA_DESHY      --------------------------------MKYTNIREGQFLSRPNRFIAKVEID-GK
SFSA_ALKOO      --------------------------------MKYKKVVEGIFLKRPNRFIAQVLID-GQ
SFSA_CLOB6      -------------------------------MKITKNILKAEFIKRPNRFQAYVKIN-EK
SFSA_CLOBJ      -------------------------------MKITKNILKAEFIKRPNRFQAYVKIN-EK
SFSA_CLOBL      -------------------------------MKITKNILKAEFIKRPNRFQAYVKIN-EK
SFSA_CLOBK      -------------------------------MKITKNILKAEFIKRPNRFQAYVKIN-EK
SFSA_CLOBM      -------------------------------MKITKNILKAEFIKRPNRFQAYVKIN-EK
SFSA_CLOB1      -------------------------------MKITKNILKAEFIKRPNRFQAYVKIN-EK
SFSA_CLOBH      -------------------------------MKITKNILKAEFIKRPNRFQAYVKIN-EK
SFSA_CLOTE      -------------------------------MIIKKNIKRAEFIKRPNRFQAYVKVD-NE
SFSA_CLOK5      -------------------------------MIFHKNIVKAEFIRRPNRFQAYVKLN-GS
SFSA_CLOK1      -------------------------------MIFHKNIVKAEFIRRPNRFQAYVKLN-GS
SFSA_CLOAB      -------------------------------MKIDNMTKLAKFVKRPNRFQAYIELE-GE
SFSA_CLOP1      -------------------------------MKYNSVIRKAIFLRRPNRFQAYVVLD-DE
SFSA_CLOPS      -------------------------------MKYNSVIRKAIFLRRPNRFQAYVVLD-DE
SFSA_CLOPE      -------------------------------MKYNSVIRKAIFLRRPNRFQAYVVLD-DE
SFSA_CLONN      -------------------------------MKINNVL-TAKFIKRPNRFVAYVYLN-NE
SFSA_CLOBA      -------------------------------MIFEKKTHIVEFVRRPNRFQGYVIID-GK
SFSA_THEP3      -------------------------------MVITNPIVYGKFIKRINRFEAYVELNSGE
SFSA_THEPX      -------------------------------MVITNPIVYGKFIKRINRFEAYVELNSGE
SFSA_CALS4      -------------------------------MIIKNPIIKGKFIERLNRFEAYVEID-GI
SFSA_LACP3      --------------------------------MYYQNVSVGQLIKRVSRFTV-EIDLNGT
SFSA_LACCB      --------------------------------MYYQNVSVGQLIKRVSRFTV-EIDLNGT
SFSA_ENTMU      --------------------------------MDYQDVEIAYFIERPNRFIAFCLNKKGE
SFSA_METS3      -----------------------------------MDYVKGIFKNRPNRFIAEVEVDGKI
SFSA_ALKCK      -----------------------------MRLPPLTKMQ---FVHRPNRFVVELKRTDTE
SFSA_ALKHC      -----------------------------MFLPFNTRLHHATFLRRPNRFIVE-ARLDTG
SFSA_CHLSY      -------------MVTGHGTGHHGQSPVRVPLSSGAPLVEATFASRPSQFLVE-AQMG-G
SFSA_CHLAA      -------------MVTGHGTGHHGQSPVRVPLSSGAPLVEATFASRPSQFLVE-AQMG-G
SFSA_CHLAD      -------------MNTGHGTGQQIHPIVRVPFSAGVPLIEATFAARSGQFLVE-AQMG-G
SFSA_MOOTA      --------------------------MVELP----ANLIKATFLSRPNRFTVV-AARE-G
SFSA_SYMTH      ---------------------------MKGAEPLAELRLRATFLERPNRFVAR-VRLEDG
SFSA_AERPE      ------------------------------MAVELRYDEEAVFLRRVNRFVVEVKSS---
                                                             :  ::          

SFSA_NOSS1      SGEV--VTAHCPNTGPMTGVSTLGSA-VQLSKSANPK---------RKLAYTLELIQVHD
SFSA_TRIV2      SGEV--VTAHCPNTGPMTGVSTLGSV-VQLSKSANPK---------RKLAYTLELIQVHD
SFSA_NOSP7      SGEI--VTAHCPNTGPMTGVSTPQSA-VQLSKSDNLN---------RKLAYTLELIQVHD
SFSA_CYAP4      SGEV--ITAHCPNTGPMTGISTPGSR-VQVSRSNNPN---------RKLAYTWEMIQVED
SFSA_SYNE7      SGET--ITAHCPNTGPMTGVCQMGNL-VYVSKSDNPK---------RKLAYTWELIEVTD
SFSA_SYNP6      SGET--ITAHCPNTGPMTGVCQMGNL-VYVSKSDNPK---------RKLAYTWELIEVTD
SFSA_ACAM1      TGEV--VTAHCPNTGPMTGMCAPHSR-VQISQSNNPK---------RKLAYTWEMIEVCD
SFSA_CROS5      SGEM--ITAHCANTGPMIGVCDAESQ-VYVSKSNNPK---------RKLAYSWELIEV--
SFSA_RIPO1      SGEI--ITAHCPNTGPMTGVCTIGSP-VYISPSDNPK---------RKLAYTWEMIQV--
SFSA_MICAN      NGEL--ITAHCANTGPMTDVCVEGQP-VYLSRSDNPK---------RKLAYTWEMIQL--
SFSA_SYNP2      SGEI--VTAHCPNTGPMTGICELGAP-VMLSKSDNPK---------RKLAYTWEMIQLPT
SFSA_SYNY3      NGEI--VTAHCPNTGPMTGVCQVGAQ-VYLSKSDNPQ---------RKLAYTWEMIQI--
SFSA_TRIEI      SGGI--ITAHCPNTGPMTGVSTPGSN-VMVSYSNNPK---------RKLAYTWELIEVTD
SFSA_GLOVI      DGQL--VTAHCPNTGPMRAISTLGSP-VYLSRSPDPA---------RKLAYTWEMIDL--
SFSA_THEVB      SGDR--VTAHCPNTGPMTGICQVGAP-VQVSYHADPK---------RKLAYTWEMIFV--
SFSA_SYNJB      NGQQ--IIAHCPNTGPMSGVCQVGAP-VYLSHHPEPK---------RKLAYTWEMIQV--
SFSA_SYNJA      NGQP--VTAHCPNTGPMTGVCQVGAP-VYLSYHPDPK---------RKLAYTWEMIQV--
SFSA_PROMA      TGEV--VTAHCANTGPMKGVLHVGGR-VRLRHSPSPS---------RKLSWSWEQAQVPS
SFSA_PROM4      TGHI--VTAHCANTGPMTGVLKPGGR-VRVRYAPSPS---------RKLSWSWEQAQVVN
SFSA_PROM1      DGEV--VTAHCANTGPMKGVLWPGGR-VRLKYSPSPK---------RKLDWSWEQAEVPS
SFSA_PROMT      DGEV--VTAHCANTGPMKGVLWPGRR-VRLKYSPSPK---------RKLDWSWEQAEVPS
SFSA_PROM3      SGEI--VTAHCANTGPMTGVLHPGGR-VRLRHAPSPK---------RKLAWTWEQAEAPS
SFSA_PROMM      SGEI--VTAHCANTGPMTGVLHPGGR-VRIRHAPSPK---------RKLAWTWEQAEAPS
SFSA_SYNS3      DGQV--VTVHCANTGPMKGVLHPGGR-VRVRHAPSPK---------RKLAWTWEQAEIPS
SFSA_SYNSC      SGET--VTAHCANTGPMTGVLIPGQR-VRLRYAPSPK---------RKLAWTWEQAEVPG
SFSA_PARMW      SGEV--ITAHCANTGPMTGVLIPGQR-VRLRHAPSPK---------RKLAWTWEQAEVPG
SFSA_SYNS9      NGEV--VTAHCANTGPMTGVLIPGQR-VRLRHAPSPK---------RKLAWTWEQAEVPG
SFSA_SYNPW      DGSC--VTAHCANTGPMTGVLIPGQR-VRLRHAPSPT---------RKLAWTWEQAEVPG
SFSA_SYNR3      GGEL--VTAHCANTGPMTGVLHPGGR-VRVRHDPSPK---------RKLAYTWEQAEMPG
SFSA_PROMS      SGEV--VTAHCANTGPMKGLLSEGAK-VRISFSPSPK---------RKLPFTWEQICVFN
SFSA_PROM0      SGEV--VTAHCANTGPMKGLLREGAK-VRISVSTSPK---------RKLPFTWEQICVLD
SFSA_PROM2      SGDV--VTAHCANTGPMKGLLTEGAK-VRISVSHSPK---------RKLPFTWEQICVLD
SFSA_PROM9      TGEV--VTAHCANTGPMKGLLTEGAK-VRMSVSPSPK---------RKLPFTWEQICVLD
SFSA_PROM5      NGEI--VTAHCANTGPMKGLLNEGAK-VRISYSSSPK---------RKLSWTWEQVEVTG
SFSA_PROMP      NGEI--VTAHCANTGPMKGLLNEGAN-VRISFSSSTK---------RKLPWTWEQVKVIG
SFSA_ECO8A      DGRE--LTLHCPNTGAMTGCATPGDT-VWYSTSDNTK---------RKYPHTWELTQS--
SFSA_ECOHS      DGRE--LTLHCPNTGAMTGCATPGDT-VWYSTSDNTK---------RKYPHTWELTQS--
SFSA_ECOSE      DGRE--LTLHCPNTGAMTGCATPGDT-VWYSTSDNTK---------RKYPHTWELTQS--
SFSA_ECOLI      DGRE--LTLHCPNTGAMTGCATPGDT-VWYSTSDNTK---------RKYPHTWELTQS--
SFSA_ECODH      DGRE--LTLHCPNTGAMTGCATPGDT-VWYSTSDNTK---------RKYPHTWELTQS--
SFSA_ECOBW      DGRE--LTLHCPNTGAMTGCATPGDT-VWYSTSDNTK---------RKYPHTWELTQS--
SFSA_ECOLC      DGRE--LTLHCPNTGAMTGCATPGDT-VWYSTSDNTK---------RKYPHTWELTQS--
SFSA_ECO55      DGRE--LTLHCPNTGAMTGCATPGDT-VWYSTSDNTK---------RKYPHTWELTQS--
SFSA_ECO5E      DGRE--LTLHCPNTGAMTGCATPGDT-VWYSTSDNTK---------RKYPHTWELTQS--
SFSA_ECO57      DGRE--LTLHCPNTGAMTGCATPGDT-VWYSTSDNTK---------RKYPHTWELTQS--
SFSA_ECO24      DGRE--LTLHCPNTGAMTGCATPGDT-VWYSTSDNTK---------RKYPHTWELTQS--
SFSA_SHIDS      DGRE--LTLHCPNTGAMTGCATPGDT-VWYSTSDNTK---------RKYPHTWELTQS--
SFSA_SHIBS      DGRE--LTLHCPNTGAMTGCATRGDT-VWYSTSDNTK---------RKYPHTWELTQS--
SFSA_SHISS      DGRE--LTLHCPNTGAMTGCATRGDT-VWYSTSDNTK---------RKYPHTWELTQS--
SFSA_SHIB3      DGRE--LTLHCPNTGAMTGCATRGDT-VWYSTSDNTK---------RKYPHTWELTQS--
SFSA_SHIFL      DGRE--LTLHCPNTGAMTGCATPGDT-VWYSTSDNTK---------RKYPHTWELTQS--
SFSA_SHIF8      DGRE--LTLHCPNTGAMTGCATPGDT-VWYSTSDNTK---------RKYPHTWELTQS--
SFSA_ECOSM      DGRE--LTLHCPNTGAMTGCATPGDT-VWYSTSDNTK---------RKYPHTWELTQS--
SFSA_ECO7I      DGRE--LTLHCPNTGAMTGCATPGDT-VWYSTSDNTK---------RKYPHTWELTQS--
SFSA_ECOUT      DGRE--LTLHCPNTGAMTGCATPGDT-VWYSTSDNTK---------RKYPHTWELTQS--
SFSA_ECO27      DGRE--LTLHCPNTGAMTGCATPGDT-VWYSTSDNTK---------RKYPHTWELTQS--
SFSA_ECO81      DGRE--LTLHCPNTGAMTGCATPGDT-VWYSTSDNTK---------RKYPHTWELTQS--
SFSA_ECOK1      DGRE--LTLHCPNTGAMTGCATPGDT-VWYSTSDNTK---------RKYPHTWELTQS--
SFSA_ECO45      DGRE--LTLHCPNTGAMTGCATPGDT-VWYSTSDNTK---------RKYPHTWELTQS--
SFSA_ECOL6      DGRE--LTLHCPNTGAMTGCATPGDT-VWYSTSDNTK---------RKYPHTWELTQS--
SFSA_ECOL5      DGRE--LTLHCPNTGAMTGCATPGDT-VWYSTSDNTK---------RKYPHTWELTQS--
SFSA_ECOLU      DGRE--LTLHCPNTGAMTGCATPGDT-VWYSTSDNTK---------RKYPHTWELTQS--
SFSA_ESCF3      DGRE--LTLHCPNTGAMTGCATPGDT-VWYSTSENTK---------RKYPHTWELTET--
SFSA_CITK8      DGTE--LTLHCPNTGAMTGCATPGDT-VWYSTSENTK---------RKYPHTWELTQT--
SFSA_SALPA      DGTT--LTLHCPNTGAMTGCATPGDT-VWYSTSENTK---------RKYPHTWELTET--
SFSA_SALPK      DGTT--LTLHCPNTGAMTGCATPGDT-VWYSTSENTK---------RKYPHTWELTET--
SFSA_SALCH      DGTT--LTLHCPNTGAMTGCATPGDT-VWYSTSENTK---------RKYPHTWELTET--
SFSA_SALA4      DGTT--LTLHCPNTGAMTGCATPGDT-VWYSTSENTK---------RKYPHTWELTET--
SFSA_SALG2      DGTA--LTLHCPNTGAMTGCATPGDT-VWYSTSENTK---------RKYPHTWELTET--
SFSA_SALDC      DGTT--LTLHCPNTGAMTGCATPGDT-VWYSTSENTK---------RKYPHTWELTET--
SFSA_SALEP      DGTT--LTLHCPNTGAMTGCATPGDT-VWYSTSENTK---------RKYPHTWELTET--
SFSA_SALHS      DGTT--LTLHCPNTGAMTGCATPGDT-VWYSTSENTK---------RKYPHTWELTET--
SFSA_SALNS      DGTT--LTLHCPNTGAMTGCATPGDT-VWYSTSENTK---------RKYPHTWELTET--
SFSA_SALPB      DGTT--LTLHCPNTGAMTGCATPGDT-VWYSTSENTK---------RKYPHTWELTET--
SFSA_SALSV      DGTT--LTLHCPNTGAMTGCATPGDT-VWYSTSENTK---------RKYPHTWELTET--
SFSA_SALTY      DGTT--LTLHCPNTGAMTGCATPGDT-VWYSTSENTK---------RKYPHTWELTET--
SFSA_SALTI      DGTT--LTLHCPNTGAMTGCATPGDT-VWYSTSENTK---------RKYPHTWELTET--
SFSA_SALAR      DGTA--LTLHCPNTGAMTGCATPGDT-VWYSTSENTK---------RKYPHTWELTET--
SFSA_KLEP3      DGRE--LTLHCPNTGAMTGCAAPGDT-VWYSTSDNAK---------RKYAHTWELTET--
SFSA_KLEP7      DGRE--LTLHCPNTGAMTGCAAPGDT-VWYSTSDNAK---------RKYAHTWELTET--
SFSA_ENT38      AGEH--LTLHCPNTGAMTGCATPGDT-VWYSTSENLK---------RKYAHTWEITET--
SFSA_CROS8      QGET--LTLHCPNTGAMTGCATPGDT-VWYSTSSVAT---------RKYPHTWELTQT--
SFSA_PECAS      EGET--LTLHCANTGAMTGCATPGDT-VWYSTSDNPK---------RKYPQSWELTET--
SFSA_PECCP      EGET--LTLHCANTGAMTGCATPGDT-VWYSTSDNPK---------RKYPHSWELTET--
SFSA_YERPE      AGEA--LTIHCANTGAMTGCATPGDT-IWYSTSDNPK---------RKYPQSWELTQT--
SFSA_YERPP      AGEA--LTIHCANTGAMTGCATPGDT-IWYSTSDNPK---------RKYPQSWELTQT--
SFSA_YERPA      AGEA--LTIHCANTGAMTGCATPGDT-IWYSTSDNPK---------RKYPQSWELTQT--
SFSA_YERPN      AGEA--LTIHCANTGAMTGCATPGDT-IWYSTSDNPK---------RKYPQSWELTQT--
SFSA_YERPS      AGEA--LTIHCANTGAMTGCATPGDT-IWYSTSDNPK---------RKYPQSWELTQT--
SFSA_YERP3      AGEA--LTIHCANTGAMTGCATPGDT-IWYSTSDNPK---------RKYPQSWELTQT--
SFSA_YERE8      AGEV--LTIHCANTGAMTGCATPGDA-VWYSTSDNPK---------RKYPHSWELTQT--
SFSA_PHOLL      EGET--LTIHCANTGAMTGCATPGDT-VWYSTSDNPK---------RKYPNSWELTET--
SFSA_SERP5      EGET--FTLHCANTGAMTGCATPGDT-VWYSTSDNPK---------RKYAHSWELTHT--
SFSA_EDWI9      DGQI--ITLHCANTGAMTGCATPGDT-VWYSSSDNPK---------RKYPSSWELTHT--
SFSA_SODGM      DGEA--LTLHCPNTGAMTGCATPGDT-VWYSASDNRK---------RRYPHSWELTET--
SFSA_ACTP2      NGEQ--ITLHCPNTGAMTGCATTGDT-VWFSTSDNPK---------RKYAHTWELTQT--
SFSA_ACTP7      NGEQ--ITLHCPNTGAMTGCATTGDT-VWFSTSDNPK---------RKYAHTWELTQT--
SFSA_ACTPJ      NGEQ--ITLHCPNTGAMTGCATAGDT-VWFSTSDNPK---------RKYAHTWELTQT--
SFSA_ACTSZ      NGEI--LTIHCANTGAMTGCAEKGDT-VWYSDSKSTT---------RKYPCSWELTQL--
SFSA_MANSM      NGNI--LTIHCANTGAMTGCAEKGDT-VWYSDSKSTT---------RKYPCSWELTEL--
SFSA_HAEI8      TGDV--MTIHCANTGAMTGCGEKGDT-IWYSHSDSQT---------RKYPHSWELTQL--
SFSA_HAEIE      TGDV--MTIHCANTGAMTGCGEKGDT-IWYSHSDSQT---------RKYPHSWELTQL--
SFSA_HAEIG      TGDV--MTIHCANTGAMTGCGEKGDT-IWYSHSDSQT---------RKYPHSWELTQL--
SFSA_HAEIN      TGDV--MTIHCANTGAMTGCGEKGDK-IWYSHSDSQT---------RKYPHSWELTQL--
SFSA_PASMU      NGEV--LTIHCANTGAMTGCGEAGDI-VWYSHSDSQT---------RKYPHSWELTEL--
SFSA_HAES1      NGEI--LTLHCANTGAMTGCGEKGDT-VWFSTSDSKT---------RKYPHSWELTQL--
SFSA_HISS2      NGEI--LTLHCANTGAMTGCGEKGDT-VWFSTSDSKT---------RKYPHSWELTQL--
SFSA_PSYIN      NGNV--LTIYCPNTGAMTGCAEPGDQ-VWYSTSNNLK---------RKYKYTWELTFT--
SFSA_AERHH      NGEV--ITIHCANTGAMTGCAEPGTR-VWYSTSSNPK---------RKLPHSWEIAES--
SFSA_AERS4      NGEV--ITIHCANTGAMTGCADPGTR-VWYSTSDNPK---------RKLPHSWEIAES--
SFSA_ALIF1      DNSE--RTIHCANTGAMTGCAEPDST-VFFSTSSNLK---------RKYPNSWELSVT--
SFSA_ALIFM      DNSE--RTIHCANTGAMTGCAEPDST-VFFSTSSNLK---------RKYPNSWELSVT--
SFSA_ALISL      DKSE--RTIHCANSGAMTGCAEPGNT-VFFSTSSNLK---------RKYPNSWELSVT--
SFSA_PHOPR      DGEI--RTIHCANTGAMTGCAEPGNT-VWFSTSENKK---------RKYPNSWELAET--
SFSA_VIBCB      SGEM--RTIHCANTGSMTGCATPGNK-VWYSTSDNPK---------RKYPNSWELSET--
SFSA_VIBPA      NGEV--RTIHCANTGAMTGCATPGNK-VWFSTSDNPK---------RKYPNSWELSET--
SFSA_VIBA3      DGSE--RTIHCANTGAMTGCATPGNT-VWYSTSDNAK---------RKYPNSWEISET--
SFSA_VIBVU      SGDT--GTIHCANTGAMTGCATPGDK-VWYSTSNNTK---------RKYPHSWEITET--
SFSA_VIBVY      SGDT--GTIHCANTGAMTGCATPGDK-VWYSTSNNTK---------RKYPHSWEITET--
SFSA_VIBCH      DGSV--ITMHCANTGAMTGCAEPGST-VWFSTSDNPK---------RKYAHSWELTQT--
SFSA_VIBC3      DGSV--ITMHCANTGAMTGCAEPGST-VWFSTSDNPK---------RKYAHSWELTQT--
SFSA_PROMH      NGEE--FTLHCANTGAMTGCATPGDT-VWYSTSSNVK---------RKYPHSWELTQT--
SFSA_COLP3      CGEE--TTIHCANTGAMKGCAEPDDT-VWYTTSTNTK---------RKYPFSWEITQS--
SFSA_PSET1      DGSE--FTAHCANTGKMTGCAEPGFN-AFYSTSTNSK---------RKYPQSLELTQN--
SFSA_IDILO      DNET--TTTHCPNTGAMTGCAEPGFT-AWCSVSDNPK---------RKYSLTWELAQN--
SFSA_SHEB8      DGSE--ITLHCPNTGSMRNCLYPGET-VWFSTSDNPK---------RKYAHTWELMTT--
SFSA_SHEB2      DGSE--ITLHCPNTGSMRNCLYPGET-VWFSTSDNPK---------RKYAHTWELMTT--
SFSA_SHEB5      DGSE--ITLHCPNTGSMRNCLYPGET-VWFSTSDNPK---------RKYAHTWELMTT--
SFSA_SHEB9      DGSE--ITLHCPNTGSMRNCLYPGET-VWFSTSDNPK---------RKYAHTWELMTT--
SFSA_SHEPC      DGSE--MTIHCPNTGSMRNCLFPGEA-VWFSTSANPK---------RKYAYTWELMGT--
SFSA_SHESW      DGSE--MTIHCPNTGSMRNCLFPGEA-VWFSTSANPK---------RKYAYTWELMGT--
SFSA_SHESM      DGTE--ITLHCPNTGSMRNCLFPGET-VWFSTSNNPK---------RKYAHTWELMAT--
SFSA_SHESR      DGTE--ITLHCPNTGSMRNCLFPGET-VWFSTSNNPK---------RKYAHTWELMTT--
SFSA_SHESA      DGTE--ITLHCPNTGSMRNCLFPGET-VWFSTSNNPK---------RKYAHTWELMTT--
SFSA_SHEON      DGSE--ITVHCPNTGSMRNCLFPGET-LWFSTSSNTK---------RKYAHTWELMTT--
SFSA_SHEDO      DGTE--ITLHCPNTGSMKNCLFPGET-VWFSTSNNPK---------RKYAHTWEQSST--
SFSA_SHEFN      NGQE--ITIHCPNTGSMKNCLFPGEK-VWFSTSDNPK---------RKYAHTWELMQT--
SFSA_SHEHH      NGEE--VTIHCPNTGSMRNCLFVGEK-VWFSVSDNPK---------RKYSRTWELAQT--
SFSA_SHEPA      NGEQ--VTIHCPNTGSMKNCLFPGEK-VWFSTSDNPK---------RKYSRTWELAQT--
SFSA_SHEPW      DGTE--VTIHCPNTGSMRNCLFPGNK-VWFSVSNNPK---------RKYSRTWEQAQT--
SFSA_SHESH      DGSE--VTIHCPNTGSMKNCLFPGEK-VWFSTSDNPK---------RKYSRTWEQAES--
SFSA_SHEWM      DGSE--VTIHCPNTGSMRNCLFEGKK-VWFSISDNPK---------RKYSRTWEQAES--
SFSA_SHELP      DGTE--ITIHCPNTGSMRNCLFPGER-VWFSTSDNPK---------RKYAHTWEQAAS--
SFSA_SHEAM      DGSQ--TTLHCPNTGSMKNCLYPGKR-VWFSTSDNPK---------RKYAHTWELAED--
SFSA_HAHCH      DGAE--LTIHCPNTGAMTGCAEPGSL-VYYSDSGNPA---------RKYRHTWELVET--
SFSA_ALTMD      DGTI--VTAHCPNTGAMSGCAEPGYT-VFLSESTNPK---------RKLKYTWELAQT--
SFSA_PSEA6      NGEE--VVAHCPNTGAMIGCAEPGMQ-VWLSPSNNPK---------RKLGYTWELGVT--
SFSA_MARN8      DGTE--VTAHCPNTGSMLGCQPENAR-VWLSRSDNPK---------RKLQYTWELVET--
SFSA_MARMS      NGDV--VVAHCPNTGSMKRCQQDGAR-VWLSKSDNPK---------RKLAYTWELVEV--
SFSA_AZOVD      DGEA--LCIHCPNTGSMFNCMAEGGR-VWFSRSNDPR---------RKLPGTWELSET--
SFSA_PSEMY      SGEP--MTIHCANTGSMLNCMSEGCR-VWFSRSNDPK---------RKLPGSWEISET--
SFSA_PSEAE      GGER--LTIHCPNTGSMLNCMSEGCR-VWFSRSNDPK---------RKLPGTWELSET--
SFSA_PSEA8      GGER--LTIHCPNTGSMLNCMSEGCR-VWFSRSNDPK---------RKLPGTWELSET--
SFSA_PSEAB      GGER--LTIHCPNTGSMLNCMSEGCR-VWFSRSNDPK---------RKLPGTWELSET--
SFSA_PSEA7      GGER--LTIHCPNTGSMLNCMSEGCR-VWFSRSDDPR---------RKLPGTWELSET--
SFSA_PSEP1      SGEQ--MTIHCPNTGSMLNCMREGGQ-VWFSRSNDPK---------RKLPGTWEISET--
SFSA_PSEPK      SGEQ--MTIHCPNTGSMLNCMREGGQ-VWFSRSNDPK---------RKLPGTWEISET--
SFSA_PSEPG      SGEQ--MTIHCPNTGSMLNCMREGGL-VWFSRSNDPK---------RKLPGTWEISET--
SFSA_PSEPW      NGEQ--LTIHCPNTGSMLNCMREGGQ-VWFSRSNDPK---------RKLPGTWEISET--
SFSA_PSEE4      NGEQ--LTIHCPNTGSMLNCMREGGQ-VWFSRSNDPK---------RKLPGTWEISET--
SFSA_PSEF5      TGEL--LTIHCPNTGSMLNCMVEGGQ-VWFSRSNDPK---------RKLPGTWEISET--
SFSA_PSEFS      TGEL--LTIHCPNTGSMLNCMVEGGQ-VWFSRSNDPK---------RKLPGTWEIAET--
SFSA_PSEPF      GGEL--LTIHCPNTGSMLNCQVEGGQ-VWFSRSNDPK---------RKLPGTWEVGET--
SFSA_PSE14      SGEL--LTIHCPNTGSMLNCMMPGGR-VWFSRSSDPK---------RKLPGTWEISET--
SFSA_PSEU2      SGEL--LTIHCPNTGSMLNCMMPGGR-VWFSRSNDPK---------RKLPGTWEISET--
SFSA_PSESM      SGEL--LTIHCPNTGSMLNCMMPGGR-VWFSRSNDPK---------RKLPGTWEISET--
SFSA_SACD2      DGST--ITVHCPNTGSMRNCIVENSP-CWLLDSANPK---------RKYRYSLERVTT--
SFSA_TERTT      SGEE--ITVHCPNTGSMKNCVVPHSP-CYLSDSNNPK---------RKYRYTLELVTT--
SFSA_ALCBS      DGSE--ITVHCPNTGSMKNCVLGGPQQALISDSGNPK---------RKYRHTLEALQV--
SFSA_ACIF2      SGEI--ITVHCPNSGSMRSCAEPGQP-ILISQSGNPK---------RKLPWTWELYW---
SFSA_ACIF5      SGEI--ITVHCPNSGSMRSCAEPGQP-ILISQSGNPK---------RKLPWTWELYW---
SFSA_RHIME      DGTA--ITGSCPNTGSMRGLTIPGSP-IWLSEHDSPT---------RKYRHMLEIVE---
SFSA_SINMW      DGTA--ITGSCPNTGSMRGLTTPGSR-IWLSEHDSTT---------RKYRHMLEIVE---
SFSA_AGRFC      DGTA--ITGSCPNTGSMRGLTTPGSR-IWLSEHDSPT---------RKYRHMFEMVE---
SFSA_AGRRK      SGEI--ITGSCPNTGSMQGLTTPGSR-IWLSEHEGAK---------RKYRHVFELIE---
SFSA_AGRVS      DGSD--ITGFCANTGSMRGLTTPGSR-IYLSQSDRPG---------RKYRYGFELIE---
SFSA_BRUAB      DGRF--ITASVPNTGSMLGLTAPGSR-VWLSFSDAPH---------RKYAHTLQIVE---
SFSA_BRUSI      DGRF--ITASVPNTGSMLGLTAPGSR-VWLSFSDAPH---------RKYAHTLQIVE---
SFSA_BRUC2      DGRF--ITASVPNTGSMLGLTAPGSR-VWLSFSDAPH---------RKYAHTLQIVE---
SFSA_BRUA2      DGRF--ITASVPNTGSMLGLTAPGSR-VWLSFSDAPH---------RKYAHTLQIVE---
SFSA_BRUA1      DGRF--ITASVPNTGSMLGLTAPGSR-VWLSFSDAPH---------RKYAHTLQIVE---
SFSA_BRUO2      DGRF--ITASVPNTGSMLGLTAPGSR-VWLSFSDAPH---------RKYAHTLQIVE---
SFSA_BRUSU      DGRF--ITASVPNTGSMLGLTAPGSR-VWLSFSDAPH---------RKYAHTLQIVE---
SFSA_BRUME      DGRF--ITASVPNTGSMLGLTAPGSR-VWLSFSDAPH---------RKYAHTLQIVE---
SFSA_BRUMB      DGRF--ITASVPNTGSMLGLTAPGSR-VWLSFSDAPH---------RKYAHTLQIVE---
SFSA_BRUA4      DGRF--ITASVPNTGSMLGLTAPGSR-VWLSVSDAPH---------RKYAHTLQIVE---
SFSA_CHESB      DGTE--LTVSVPNTGSMLGLTAPGSR-VLLSKWDDPK---------RKYPYRLEIVE---
SFSA_BARHE      DQHI--FTVSVPNTGSMLGLTTPNSN-IWLSYHNNPK---------RRYAYQLEIVE---
SFSA_BARQU      DQDI--FTVSVPNTGSMLGLITPNSN-IWLSYHNNSK---------RKYVYQLEIVE---
SFSA_BART1      DQHI--FTVSVPNTGSMLGLTASNAN-IWLSYHENTK---------RKYAYQLEIVE---
SFSA_DINSH      TGEE--VRAHCPNPGAMLGLKDAGQR-IWLEPNDDPK---------KKLRYGWRLVEL--
SFSA_JANSC      -GTE--ITAHCPNPGAMLGLKDDGAR-IWLLPNDDPK---------KKLKYGWRLVEL--
SFSA_ROSDO      DGAE--ITAHCANPGSMMGLAAPGTR-IWLEPNDDPK---------KKLKFGWRLVDH--
SFSA_RUEPO      DGRE--VTAHCANPGSMMGLADPGTK-IWLEPNDDPK---------KKLKFGWRLVDH--
SFSA_RUEST      DGRE--ITAHCANPGSMMGLAEPGMR-VWLEPNDDPK---------KKLKYGWRLVEH--
SFSA_AZOC5      DGTE--LTAHVANSGAMLGLMAPGAR-VWLAPKSGKT---------AKLPYGWELVEADL
SFSA_XANP2      DGTE--TTVHVANSGAMLGLDAPGSR-VWLSRAANLA---------RKLPLSWELVEADF
SFSA_RHOCS      DGTA--ATAHVANSGTMLGIDAPGSP-VWLSRSPNPA---------RKLPYTLELVEAD-
SFSA_MAGSA      DGTE--VTAHVANSGAMLGTAEPGME-VWLSPASNPE---------RKLKWNWELVTVD-
SFSA_RHORT      DGTA--VTAHCANSGSMASVKEPGSP-VWLSESPNPD---------RKLKYTWEIIRVG-
SFSA_CAUVC      DGQE--ITAHCPNPGAMLGVKDAGQG-AWVSWSDDPK---------RKLAYTLQMVEQGN
SFSA_CAUVN      DGQE--ITAHCPNPGAMLGVKDAGQG-AWVSWSDDPK---------RKLAYTLQMVEQGN
SFSA_CAUSK      DGRE--ITAHCPNPGAMLGLKDPGLA-AWVSWSGDPR---------RKLAWTLQLVEADG
SFSA_PHEZH      DGTP--LTAHCPNPGAMLGLNTPGLT-CWLSRSDDPK---------RKLAHTLELVEADG
SFSA_METC4      DGTM--VTAHCANPGAMLGLNTDGFR-VLLSPSTNPL---------RKLGYSWELVEAEL
SFSA_METEP      DGTM--VTAHCANPGAMLGLNAEGFR-VLLSPSTNPS---------RKLGYSWELVEAEL
SFSA_METPB      DGTL--VTAHCANPGAMLGLNAEGFR-VLLSPSTNPA---------RKLGFSWELVEAEL
SFSA_METRJ      DGR---VTVHCPNPGAMLGLNAPGAR-VLLSRSSNPA---------RKLPLTWELVEAEL
SFSA_METNO      DGRV--VTAHCANPGTMLGLIAPGRP-VLLSASTNPA---------RKLAWSWEMVQADL
SFSA_METS4      DGRL--VTAHCANPGAMLGLAAPGRP-VLLSAATSPG---------RKLAWSWEMVEADL
SFSA_MARMM      DGEV--VTAHCANTGAMTGIKTPGLP-VWLSRSDNPK---------RKLKYTWELVEAEG
SFSA_NITOC      TGES--IVAHCPNTGSMRGLAEPGLG-VYVSRANNPR---------RKLAYTLELVD---
SFSA_CHRSD      SGDV--VVAHCPNTGSMRAVDVPGCR-VWLSPSRNPA---------RKLAWTWELIELPM
SFSA_MAGMM      DGTQ--VTAHCANSGSMRGLVHVGEP-VYLSHSDNPK---------RKLAWTLELV----
SFSA_ALKEH      SGER--ITAHCPNTGSMMGCAEPGSR-VWVSRSDNPR---------RKYAYTWELVEV--
SFSA_HALHL      SGQQ--WTVHCPNTGSMLGCTEPGAR-VWLSHSTRPG---------RKYAQTWELVEL--
SFSA_THISH      DGRE--FTAHCPNTGSMMGCMEPGSR-VWLSHSPDPK---------RKYAHTWQLVE---
SFSA_CITBB      DGTV--VTAHTPNTGSMMGCACPGNR-VLLSKSASLT---------RKYPHSWELVQ---
SFSA_GEOSM      DGTV--VTAHTPNTGSMMGCACPGNR-VLLSKSASLT---------RKYPHSWELVQ---
SFSA_GEOMG      DGTI--VTAHCPNSGSMKGCNLPGSL-VWLSKSTNPA---------RKLAYTWELVM---
SFSA_GEOSL      DGTV--VTAHCPNSGSMKGCCQPGSA-VFLSLSDNPK---------RRLAYTWELVM---
SFSA_PELPD      DGSP--VTVHCPNSGSMKGCASPGSR-VLLSRSANPG---------RAYPLTWELVE---
SFSA_GEODF      NGEI--VTAHCPNSGSMKGCAVPGSP-AFISRCDKPG---------RKLCYTWEQVK---
SFSA_GEOUR      SGEI--VTAHCPNSGSMKGCATPGSP-AFLSRSDKPE---------RKLKYTWELVK---
SFSA_SYNC1      DGSL--VTAHTPNTGSMLQCAVPGHR-VLISRSDNPK---------RKLAYTLELIE---
SFSA_DESPS      DGTI--ITVYCPNTGTMRTCSTPNSP-VMLSISDNPK---------RKYAHTLEMIFE--
SFSA_BDEBA      -GQQ--VTAHVPNTGSLKSVNNPGQH-CLFSESTNPE---------RKLKYTLEMIKSPT
SFSA_PELUB      -KEI--VTAHCPNTGSMKGLLDEGNM-VYVSKNDDPK---------RKLKYTLEIIKVKK
SFSA_DESVH      --ES--VWVHSNNSGSMLGLLRPGAT-MLASPAANPD---------RKLAWTHEAMRCHG
SFSA_DESVV      --ES--VWVHSNNSGSMLGLLRPGAT-MLASPAANPD---------RKLAWTHEAMRCHG
SFSA_OLEA2      APER--VWIHSNNSGSMLGLLRAGAP-VLASPAANPA---------RKLKWTQELA----
SFSA_MARSD      --EV--VGVHTNNTGSMLGLLREGQE-IYISPAQNPN---------RKLKWTLEAV----
SFSA_LAWIP      --EE--VVAHTNNTGSMLGLLNSGTP-VLLSPALNPT---------RKLQWTLELVWTGG
SFSA_SYNFM      --HL--FQAHCNNSGSMLGLLRPGSD-ILLSVSPNPS---------RRLPYTLESIKLG-
SFSA_ALKMQ      V------VVHVANTGRMKELLTPGAE-VLLRRVNEP---------HRKTNYDLLMVYH--
SFSA_NATTJ      R------LCHVPNSGRMKELLLPETP-VLLQKKQGK---------QRKTDFDLALVLY--
SFSA_ACET2      E------FAHVPNTGRLKELLVDGAA-VMVRKYDKT---------DRKTRFGLILVRK--
SFSA_CARHZ      V------LVHIPNSGRLAEILTEGRL-VYLREGKNP---------GRKYQYDLVLAQM--
SFSA_DESRM      C------PAHVPSSGRMRELLFPGNI-VYISPMPK----------GRKTQYRIHLAKY--
SFSA_ARCFU      E------RAYINNTGRLKELIFEGNV-GKCLTKRG-----------GKLSYRLFAVSC--
SFSA_PYRFU      E------RALITNTGRLNEFMIPGRI-GYCTPKAG-----------GKTRYILLGFED--
SFSA_AQUAE      E------RALIRNTGRLSELLKFGNT-VFVREKEG-----------GKYRYEIILARA--
SFSA_THEM4      VDV------HVHDPGRLKELLFKNNK-VLVKKVNS---------TNRKTKYDLIAAKK--
SFSA_METST      ITLA-----HLHDPGRLKELLIPNTD-VLLKYINTYKE------TGRKTKYDVIAIKN--
SFSA_THEP1      T------LIHIHNTGRL-PLLKKGKR-VLLKRAES---------DRRKTGWDLLAVEH--
SFSA_THESQ      T------LIHIHNTGRL-PLLKKGKR-VLLKRAES---------DRRKTGWDLLAVEH--
SFSA_THEMA      T------LIHIHNTGRL-PLLKKGKR-VLLKRAES---------DRRKTGWDLLAVEH--
SFSA_THENN      T------QAHIHNTGRL-PLLSPGKR-VLLKRAKS---------ERRKTKWDLLAVEY--
SFSA_METTH      R------LAHLRDPGRLRELLIPGND-VILRKASS---------GNRKTEFDVIALRR--
SFSA_METBU      SSGPFQEKVHIHDPGRLEDLLYPGNR-LLLRKATN---------PKRKTGWDVIAAKA--
SFSA_THEAC      E------LAHLHDPGRLLEIVYPGNE-VLVRRTDG-----------PKLKWRIEFGKI--
SFSA_THEVO      V------EAHLHDPGRLKEIIYTGNK-VLVRRKSG-----------KKTGYRITFGLR--
SFSA_PICTO      V------YAHLHDPGRLNEIIYPGNK-IKLRKTDG-----------KKYNYSVTFGHD--
SFSA_SULAC      -------LCHLHDPGRLKELIYPGNR-ILIREHKG-----------RKTNYMVLAAHS--
SFSA_SULTO      -------ICHLHDPGRLKELIYPGNK-ILIRNVNGK----------RKTNCQVTAAWS--
SFSA_SULIA      F------LAHLHDPGRLKDLIYPGNL-VLIRETKG-----------YKTKFSITAAYS--
SFSA_SULIK      F------LAHLHDPGRLKDLIYPGNL-VLIRETKG-----------YKTKFSITAAYS--
SFSA_SULIM      F------LAHLHDPGRLKDLIYPGNL-VLIRETKG-----------YKTKFSITAAYS--
SFSA_SULIL      F------LAHLHDPGRLKDLIYPGNL-VLIRETKG-----------YKTKFSITAAYS--
SFSA_SACS2      I------LVHLHDPGRLKELIYPGNL-VLIRETKG-----------NKTKFSITAAYA--
SFSA_PYRAE      S------YVHIHDPGRLRELLFPGAK-IWARRTVR-----------GRTEYYLAAVEL--
SFSA_PYRAR      V------KIHIHDPGRLQELLFPGVK-IWARRRVG-----------GKTEYYLTAVEL--
SFSA_PYRIL      T------LVHIHDPGRLQELLFPGAM-IWARRKQR-----------GKTQYYLTAVEL--
SFSA_PYRNV      E------LVHIHDPGRLAELLYPGSV-IWARRKKT-----------GKTRYYLTAVEL--
SFSA_PYRCJ      A------LVHIHDPGRLAELLFPGST-VWLRKKAG-----------GKAPYYLLAVEL--
SFSA_CALMQ      S------LVHIHDPGRLKELLKPGIK-FYAYHKDS-----------GKTRFYLTAVDL--
SFSA_CLOB8      EE-----VCHVKNTGRCKELLIPNAT-VFIQKN-DNP--------KRKTKFSLIGVVK--
SFSA_RUMCH      TE-----ICHVKNTGRCKELLIPGTV-VYIQKS-DNP--------KRKTGFDLISVIK--
SFSA_DESHD      EE-----ICHVKNTGRCRELLIPGVT-VFLQEA-DFE--------HRKTKYDLIGVRK--
SFSA_DESHY      EE-----ICHVKNTGRCRELLIPGVT-VFLQEA-DFE--------HRKTKYDLIGVRK--
SFSA_ALKOO      EE-----TVHVKNTGRCRELLIPGVK-VLLEDGRDNP--------NRKTKYSLISVWK--
SFSA_CLOB6      IE-----MVHVPNTGRCKEILIPGST-VILREE-NNE--------NRKTRYDLIAGYK--
SFSA_CLOBJ      IE-----MVHVPNTGRCKEILIPGST-VILREE-NNE--------NRKTRYDLIAGYK--
SFSA_CLOBL      IE-----MVHVPNTGRCKEILIPGST-VILREE-NNE--------NRKTRYDLIAGYK--
SFSA_CLOBK      IE-----MVHVPNTGRCKEILIPGST-VILREE-NNE--------NRKTRYDLIAGYK--
SFSA_CLOBM      IE-----MVHVPNTGRCKEILIPGST-VILREE-NNE--------NRKTRYDLIAGYK--
SFSA_CLOB1      IE-----MVHVPNTGRCKEILIPGSM-VILREE-NNE--------NRKTRYDLIAGYK--
SFSA_CLOBH      IE-----MVHVPNTGRCKEILIPGSM-VILREE-NNE--------NRKTRYDLIAGYK--
SFSA_CLOTE      EI-----MVHVPNTGRCKEILIPGTT-VVLREE-SNP--------TRKTKYDLIGGYK--
SFSA_CLOK5      EV-----MVHVPNTGRCREILLPETT-ILLREE-NGI--------NRKTKYDLIAGYK--
SFSA_CLOK1      EV-----MVHVPNTGRCREILLPETT-ILLREE-NGI--------NRKTKYDLIAGYK--
SFSA_CLOAB      EM-----MVHVPNTGRCREILLPNCT-VVLREE-NNP--------NRKTKYDLIGAYK--
SFSA_CLOP1      EL-----LVHVPNTGRCREILKEGCT-VLLRKG-TTP--------NRKTPYDLIAAYK--
SFSA_CLOPS      EL-----LVHVPNTGRCREILKEGCT-VLLRKG-TTP--------NRKTPYDLIAAYK--
SFSA_CLOPE      EL-----LVHVPNTGRCREILKEGCT-VLLRKG-TTP--------NRKTPYDLIAAYK--
SFSA_CLONN      EV-----KVHVPNTGRCREILIPDTT-VVLREG-TNP--------NRKTKYDLIAAYK--
SFSA_CLOBA      EE-----LVHVPNTGRCKEILIPGCR-ALIREE-NGQ--------NRKTRFSLIGAYK--
SFSA_THEP3      KT-----LVHVPNTGRCKEIFVPGAE-VILEVR-DRQ--------GRKTPYELAFAYK--
SFSA_THEPX      KT-----LVHVPNTGRCKEIFVPGAE-VILEVR-DRQ--------GRKTPYELAFAYK--
SFSA_CALS4      KT-----LVHVPNTGRLKEILVKGAD-VLLEVR-EKK--------GRKTPYELAFAYK--
SFSA_LACP3      VE-----PVHMNNTGRNKEILIPGSL-ASVRYV-DNP--------NRKTHYDLLAVQR--
SFSA_LACCB      VE-----PVHMNNTGRNKEILIPGSL-ASVRYV-DNP--------NRKTHYDLLAVQR--
SFSA_ENTMU      VV-----KTHVKNTGRGKELLLPGAE-VALVHI-PGT--------KRKTAYDLIAVKK--
SFSA_METS3      EI------AHVPNTGRCKELLVDGAA-VYLKPSDNPK---------RKTRFTLHFVVN--
SFSA_ALKCK      ENVL----AHLPDPGRLRELLVEGAI-IWAE---------PAVDPLRKTAWTAVLCETPG
SFSA_ALKHC      EEVV----AHLPDPGRLKELLLPEAS-IWLR---------HVDNPSRKTQWSVVCSQAPE
SFSA_CHLSY      RMVR----AHLADRGRLTDLLTPGAR-LLLA--------SREEIG-RKTAFQVVAVYQ--
SFSA_CHLAA      RMVR----AHLADRGRLTDLLTPGAR-LLLA--------SREEIG-RKTAFQVVAVYQ--
SFSA_CHLAD      RMVR----AHVADRGRLVDLLVPGAR-LLLA--------PREEVG-RKTAFQVVAVYQ--
SFSA_MOOTA      EKLV----AFLADPGRLTELLLPGAE-VYLA--------PASRQGDRKTAYDVVLLRQ--
SFSA_SYMTH      REVP----VHVASSGRMKELLVPGAP-VIVTLQGDASAQPTRPFGGRKTAGRLLMVRT--
SFSA_AERPE      ---RGVVRCHLMDTGRIDHLASPGRRGVLIAWLNRLG---------GKTVCRAQAFKT--
                            . *                                             

SFSA_NOSS1      -----------------------NEPTWVGVNTALPNQIVKLALAKYLFPEL-----GNY
SFSA_TRIV2      -----------------------NEPTWVGVNTALPNQIVKLALAKYLFPEL-----GSY
SFSA_NOSP7      -----------------------NEPTWVGINTFLPNRVVKLALAKYLFPEL-----GEY
SFSA_CYAP4      -----------------------TEPTWVGVNTGLPNQVTKLVLAAHLIPEL-----GDY
SFSA_SYNE7      -----------------------NEPTWVGVNTGLPNRVVQALLEQRCLPVL-----GDY
SFSA_SYNP6      -----------------------NEPTWVGVNTGLPNRVVQALLEQRCLPVL-----GDY
SFSA_ACAM1      -----------------------TEPTWVGVNTQIPNLVVKQLLQNRLLPTL-----GEY
SFSA_CROS5      ------------------------DNTWVGINTALPNRVIKQILEQEKLPHLK----GKY
SFSA_RIPO1      ------------------------NNTWVGINTAIPNKVIKYALENQWFAQLK----ERY
SFSA_MICAN      ------------------------GETWVGVNTNLPNQVVKNALLQGVFPDLV----KNE
SFSA_SYNP2      -----------------------PEPTWIGVNTALPNRVIKAMLLAKQIPELA----DHY
SFSA_SYNY3      ------------------------DGTWVGVNTALPNRVIKQALADRIFPNLT----NSY
SFSA_TRIEI      -----------------------NEPTWVGINTALPNRVIKLALAENLFPEL-----GDY
SFSA_GLOVI      ------------------------DGTWVGVNTALPNRIVYRALVERVIAEV-----GTY
SFSA_THEVB      ------------------------DGTWVGVNTSLPNRVIASALAAGILPEL-----AGY
SFSA_SYNJB      ------------------------DGVWVGINTSLPNRLVDWGLERGWFPQL-----AGF
SFSA_SYNJA      ------------------------EGVWVGINTGLPNRLVEWGLARGWFPQL-----AEF
SFSA_PROMA      ----------------------GQSFSWVGVNTALPNKLVRLAIEAGCLKQEL----GEI
SFSA_PROM4      --------------------Q-AGNRIWVGVNTALPNKIVRLAIEAGCFREAL----GEI
SFSA_PROM1      --------------------HNEKKKCWVGINTSLPNKLIKHLIEANCLERQF----GQI
SFSA_PROMT      --------------------HNENKKCWVGINTSLPNKLIKHLIEANCLERQF----GQI
SFSA_PROM3      ---------------------SQGGLCWVGINTALANSLIRAAIEAGHLKQVL----GPI
SFSA_PROMM      ---------------------AQGGLCWVGINTALANSLIRAAIEAGHLKQVL----GPI
SFSA_SYNS3      ---------------------SDGTLCWAGINTALPNKLIRALIEAGGLKDQL----GPI
SFSA_SYNSC      ---------------------ADGQHCWVGINTALPNRLIRATVEAGCLEAQL----GAI
SFSA_PARMW      ---------------------ADGAPCWVGINTALPNRLIRATIEAGCLAAQL----GPI
SFSA_SYNS9      ---------------------ADGQPCWAGINTALPNRLIRATIEAGCLSEQL----GAI
SFSA_SYNPW      ---------------------ADGQLCWVGINTALPNRLIRATIEAGCLREQL----GEI
SFSA_SYNR3      ---------------------DGG---WVGVNTALPNRLLRATIEAGLLEPWL----GPI
SFSA_PROMS      ---------------------AKNEEVWVGINTLFANKLIKKVIEKNLLIEKI----GEI
SFSA_PROM0      ---------------------EKNEEVWVGINTLFANKLIKKVIEKNLLDEII----GEI
SFSA_PROM2      ---------------------SKNDEVWVGINTLFANKLIKKVIAKNLLREII----GEV
SFSA_PROM9      ---------------------AKNEEVWVGINTLFANKLIKKVIEKNLLNEII----GEI
SFSA_PROM5      ---------------------INNEKVWVGINTLFANKLIKTVIEKNLLKDKL----GDI
SFSA_PROMP      ---------------------RDNKEVWVGINTLFANKLIRKVIEQNLFKDKL----GEI
SFSA_ECO8A      -----------------------QSGAFICVNTLWANRLTKEAILNESISEL-----SGY
SFSA_ECOHS      -----------------------QSGAFICVNTLWANRLTKEAILNESISEL-----SGY
SFSA_ECOSE      -----------------------QSGAFICVNTLWANRLTKEAILNESISEL-----SGY
SFSA_ECOLI      -----------------------QSGAFICVNTLWANRLTKEAILNESISEL-----SGY
SFSA_ECODH      -----------------------QSGAFICVNTLWANRLTKEAILNESISEL-----SGY
SFSA_ECOBW      -----------------------QSGAFICVNTLWANRLTKEAILNESISEL-----SGY
SFSA_ECOLC      -----------------------QSGAFICVNTLWANRLTKEAILNESISEL-----SGY
SFSA_ECO55      -----------------------QSGAFICVNTLWANRLTKEAILNESISEL-----SGY
SFSA_ECO5E      -----------------------QSGAFICVNTLWANRLTKEAILNESISEL-----SGY
SFSA_ECO57      -----------------------QSGAFICVNTLWANRLTKEAILNESISEL-----SGY
SFSA_ECO24      -----------------------QSGAFICVNTLWANRLTKEAILNESISEL-----SGY
SFSA_SHIDS      -----------------------QSGAFICVNTLWANRLTKEAILNESISEL-----SGY
SFSA_SHIBS      -----------------------QSGAFICVNTLWANRLTKEAILNESISEL-----SGY
SFSA_SHISS      -----------------------QSGAFICVNTLWANRLTKEAILNESISEL-----SGY
SFSA_SHIB3      -----------------------QSGAFICVNTLWANRLTKEAILNESISEL-----SGY
SFSA_SHIFL      -----------------------QSGAFICVNTLWANRLTKEAILNESISEL-----SGY
SFSA_SHIF8      -----------------------QSGAFICVNTLWANRLTKEAILNESISEL-----SGY
SFSA_ECOSM      -----------------------QSGAFICVNTLWANRLTKEAILNESISEL-----SGY
SFSA_ECO7I      -----------------------QSGAFICVNTLWANRLTKEAILNESISEL-----SGY
SFSA_ECOUT      -----------------------QSGAIICVNTLWANRLTKEAILNESISEL-----AGY
SFSA_ECO27      -----------------------QSGAIICVNTLWANRLTKEAILNESISEL-----AGY
SFSA_ECO81      -----------------------QSGAIICVNTLWANRLTKEAILNESISEL-----AGY
SFSA_ECOK1      -----------------------QSGAIICVNTLWANRLTKEAILNESISEL-----AGY
SFSA_ECO45      -----------------------QSGAIICVNTLWANRLTKEAILNESISEL-----AGY
SFSA_ECOL6      -----------------------QSGAIICVNTLWANRLTKEAILNESISEL-----AGY
SFSA_ECOL5      -----------------------QSGAIICVNTLWANRLTKEAILNESISEL-----AGY
SFSA_ECOLU      -----------------------QSGAIICVNTLWANRLTKEAILNESISEL-----SGY
SFSA_ESCF3      -----------------------QAGALICVNTLWANRLTKEALENDWLSEL-----SGY
SFSA_CITK8      -----------------------RTGALICVNTLWANRLTKEAIQNEQLSEL-----SGY
SFSA_SALPA      -----------------------QFGAFICVNTLRANQLTKEAIQENRLPAL-----AGY
SFSA_SALPK      -----------------------QFGAFICVNTLRANQLTKEAIQENRLPAL-----AGY
SFSA_SALCH      -----------------------QFGAFICVNTLRANQLTKEAIQENRLPAL-----AGY
SFSA_SALA4      -----------------------QFGAFICVNTLRANQLTKEAIQENRLPAL-----EGY
SFSA_SALG2      -----------------------QFGAFICVNTLRANQLTKEAIQENRLPAL-----AGY
SFSA_SALDC      -----------------------QSGAFICVNTLRANQLTKEAIQENRLPAL-----AGY
SFSA_SALEP      -----------------------QSGAFICVNTLRANQLTKEAIQENRLPAL-----AGY
SFSA_SALHS      -----------------------QSGAFICVNTLRANQLTKEAIQENRLPAL-----AGY
SFSA_SALNS      -----------------------QSGAFICVNTLRANQLTKEAIQENRLPAL-----AGY
SFSA_SALPB      -----------------------QSGAFICVNTLRANQLTKEAIQENRLPAL-----AGY
SFSA_SALSV      -----------------------QSGAFICVNTLRANQLTKEAIQENRLPAL-----AGY
SFSA_SALTY      -----------------------QSGAFICVNTLRANQLTKEAIQENRLPAL-----AGY
SFSA_SALTI      -----------------------QSGAFICVNTLRANQLTKEAIQENRLPAL-----AGY
SFSA_SALAR      -----------------------QSGVFICVNTLWANRLTKEAIQEDRLPEL-----AGY
SFSA_KLEP3      -----------------------QQGAVICVNTLRANSLAKEAISSGIIPEL-----SGY
SFSA_KLEP7      -----------------------QQGAVICVNTLRANSLAKEAISAGIIPEL-----SGY
SFSA_ENT38      -----------------------QQGAFICVNTQRANQLVKEAIATHTIPEL-----TGY
SFSA_CROS8      -----------------------RDGALICVNTLRANTVVKEALQAQRLPAL-----AGY
SFSA_PECAS      -----------------------QQNHWICVNTLRANTLLYEALLENRIEEL-----AGY
SFSA_PECCP      -----------------------QQNHWICVNTLRANTLLYEALLENRVEEL-----SGY
SFSA_YERPE      -----------------------QTGDWICVNTMRANELVNLAIEKNQIAEL-----SGY
SFSA_YERPP      -----------------------QTGDWICVNTMRANELVNLAIEKNQIAEL-----SGY
SFSA_YERPA      -----------------------QTGDWICVNTMRANELVNLAIEKNQIAEL-----SGY
SFSA_YERPN      -----------------------QTGDWICVNTMRANELVNLAIEKNQIAEL-----SGY
SFSA_YERPS      -----------------------QTGDWICVNTMRANELVNLAIEKNQIAEL-----SGY
SFSA_YERP3      -----------------------QTGDWICVNTMRANELVNLAIEKNQIAEL-----SGY
SFSA_YERE8      -----------------------QIGDWICVNTLRANELASLAIDNNQIVEL-----SGY
SFSA_PHOLL      -----------------------PAGHWICVNTLRANDLVAEAIAQNAIPEF-----SEY
SFSA_SERP5      -----------------------QQGDWICVNTLRANTLVREAIEQNLVNEL-----SGY
SFSA_EDWI9      -----------------------QAGDWICINTLRANTLVYEAIAQQRIGEV-----SGY
SFSA_SODGM      -----------------------ASGQWIGVNTLHANTLVGEALRAGTIPEL-----AGY
SFSA_ACTP2      -----------------------QAGDFICVNTQRANQLVQEALEKRWIAEL-----AEY
SFSA_ACTP7      -----------------------QAGDFICVNTQRANQLVQEALEKRWIAEL-----AEY
SFSA_ACTPJ      -----------------------QAGDFICVNTQRANQLVQEALEKRWIAEL-----AEY
SFSA_ACTSZ      -----------------------SNGSLVCINTHRSNQLVHEALQNKVIKEL-----ADY
SFSA_MANSM      -----------------------SNGNLVCINTHRSNQLVQEALQNKVIKEL-----AGY
SFSA_HAEI8      -----------------------ANGQLCCINTHRSNQLVFEALQNKQIKEL-----AMY
SFSA_HAEIE      -----------------------ANGQLCCINTHRSNQLVFEALQNKQIKEL-----AMY
SFSA_HAEIG      -----------------------ANGQLCCINTHRSNQLVFEALQNKQIKEL-----AMY
SFSA_HAEIN      -----------------------ANGQLCCINTHRSNQLVFEALQNKQIKEL-----AMY
SFSA_PASMU      -----------------------KNGNMVCINTHRSNQLTLEALQNKQIKAL-----AMY
SFSA_HAES1      -----------------------KNGQTVCINTHRSNQLTLEALQNKIITEL-----AEY
SFSA_HISS2      -----------------------KNGQTVCINTHRSNQLTLEALQNKIITEL-----AEY
SFSA_PSYIN      -----------------------KGGHWICVNTARANQLVKEALHNSEIEAL-----SGY
SFSA_AERHH      -----------------------PAGHFICVNTARANQLARELIEQDALAPL-----RGY
SFSA_AERS4      -----------------------PAGHFICVNTARANQIARELIEQGALAPL-----TGY
SFSA_ALIF1      -----------------------ENNHTICVNTLRSNQLVVEAIQDQNIKEL-----TEY
SFSA_ALIFM      -----------------------ENNHTICVNTLRANQLVVEAIQEQNIKEL-----TEY
SFSA_ALISL      -----------------------EHNHTICVNTIRANQLVVEAIINKEIDEL-----VNY
SFSA_PHOPR      -----------------------ANGHWICVNTAQANRLVVEAINAGTITEL-----QGY
SFSA_VIBCB      -----------------------AQGHRICINTARANQLAVEAIENDVISEL-----VGY
SFSA_VIBPA      -----------------------EQGHRICINTARANQLAVEAIENNVISEL-----CGY
SFSA_VIBA3      -----------------------DKGHRICVNTARANQLAVEAIENGTIVEL-----LGY
SFSA_VIBVU      -----------------------EQGHLICVNTIRANQLAVEAIEQGWIKEL-----SGY
SFSA_VIBVY      -----------------------QQGHLICVNTIRANQLTVEAIEQGWIKEL-----SGY
SFSA_VIBCH      -----------------------QAGHWICVNTARANALVVEAILAGEIPQL-----RGY
SFSA_VIBC3      -----------------------QAGHWICVNTARANALVVEAILAGEIQQL-----RGY
SFSA_PROMH      -----------------------QSGDWICINTLRANTIIADAIEAGDIPEL-----SDY
SFSA_COLP3      -----------------------QDDHFICVNTLRANQLVEEALHLDLIKEL-----SGF
SFSA_PSET1      -----------------------SLSQLICVNTAVANKVVAEAINANLISEL-----SNY
SFSA_IDILO      -----------------------NNGEMIVVNTQHANRMAGELLQTNLVPEL-----SQW
SFSA_SHEB8      -----------------------PDAGLIGIHSGQANTLAEEAINKGIIKEL-----TGY
SFSA_SHEB2      -----------------------PDAGLIGIHSGQANTLAEEAINKGIIKEL-----TGY
SFSA_SHEB5      -----------------------PDSGLIGIHSGQANTLAEEAINKGIIKEL-----TGY
SFSA_SHEB9      -----------------------PNAGLIGIHSGQANTLAEEAINKGIITEL-----TGY
SFSA_SHEPC      -----------------------PNGGFIGIHSGSANALAEEAIHSGIIKEL-----TGY
SFSA_SHESW      -----------------------PNGGFIGIHSGSANALAEEAIHSGIIKEL-----TGY
SFSA_SHESM      -----------------------PTGGLIGIHSGNANALVEEALNKGIITEL-----TGY
SFSA_SHESR      -----------------------PTGGLIGIHSGNANALVEEALNKGIITEL-----TGY
SFSA_SHESA      -----------------------PTGGLIGIHSGNANALVEEALNKGVITEL-----VGY
SFSA_SHEON      -----------------------PTGALIGIHSGNANALVEEALNKGIITEL-----TGY
SFSA_SHEDO      -----------------------PDKQLIGINTGRANALAEEAINLGVIKEL-----TGY
SFSA_SHEFN      -----------------------DQQHYIGINTGRANALAEEAINRQVITEL-----LGY
SFSA_SHEHH      -----------------------PEGHIIGINTGRANALAEEAINNGIITEL-----QGY
SFSA_SHEPA      -----------------------PEGHIIGINTGRANALAEEAIHAGVITEL-----QGY
SFSA_SHEPW      -----------------------PDGDIIGINTGRANALAEEAINAGTIVEL-----QGY
SFSA_SHESH      -----------------------DVGHIIGINTGRANQLAEDAIKAGVITEL-----SGY
SFSA_SHEWM      -----------------------DCGDIIGINTGRANQLAEDAIKSGVITEL-----QDY
SFSA_SHELP      -----------------------DEGHIIGINTGRANALAAEAIEAGVISEL-----TGY
SFSA_SHEAM      -----------------------DRGNLIGINTARANQLAEEAIGLGQISEL-----QGY
SFSA_HAHCH      -----------------------PAGEFACVNTARPNQLVGEAVDAGVIKEL-----QGY
SFSA_ALTMD      -----------------------FDGHFIGINTHNANKLVAEALDNKVLKEF-----SDI
SFSA_PSEA6      -----------------------HQGHWIGINTNNANKIVAEALATHAIQEL-----QGY
SFSA_MARN8      -----------------------EPGVLACVNTVRPNAQARAAIEAGVVQSL-----AGY
SFSA_MARMS      -----------------------DAQYLACINTGYPNKLVGEAISNGVVKEL-----AEY
SFSA_AZOVD      -----------------------PQGRLACVNTARANPLVEEALRAGSIAEL-----TGF
SFSA_PSEMY      -----------------------PQGRLACINTARANALVEEALRAGLIAEL-----AGF
SFSA_PSEAE      -----------------------PQGRLACVNTARANRLVEEALLAGDIAEL-----AGF
SFSA_PSEA8      -----------------------PQGRLACVNTARANRLVEEALLAGDIAEL-----AGF
SFSA_PSEAB      -----------------------PQGRLACVNTARANRLVEEALLAGDIAEL-----AGF
SFSA_PSEA7      -----------------------PQGRLACVNTARANRLVEEALLAGDIPEL-----AGF
SFSA_PSEP1      -----------------------PQGRLACVNTGRANALVEEALRAGTITEL-----VGF
SFSA_PSEPK      -----------------------PQGRLACVNTGRANALVEEALRAGTITEL-----AGF
SFSA_PSEPG      -----------------------PQGRLACVNTGRANALVEEALRAGTIAEL-----AGF
SFSA_PSEPW      -----------------------PQGRLACVNTGRANALVEEALRAGVIREL-----AGF
SFSA_PSEE4      -----------------------PQGRLACVNTGRANALVEEALRAGTILEL-----AGF
SFSA_PSEF5      -----------------------PQGRLACVNTGRANGLVEEALRAGLISEL-----NGF
SFSA_PSEFS      -----------------------PQGRLACVNTARANQLVEEALLAGVITEL-----NGF
SFSA_PSEPF      -----------------------PQGRLFCVNTGRANALVEEALQAGVINEL-----NGF
SFSA_PSE14      -----------------------PQGRLACINTGRANTLVEEALRAGVISEL-----EGF
SFSA_PSEU2      -----------------------PQGRLACINTGRANTLVEEALRAGVISEL-----TGF
SFSA_PSESM      -----------------------PQGRLACINTGRANTLVEEALRAGVIREL-----EGF
SFSA_SACD2      -----------------------PTGAVAGINSASANGLVIAAIENGVISEL-----QGY
SFSA_TERTT      -----------------------PDGDLAGVNTGRANALVEEAIRAGVVPEL-----AGY
SFSA_ALCBS      -----------------------AHGHWAGVNTARPNALVEEAVRAGQFPML-----DST
SFSA_ACIF2      -----------------------SGASWVCINTQHPNAVVAEAIAAGDIPAL-----QNY
SFSA_ACIF5      -----------------------SGASWVCINTQHPNAVVAEAIAAGDIPAL-----QNY
SFSA_RHIME      -----------------------ADGTLVGINTGLPNRIAEEAIMAGQVGNL-----HTY
SFSA_SINMW      -----------------------ADGTLVGINTGLPNRIAEEAISAGQVSNL-----DSY
SFSA_AGRFC      -----------------------ADGTVVGINTGMPNRLAEEAILNGRIPEL-----AGY
SFSA_AGRRK      -----------------------ADGTTVGVNTAMPNRTAAEAIALGQISDL-----GDY
SFSA_AGRVS      -----------------------ADGTLVGVNTSLPNRLAHEAIRAGLVSDL-----LHY
SFSA_BRUAB      -----------------------ADNTLVGVNTGLPNRIAEEAILKGLIPDL-----DGY
SFSA_BRUSI      -----------------------ADNTLVGVNTGLPNRIAEEAILKGLIPDL-----DGY
SFSA_BRUC2      -----------------------ADNTLVGVNTGLPNRIAEEAILKGLIPDL-----DGY
SFSA_BRUA2      -----------------------ADNTLVGVNTGLPNRIAEEAILKGLIPDL-----DGY
SFSA_BRUA1      -----------------------ADNTLVGVNTGLPNRIAEEAILKGLIPDL-----DGY
SFSA_BRUO2      -----------------------ADNTLVGVNTGLPNRIAEEAILKGLIPDL-----DGY
SFSA_BRUSU      -----------------------ADNTLVGVNTGLPNRIAEEAILKGLIPDL-----DGY
SFSA_BRUME      -----------------------ADNTLVGVNTGLPNRIAEEAILKGLIPDL-----DGY
SFSA_BRUMB      -----------------------ADNTLVGVNTGLPNRIAEEAILKGLIPDL-----DGY
SFSA_BRUA4      -----------------------ADNTLVGVNTGLPNRIAEEAILNSLIPDL-----AGY
SFSA_CHESB      -----------------------ADGTLVGINTGLPNRLAAEAIRARLVGDL-----GTY
SFSA_BARHE      -----------------------ANNTLVGINTTLPNKLALEAIQNNLLPEL-----NGY
SFSA_BARQU      -----------------------ANNSLVGINTTLPNKLALEAIQNGLLPEL-----NGY
SFSA_BART1      -----------------------ADNTLVGINTTLPNKLVLEAIQNGLLPEL-----SGY
SFSA_DINSH      -----------------------ADGHMAGIDTSVPNKVVGEALAARAITEL-----AAY
SFSA_JANSC      -----------------------PDGHFAGIDAGLPNALVKEALAEGQIEAL-----RGY
SFSA_ROSDO      -----------------------ENGHFTGVDTSLPNRVLKEALVARHVETL-----SGY
SFSA_RUEPO      -----------------------ENGHFTGVDTSVPNRALKTALERRAIPSL-----AAY
SFSA_RUEST      -----------------------TNGHFTGVDTSVPNRALKAALEAHEIAEF-----AAY
SFSA_AZOC5      ----------------------GAGPELVGVNTMHPNVLVAEAIAAGKVPEL-----AGY
SFSA_XANP2      ----------------------GAGAELVGVNTMHPNLLVAEAIAAGAVPAL-----SGY
SFSA_RHOCS      -------------------------GTLVGCNTAHPNRIVAEAVAAGEIPAL-----AGY
SFSA_MAGSA      -------------------------GHLVGVNTAHPNGIVAEAVAAGQVAEL-----AGY
SFSA_RHORT      -------------------------DAYSGVNTGTPNAVVAEAIAEGKIPPL-----AGY
SFSA_CAUVC      --------------------------ALVGINTLLPNKLVAEALAADALPEL-----SGY
SFSA_CAUVN      --------------------------ALVGINTLLPNKLVAEALAADALPEL-----SGY
SFSA_CAUSK      --------------------------GLVGVNTMNPNRLVAEALAADAIPEL-----SGY
SFSA_PHEZH      --------------------------GLVGINTLHPNRLVAEALAAGAIPEV-----AGY
SFSA_METC4      ----------------------PGGPQWVGINTARPNALVAEAFRENKLAPL-----IGY
SFSA_METEP      ----------------------PGGLQWVGINTARPNALVAEAFRENKLTPL-----IGY
SFSA_METPB      ----------------------PGGPQWVGINTARPNALVAEAFRENKLAPL-----AGY
SFSA_METRJ      ----------------------PGGAQWVGINTQRPNALVAEAFRAGAIAAL-----AGH
SFSA_METNO      ----------------------PGGPQWVGINTLRPNLLVAEAFREGRLPPL-----SGA
SFSA_METS4      ----------------------PGGPQWVGINTMRPNHLVAEAFREGRLPAL-----AGV
SFSA_MARMM      --------------------------TLIGALPNLANSLAEEAVNAGVISEL-----TGY
SFSA_NITOC      -----------------------AHTSLVGVHTGRANILTKEAIAAGRISQL-----LGY
SFSA_CHRSD      ---------------------PDAPPALVSVHTGRANALVAQALQEARIPEL-----AGY
SFSA_MAGMM      ----------------------CDGGALVGVNTGLANALVAEALQQDRIPPL-----QGF
SFSA_ALKEH      -----------------------AAGVVVGVHTGRANALVEEALLAGRLPAL-----RGY
SFSA_HALHL      -----------------------PGEVVVGVHTGRANALVGEALDAGLLPEL-----SGY
SFSA_THISH      -----------------------AEGALVGINTGLSNRLVEEAIGSGLIAEL-----AGW
SFSA_CITBB      -----------------------ADGTWVGINTQLPNLLAREAILDGTISEL-----SGY
SFSA_GEOSM      -----------------------ADGTWVGINTQLPNLLAREAILDGTISEL-----SGY
SFSA_GEOMG      -----------------------ADGFWAGINTGLPNRLVREAIEDGTVTEL-----QGY
SFSA_GEOSL      -----------------------ADGYWAGINTGLPNRLVREGIENGTVAEL-----LGY
SFSA_PELPD      -----------------------SDGCWAGINTSLPNRLVREAIENGTVVEL-----RGY
SFSA_GEODF      -----------------------ADNCWIGINTSLPNRLVHNAIESNVIKEL-----QGY
SFSA_GEOUR      -----------------------ADGCWIGINTGLPNRLVREAIENGLVAEL-----QGY
SFSA_SYNC1      -----------------------VAGFWVDTHTHRTNRVAEEALRGGAVLEF-----TGW
SFSA_DESPS      ------------------------NHTWIGVNTGRTNSIVAKAILNGSIAEF-----SGA
SFSA_BDEBA      --------------------G-----SWVGVNTATPNTVVRETLHHVVGHKKE----VIG
SFSA_PELUB      --------------------------NLVGVNTHFANKIAFHGLVNNLVKEVA----NN-
SFSA_DESVH      DGPQ---------------------GFWVGVNTSVPNRMVEAAFHAGRLPWA-----QGY
SFSA_DESVV      DGPQ---------------------GFWVGVNTSVPNRMVEAAFHAGRLPWA-----QGY
SFSA_OLEA2      -GLD---------------------GMWVGVNTQTPNRLLEAAFHAGRLPWA-----AGY
SFSA_MARSD      -MPF---------------------GEMIGVNTSVPNKMLQLAFEAGQLPEA-----GGY
SFSA_LAWIP      TYPDENKLPSFPNKEGGVTPFHSGLGFWVGVNTLIPHKFFKLAFEAGLFPWT-----KGY
SFSA_SYNFM      -------------------------SHWVGVNTLVPNRILRLAWDRGILPEL-----IGY
SFSA_ALKMQ      ------------------------KGILVSIDS-KLPNRL---LYQGFINKEIVAFDK-F
SFSA_NATTJ      ------------------------EGHWVSVDS-RLPNKLFEILVKKSLLPETSVAYG-A
SFSA_ACET2      ------------------------NGIWVSIDSANAPNRI---MYEALVQGKFDKFRD-Y
SFSA_CARHZ      ------------------------PESLVLVDS-LLPNKI---AQGLLEKGIIKPFSREI
SFSA_DESRM      ------------------------DDIMVSVDS-LLPNRL---MYKVLSEGAISHFAM-Y
SFSA_ARCFU      ------------------------EGGYALIDT-QLQMRA----FEVAIPKISWLDGE--
SFSA_PYRFU      ------------------------HGKIAIIDT-RLQGKA----FEKIIEKELLPELEGC
SFSA_AQUAE      ------------------------EKSLVCVES-HYANKI----FEEYIRRNWKFKEL--
SFSA_THEM4      ------------------------EKEYVLVHS-MYHRYI----AEKILRKK-------Y
SFSA_METST      ------------------------KNNWILLNS-SYHNKL----VEELINTKEINSLENF
SFSA_THEP1      ------------------------RDEFVFVHS-GFHSIV----AGKILE----ELFPGS
SFSA_THESQ      ------------------------RDEFVFVHS-GFHSIV----AGKILE----ELFPGS
SFSA_THEMA      ------------------------RNEFVFVHS-GFHSIV----AGKILE----ELFPGS
SFSA_THENN      ------------------------REEFVFVHS-GYHSLV----AERILG----EMFPGA
SFSA_METTH      ------------------------DDEWVLVNS-GFHSDL----AASIIESSAVDEFRGF
SFSA_METBU      ------------------------DDGWILINS-IFHRRI----AEWAIANKVCSCFENV
SFSA_THEAC      ------------------------NGRYVLIDS-GLHSDI----ARRFLPEG--------
SFSA_THEVO      ------------------------EDQYILIDS-GLHSQI----ASHFVSQE--------
SFSA_PICTO      ------------------------GFNYTLNDA-RFHSMI----ASQFLRLG--------
SFSA_SULAC      ------------------------GTGWVVTDS-SIHNKI----ARNFLPSD--------
SFSA_SULTO      ------------------------GKEWVVTDS-SIHNEI----ARRFLPSD--------
SFSA_SULIA      ------------------------NSRFVVLDS-RLHNII----ASKFLPEA--------
SFSA_SULIK      ------------------------NSRFVVLDS-RLHNII----ASKFLPEA--------
SFSA_SULIM      ------------------------NSRFVVLDS-RLHNII----ASKFLPEA--------
SFSA_SULIL      ------------------------NSRFVVLDS-RLHNII----ASKFLPEA--------
SFSA_SACS2      ------------------------NSRFIVLDS-RLHNII----ASKFIPKI--------
SFSA_PYRAE      ------------------------DDELVLVDS-SLHNKI----AVWLIENG--YLLRGY
SFSA_PYRAR      ------------------------EEELVLVDS-SLHNKV----AAWLVESG--VIFQGY
SFSA_PYRIL      ------------------------DDELVLIDP-AAHNKV----TSWLIEAG--FLLRGY
SFSA_PYRNV      ------------------------ADELVFVDS-AKHNKI----ASWLIESG--VLLPGY
SFSA_PYRCJ      ------------------------PEELVLVDS-AMHNKI----ATWLVEEG--HVFKGY
SFSA_CALMQ      ------------------------GNELVLINS-AIHNNV----AAWLIENG--LILKGY
SFSA_CLOB8      ------------------------GDRMINMDSQVTNKVVHEWILKGN-------LLKDV
SFSA_RUMCH      ------------------------GSRHINMDSQAPNKLVQEWMEKGN-------LFSGI
SFSA_DESHD      ------------------------GNRLINMDSQVPNKVFREWLEKG--------YFQEL
SFSA_DESHY      ------------------------GNRLINMDSQVPNKVFCEWLEKG--------YFQEL
SFSA_ALKOO      ------------------------GDMLINMDSQAPNAAAFTAIKENRVK-----EIQSL
SFSA_CLOB6      ------------------------GDMLISIDSQIPNKVVYEALMNFKIE-----ILKEY
SFSA_CLOBJ      ------------------------GDMLISIDSQIPNKVVYEALMNFKIE-----ILKEY
SFSA_CLOBL      ------------------------GDMLISIDSQIPNKVVYEALMNFKIE-----ILKEY
SFSA_CLOBK      ------------------------GDMLISIDSQIPNKVVYEALMNFKIE-----ILKEY
SFSA_CLOBM      ------------------------GDMLISIDSQIPNKVVYEALMNFKIE-----ILKEY
SFSA_CLOB1      ------------------------GDMLINIDSQIPNKVVHEALMNLKID-----ILKEY
SFSA_CLOBH      ------------------------GDMLINIDSQIPNKVVHEALMNLKID-----ILKEY
SFSA_CLOTE      ------------------------NGKFINIDSQIPNKVVEEALKLGNIK-----KLKKY
SFSA_CLOK5      ------------------------ENKLINIDSQIPNKVVEEALENRKIS-----YFTKY
SFSA_CLOK1      ------------------------ENKLINIDSQIPNKVVEEALENRKIS-----YFTKY
SFSA_CLOAB      ------------------------GEKFINIDSQIPNKVVYEALYNKKVE-----SLAKY
SFSA_CLOP1      ------------------------GEVLINIDSQIPNKVVEEALINKKIE-----KLVNF
SFSA_CLOPS      ------------------------GEILINIDSQIPNKVVEEALINKKIE-----KLVNF
SFSA_CLOPE      ------------------------GEVLINIDSQIPNKVVEEALRNKKIE-----KLVNF
SFSA_CLONN      ------------------------NDKLINIDSQVPNAVVEEALKNKKIQ-----PLVKF
SFSA_CLOBA      ------------------------GKNLINIDSQIPNKVVEEALINKKIN-----GLEKY
SFSA_THEP3      ------------------------GKRLISIDSQVPNKVVLESIKMGLIE-----EFKGY
SFSA_THEPX      ------------------------GKRLISIDSQVPNKVVLESIKMGLIE-----EFKGY
SFSA_CALS4      ------------------------GKRLISIDSQVPNKVFLESIKKGIVE-----EFRGY
SFSA_LACP3      ------------------------QGRWINIDSLAPNHVAKECLEAGTLKLP--GLALPY
SFSA_LACCB      ------------------------QGRWINIDSLAPNHVAKECLEAGTLKLP--GLALPY
SFSA_ENTMU      ------------------------EQQWFNIDSQLPNRLAIDGILDGTIHLP--NLNSDI
SFSA_METS3      ------------------------KGELVSLYSQEANSIVYDAILDGKIKEL-----QGY
SFSA_ALKCK      ------------------------GD-LVSLKTTFANQLVEEALASQSLEAF-----SGW
SFSA_ALKHC      ------------------------GDVLVSLDTTLPNQLVTKALQQQEFLPL-----CQW
SFSA_CHLSY      ------------------------DGDLVSLDTQLPNRLVAAALSLGALPQF-----ARY
SFSA_CHLAA      ------------------------DGDLVSLDTQLPNRLVAAALSLGALPQF-----ARY
SFSA_CHLAD      ------------------------DSDLVSLDTQLPNRLVAAALSLRALPQF-----ARY
SFSA_MOOTA      ------------------------NGTFISLDSRLPNRLFAAALQAGSLEPF-----KGY
SFSA_SYMTH      ------------------------GSTWVSVDTSLPGKLFHQAVVAGSCAPF-----AGY
SFSA_AERPE      -----------------------AGGVVAVVDSRVPNRLFAEAAPMVVGGDA--------
                                                .                           

SFSA_NOSS1      S--------YIKSEVVYGVDKKSRVDFFLTGSDT---------------------ERPIY
SFSA_TRIV2      N--------HIKSEVVYGVDKKSRVDFFLTGSDT---------------------ERPIY
SFSA_NOSP7      S--------QIKGEVVYGLDKKSRVDFFLTGSDE---------------------ERPIY
SFSA_CYAP4      D--------QIRFEVPYGSEK-SRVDFLLTGSDR---------------------P-PTY
SFSA_SYNE7      G--------EVQREVPYGENS--RIDFRLTG------------------------DRPIY
SFSA_SYNP6      G--------EVQREVPYGENS--RIDFRLTG------------------------DRPIY
SFSA_ACAM1      D--------QVKSEVRYGREK-SRIDFLLTGT-----------------------AQPAY
SFSA_CROS5      N--------KVRSEVPYGKDKKSRIDFVLTNESQ---------------------QNPIY
SFSA_RIPO1      T--------TVRSEVPYGKDNKSRVDFLLTQNEG---------------------KSPIY
SFSA_MICAN      T--------EVRSEVAYGQNNGSRIDFLLTHGD----------------------NSLTY
SFSA_SYNP2      D--------TVRPEVRYGTENKSRIDFLLTGEG----------------------RSPLY
SFSA_SYNY3      D--------TFKPEVPYGKDKKSRIDFLLTKPE----------------------EKSIY
SFSA_TRIEI      Y--------EVKTEVVYGKDRKSRVDFKLISE-----------------------TKNIY
SFSA_GLOVI      R--------TIRREVPYGSEN-SRIDFLLTGEGE-----------------------PLY
SFSA_THEVB      G--------TQQREVAYGQER-SRIDFYLTDHPQ---------------------EPPAY
SFSA_SYNJB      S--------RRQREVTCG--K-SKIDFLLTGDAG-----------------------SAY
SFSA_SYNJA      S--------RWQREVTCG--R-SKIDFLLMGDSG-----------------------LAY
SFSA_PROMA      F--------EIKNEVTYGVARKSRIDLLLTPHFNNSD------------------SRKIF
SFSA_PROM4      A--------RIRNEVKYGRTGNSRIDLLLTPGENNCD------------------QRQIF
SFSA_PROM1      S--------SIKPEVVYGLERKSRIDLLLYPSIQNED------------------SRKIF
SFSA_PROMT      S--------SIKPEVVYGLERKSRIDLLLYPSIQNED------------------SRKIF
SFSA_PROM3      A--------AIRPEVTYGSNRRSRIDLLLTPDANCSD------------------TRPIY
SFSA_PROMM      A--------AIRAEVTYGSNRRSRIDLFLTPDANCSD------------------TRPIY
SFSA_SYNS3      K--------TIRAEVPYGLNRRSRIDLLLTPDDSADD------------------QRPIY
SFSA_SYNSC      A--------RIRAEVAYGTNKRSRIDLLLTPAEQNPD------------------QRPIY
SFSA_PARMW      A--------SIRAEVAYGANKRSRIDLLLTPTDSNPD------------------QRPIY
SFSA_SYNS9      S--------NIRAEVAYGTNRRSRIDLLLTPGESNPD------------------QRLIY
SFSA_SYNPW      E--------SIRAEVVYGKNRKSRIDLLLQPSREAID------------------QRPIY
SFSA_SYNR3      A--------GVRAEVTYGRERRSRIDLLLQPAPEADD------------------QRPIY
SFSA_PROMS      E--------TIKSEVPYGKDKKSRIDFFLTPKSSNPD------------------KRNIF
SFSA_PROM0      E--------TIKSEVPYGKDKKSRIDFFLTPKSSNPD------------------KRNIY
SFSA_PROM2      E--------TIQSEIPYGKDKKSRIDFFLTPKSSNPD------------------KRNIY
SFSA_PROM9      E--------TIKAEVPYGKDKKSRIDFFLTPKSSNPD------------------KRNIY
SFSA_PROM5      A--------TIQSEVVYGQDKKSRIDFLLTPKISNPD------------------NRKIF
SFSA_PROMP      A--------KIKSEVPYGKDKKSRIDFLLTPKSSNPD------------------NRNIY
SFSA_ECO8A      S--------SLKSEVKYGAER-SRIDFMLQADS----------------------RPDCY
SFSA_ECOHS      S--------SLKSEVKYGAER-SRIDFMLQADS----------------------RPDCY
SFSA_ECOSE      S--------SLKSEVKYGAER-SRIDFMLQADS----------------------RPDCY
SFSA_ECOLI      S--------SLKSEVKYGAER-SRIDFMLQADS----------------------RPDCY
SFSA_ECODH      S--------SLKSEVKYGAER-SRIDFMLQADS----------------------RPDCY
SFSA_ECOBW      S--------SLKSEVKYGAER-SRIDFMLQADS----------------------RPDCY
SFSA_ECOLC      S--------SLKSEVKYGAER-SRIDFMLQADS----------------------RPDCY
SFSA_ECO55      S--------SLKSEVKYGAER-SRIDFMLQADS----------------------RPDCY
SFSA_ECO5E      S--------SLKSEVKYGAER-SRIDFMLQADS----------------------RPDCY
SFSA_ECO57      S--------SLKSEVKYGAER-SRIDFMLQADS----------------------RPDCY
SFSA_ECO24      S--------SLKSEVKYGAER-SRIDFMLQADS----------------------RPDCY
SFSA_SHIDS      S--------SLKSEVKYGAER-SRIDFMLQADS----------------------RPDCY
SFSA_SHIBS      S--------SLKSEVKYGAER-SRIDFMLQADS----------------------RPDCY
SFSA_SHISS      S--------SLKSEVKYGAER-SRIDFMLQADS----------------------RPDCY
SFSA_SHIB3      S--------SLKSEVKYGAER-SRIDFMLQADS----------------------RPDCY
SFSA_SHIFL      S--------SLKSEVKYGSER-SRIDFMLQADS----------------------RPDCY
SFSA_SHIF8      S--------SLKSEVKYGSER-SRIDFMLQADS----------------------RPDCY
SFSA_ECOSM      S--------SLKSEVKYGAER-SRIDFMLQADS----------------------RPDCY
SFSA_ECO7I      S--------SLKSEVKYGAEH-SRIDFMLQADS----------------------RPDCY
SFSA_ECOUT      S--------SLKSEVKYGAER-SRIDFMLQADS----------------------RPDCY
SFSA_ECO27      S--------SLKSEVKYGAER-SRIDFMLQADS----------------------RPDCY
SFSA_ECO81      S--------SLKSEVKYGAER-SRIDFMLQADS----------------------RPDCY
SFSA_ECOK1      S--------SLKSEVKYGAER-SRIDFMLQADS----------------------RPDCY
SFSA_ECO45      S--------SLKSEVKYGAER-SRIDFMLQADS----------------------RPDCY
SFSA_ECOL6      S--------SLKSEVKYGAER-SRIDFMLQADS----------------------RPDCY
SFSA_ECOL5      S--------SLKSEVKYGAER-SRIDFMLQADS----------------------RPDCY
SFSA_ECOLU      S--------SLKSEVKYGAER-SRIDFMLQADS----------------------RPDCY
SFSA_ESCF3      S--------ELRSEVKYGAER-SRIDFMLQAGF----------------------QPDCY
SFSA_CITK8      S--------LLKSEVKYGAER-SRIDFMLQADS----------------------RPDCY
SFSA_SALPA      N--------ILKSEVKYGAER-SRIDFMLQADF----------------------RPDCY
SFSA_SALPK      N--------ILKSEVKYGAER-SRIDFMLQADF----------------------RPDCY
SFSA_SALCH      N--------ILKSEVKYGAER-SRIDFMLQADF----------------------RPDCY
SFSA_SALA4      N--------ILKSEVKYGAER-SRIDFMLQADF----------------------RPDCY
SFSA_SALG2      N--------ILKSEVKYGAER-SRIDFMLQADF----------------------RPDCY
SFSA_SALDC      N--------ILKSEVKYGAER-SRIDFMLQADF----------------------RPDCY
SFSA_SALEP      N--------ILKSEVKYGAER-SRIDFMLQADF----------------------RPDCY
SFSA_SALHS      N--------ILKSEVKYGAER-SRIDFMLQADF----------------------RPDCY
SFSA_SALNS      N--------ILKSEVKYGAER-SRIDFMLQADF----------------------RPDCY
SFSA_SALPB      N--------ILKSEVKYGAER-SRIDFMLQADF----------------------RPDCY
SFSA_SALSV      N--------ILKSEVKYGAER-SRIDFMLQADF----------------------RPDCY
SFSA_SALTY      N--------ILKSEVKYGAER-SRIDFMLQADF----------------------RPDCY
SFSA_SALTI      N--------ILNSEVKYGAER-SRIDFMLQADF----------------------RPDCY
SFSA_SALAR      N--------ILKSEVKYGAER-SRIDFMLQADF----------------------RPDCY
SFSA_KLEP3      N--------QLKSEVKYGEEN-SRIDIMLQADD----------------------RQNCY
SFSA_KLEP7      N--------QLKSEVKYGEEN-SRIDIMLQADD----------------------RQNCY
SFSA_ENT38      G--------SIKGEVKYGEEG-SRIDFMLQADD----------------------RPECY
SFSA_CROS8      E--------SLKSEVKYGAER-SRIDFMLQASD----------------------KVNCY
SFSA_PECAS      S--------DIKTEVKYGTEN-SRIDLLLQAPD----------------------RIDCY
SFSA_PECCP      S--------DVKTEVRYGTEN-SRVDLLLQAPD----------------------KIDCY
SFSA_YERPE      N--------FVRKEVKYGEEN-SRIDLLLQAED----------------------RRDCY
SFSA_YERPP      N--------FVRKEVKYGEEN-SRIDLLLQAED----------------------RRDCY
SFSA_YERPA      N--------FVRKEVKYGEEN-SRIDLLLQAED----------------------RRDCY
SFSA_YERPN      N--------FVRKEVKYGEEN-SRIDLLLQAED----------------------RRDCY
SFSA_YERPS      N--------FVRKEVKYGEEN-SRIDLLLQAED----------------------RRDCY
SFSA_YERP3      N--------FVRKEVKYGEEN-SRIDLLLQAED----------------------RRDCY
SFSA_YERE8      T--------SVKREIKYGDEN-SRIDLLLQAEN----------------------RSNCY
SFSA_PHOLL      K--------KISREVKYGEEN-SRIDLLLQAEQ----------------------QVNCY
SFSA_SERP5      S--------KISSEVKYGSES-SRIDLLLQAED----------------------RANCY
SFSA_EDWI9      T--------KIRSEVRYGAEN-SRIDLLLQAED----------------------RPDCY
SFSA_SODGM      A--------HLRGEVRYGAEN-SRIDWLLSAEG----------------------RADCY
SFSA_ACTP2      Q--------TVLPEQKYGSEN-SRIDFLLKADN----------------------QPDCF
SFSA_ACTP7      Q--------TVLPEQKYGSEN-SRIDFLLKADN----------------------QPDCF
SFSA_ACTPJ      Q--------TVLPEQKYGSEN-SRIDFLLKADN----------------------QPDCF
SFSA_ACTSZ      S--------EIYPEVKYGEEN-SRIDFLLKGEG----------------------LPDCY
SFSA_MANSM      S--------EIYPEVKYGEEN-SRIDFLLKGEG----------------------LPDCY
SFSA_HAEI8      D--------EIYPEVKYGEEN-SRIDFLLKGEG----------------------LPDCY
SFSA_HAEIE      D--------EIYPEVKYGEEN-SRIDFLLKGEG----------------------LPDCY
SFSA_HAEIG      D--------EIYPEVKYGEEN-SRIDFLLKGKG----------------------LPDCY
SFSA_HAEIN      D--------EIYPEVKYGEEN-SRIDFLLKGEG----------------------LLDCY
SFSA_PASMU      E--------QILPEVKYGEEN-SRIDFLLKGDG----------------------LPDCY
SFSA_HAES1      D--------EILPEVKYGVEN-SRIDFLLKGKN----------------------LPDCY
SFSA_HISS2      D--------EILPEVKYGVEN-SRIDFLLKGKN----------------------LPDCY
SFSA_PSYIN      S--------QIKAEVKYGTEN-SRIDFLLSNEN----------------------KADCY
SFSA_AERHH      A--------RLRTEVKYGEEN-SRIDLLLEDDH----------------------RPACY
SFSA_AERS4      A--------RLRTEVKYGEEN-SRIDLLLEDDG----------------------KPDCY
SFSA_ALIF1      D--------ELKTEVKYGSEN-SRIDILLTGKS----------------------LPDCY
SFSA_ALIFM      D--------ELKTEVKYGSEN-SRIDILLTGKS----------------------LPDCY
SFSA_ALISL      A--------ELKTEVKYGSEN-SRIDIFLSAEM----------------------LPDCY
SFSA_PHOPR      S--------SLRTEVKYGSEN-SRIDILLEDKN----------------------KPVCY
SFSA_VIBCB      D--------QLQTEVKYGNEN-SRIDILLSASD----------------------KPKCY
SFSA_VIBPA      D--------TLQTEVKYGNEN-SRIDILLSASD----------------------KPKCY
SFSA_VIBA3      N--------ALRTEVKYGSEN-SRIDILLEDNE----------------------KPPCY
SFSA_VIBVU      E--------RLQTEVKYGHEN-SRIDILLSASD----------------------RPACY
SFSA_VIBVY      E--------QLQTEVKYGHEN-SRIDILLSASD----------------------RPACY
SFSA_VIBCH      D--------ALSTEVKYGHEN-SRIDILLKSDS----------------------QPHCF
SFSA_VIBC3      D--------ALSTEVKYGHEN-SRIDILLKSDS----------------------QPHCF
SFSA_PROMH      D--------EIRREVKYGSEN-SRIDILLKSNH----------------------KVDCY
SFSA_COLP3      N--------ELKREVKYGNEN-SRVDFLATYNN----------------------APDTY
SFSA_PSET1      E--------QLQSEVKYGNEN-SRIDFLLTSDE----------------------RPNCY
SFSA_IDILO      Q--------ELKPEQRYGKEK-SRIDWWGVDQH----------------------NRECF
SFSA_SHEB8      D--------SLSREVKYGDEN-SRIDILLQGAQ----------------------KPACY
SFSA_SHEB2      D--------SLSREVKYGDEN-SRIDILLQGAQ----------------------KPACY
SFSA_SHEB5      D--------SLSREVKYGDEN-SRIDILLQGAQ----------------------KPACY
SFSA_SHEB9      D--------SLSREVKYGDEN-SRIDILLQGAQ----------------------KPACY
SFSA_SHEPC      D--------TLSREVKYGDEN-SRIDILLQGAQ----------------------KPDCY
SFSA_SHESW      D--------TLSREVKYGDEN-SRIDILLQGAQ----------------------KPDCY
SFSA_SHESM      D--------SLSREVKYGDEN-SRIDILLESAQ----------------------KPACY
SFSA_SHESR      D--------SLSREVKYGDEN-SRIDILLEAAQ----------------------KPACY
SFSA_SHESA      D--------SLSREVKYGDEN-SRIDILLEAAQ----------------------KPACY
SFSA_SHEON      D--------SLRREVKYGDEN-SRIDILLECAQ----------------------KTACY
SFSA_SHEDO      D--------RLQREVKYGEEN-SRIDILLSSDT----------------------RASCY
SFSA_SHEFN      E--------HLKREVKYGSEN-SRIDILLTSQN----------------------RPECY
SFSA_SHEHH      G--------SLRREVKYGSEN-SRIDILLEDAD----------------------KANCY
SFSA_SHEPA      H--------SLRREVKYGSEN-SRIDILLEDTK----------------------KPNCY
SFSA_SHEPW      E--------SLRREVKYGSEN-SRIDILLTSDA----------------------QANCY
SFSA_SHESH      H--------SLKREVKYGSEN-SRIDILLSDDTGSTDTSFSGTPPTNTEPANTKAKPNCY
SFSA_SHEWM      D--------LLKREVKYGSEN-SRIDILLTDND-----------------SHNEPKPHCY
SFSA_SHELP      D--------RLRREVKYGSEN-SRIDLLLESED----------------------KPACY
SFSA_SHEAM      N--------QIRREVKYGNEN-SRIDLLLSEGQ----------------------APDCY
SFSA_HAHCH      P--------LKKAEVKFGDQN-SRADWMLSGSSE---------------------LPDCY
SFSA_ALTMD      T--------RWKAEVTPPTAN-SRFDFALERENTQHQ------------------GIIEY
SFSA_PSEA6      E--------TVRPEVRFGHEN-SRIDFLLSSSDKKD----------------------CY
SFSA_MARN8      A--------QCRAEVRYGSEK-SRIDLLLSGHDH---------------------DPDAW
SFSA_MARMS      P--------EQKAEVKYG-EK-SRIDWLLTGND----------------------GRKCY
SFSA_AZOVD      T--------GLRREVRYGLEN-SRVDFCLDY-P----------------------DGTAF
SFSA_PSEMY      T--------ALKREVPYGVEN-SRADFRLDY-P----------------------SGPVF
SFSA_PSEAE      T--------ALRREVAYGVEN-SRADFRLEY-P----------------------TGALF
SFSA_PSEA8      T--------ALRREVAYGVEN-SRADFRLEY-P----------------------TGALF
SFSA_PSEAB      T--------ALRREVAYGVEN-SRADFRLEY-P----------------------TGALF
SFSA_PSEA7      A--------SLRREVAYGVEN-SRADFRLEY-P----------------------AGALF
SFSA_PSEP1      T--------ALKREVAYGEEG-SRIDFRLEF-E----------------------GAPAY
SFSA_PSEPK      T--------ALKREVAYGEEG-SRIDFRLEF-E----------------------GAPAY
SFSA_PSEPG      T--------ALKREVAYGEEG-SRIDFRLEF-D----------------------GAPVY
SFSA_PSEPW      T--------ALKREVAYGEEG-SRVDFRLEF-D----------------------HGPAY
SFSA_PSEE4      E--------LLKREVAYGEER-SRIDFYLEFAD----------------------GRPAY
SFSA_PSEF5      T--------GLKREVPYGQEN-SRIDFRLDY-P----------------------DGPAY
SFSA_PSEFS      T--------ALKREVPYGQEK-SRIDFRLDY-P----------------------DGAAY
SFSA_PSEPF      T--------GLKREVAYGQEK-SRIDFRLDY-P----------------------TGPAY
SFSA_PSE14      T--------TLKREVAYGQEK-SRVDFRLEY-P----------------------DGYLY
SFSA_PSEU2      T--------ALKREVAYGQEK-SRVDFRLEY-P----------------------DGYLY
SFSA_PSESM      T--------ALKREVAYGQEK-SRVDFRLEY-P----------------------DGYLY
SFSA_SACD2      D--------ELAREQRYGDEK-SRIDILLS-KP----------------------EEQCY
SFSA_TERTT      ---------QIQREQKYGEEG-SRIDLLLS-RG----------------------EERCF
SFSA_ALCBS      S--------GVEREVKYGD---SRFDLALGERA----------------------DPHTF
SFSA_ACIF2      A--------QLRREVPYGS-H-ERVDVLLSSEG----------------------RPPCY
SFSA_ACIF5      A--------QLRREVPYGS-H-ERVDVLLSSEG----------------------RPPCY
SFSA_RHIME      G--------TLRREQRYGR-N-SRIDILLSDAE----------------------KGLAY
SFSA_SINMW      D--------TLRREQRYGR-N-SRIDILLSDAE----------------------KGLAY
SFSA_AGRFC      S--------TIRREQKYGR-N-SRIDFLLSEPG----------------------RPDAY
SFSA_AGRRK      T--------TVRREQNYGR-N-SRIDLLLTDPL----------------------RTTTY
SFSA_AGRVS      P--------QIRTEQRYGE-N-SRIDLLLSGSG----------------------KADCY
SFSA_BRUAB      A--------TLKREQKYGR-N-SRIDLLLDDGP----------------------RPRAY
SFSA_BRUSI      A--------TLKREQKYGR-N-SRIDLLLDDGP----------------------RPRAY
SFSA_BRUC2      A--------TLKREQKYGR-N-SRIDLLLDDGP----------------------RPRAY
SFSA_BRUA2      A--------TLKREQKYGR-N-SRIDLLLDDGP----------------------RPRAY
SFSA_BRUA1      A--------TLKREQKYGR-N-SRIDLLLDDGP----------------------RPRAY
SFSA_BRUO2      A--------TLKREQKYGR-N-SRIDLLLDDGP----------------------RPRAY
SFSA_BRUSU      A--------TLKREQKYGR-N-SRIDLLLDDGP----------------------RPRAY
SFSA_BRUME      A--------TLKREQKYGR-N-SRIDLLLDDGP----------------------RPRAY
SFSA_BRUMB      A--------TLKREQKYGR-N-SRIDLLLDDGP----------------------RPRAY
SFSA_BRUA4      A--------SLKREQKYGR-N-SRIDLLLDDGP----------------------RQRAY
SFSA_CHESB      P--------VIRPEQRYGE-R-SRIDFLLEHPE----------------------RPPAY
SFSA_BARHE      K--------TILKEQRYGI-Q-SRIDFLLRDDI----------------------LPDCY
SFSA_BARQU      K--------TILKEQRYGT-Q-SRIDFLLRDDI----------------------LPDCY
SFSA_BART1      K--------TILKEQRYGT-Q-SRIDFLLRDDN----------------------LPDCY
SFSA_DINSH      G--------TIRAEVKYGT-N-SRVDFLATEPG----------------------LPDTY
SFSA_JANSC      S--------SIRPEQKYGDEN-SRIDFLLSEPG----------------------RPDAF
SFSA_ROSDO      G--------TVRPEVKYGQ-N-SRIDFLLSEDG----------------------LPDAY
SFSA_RUEPO      E--------TVRPEVKYGQ-N-SRIDFLLSGPG----------------------LADAY
SFSA_RUEST      S--------EVQAEVKYGQ-N-SRIDFLLTDAK----------------------LPRCY
SFSA_AZOC5      A--------RMRREVKYGV-N-SRIDILLEDDD----------------------RPPCF
SFSA_XANP2      A--------RLRREVKYGL-S-SRIDIQLEDEA----------------------RPLCL
SFSA_RHOCS      A--------TLRREVKYGR-N-SRIDLLLEDPV----------------------RGSAY
SFSA_MAGSA      D--------SIRREVKYGV-N-SRIDLLLEAEG----------------------RPKCW
SFSA_RHORT      A--------RLRREVKYGK-T-SRIDILLEDDAAADDAP---------------ARPRCY
SFSA_CAUVC      A--------TIKPEVKYAE-A-SRVDFLLTHPD----------------------RPPCW
SFSA_CAUVN      A--------TIKPEVKYAE-A-SRVDFLLTHPD----------------------RPPCW
SFSA_CAUSK      A--------MIRPEVKYSE-A-SRVDFLLTHPD----------------------RPPCW
SFSA_PHEZH      A--------SHRREVRYGE-N-SRVDFLLEAPD----------------------RPRCW
SFSA_METC4      E--------TLRPEVAYGK-A-SRVDFLASGGG----------------------RPPCH
SFSA_METEP      E--------TLRPEVAYGK-A-SRVDFLTSGGG----------------------LAPCH
SFSA_METPB      E--------TLRAEVAYGK-A-SRVDFLASGGG----------------------LPPCH
SFSA_METRJ      D--------ALRPEVRYAE-A-SRVDFLASGAE----------------------AGPCH
SFSA_METNO      A--------TLRPEVRYGR-A-SRVDFLAEGP-----------------------AGPCH
SFSA_METS4      T--------SLRPEVRYGR-A-SRVDFLAEHP-----------------------AGPIH
SFSA_MARMM      D--------SLRREVKYGE-N-SRIDLLLEGND----------------------RPPCW
SFSA_NITOC      G--------EIRQEVRYSK-N-SRIDLLLEDPS---------------------TQQCCY
SFSA_CHRSD      D--------THKREVRVAD---ARLDFRLST-----------------------AHAAAY
SFSA_MAGMM      A--------HFRREVPYQD---SRLDFCLTAP----------------------AGALTY
SFSA_ALKEH      R--------RVRREVRVVNRP-MRADLLLGDHSE--------------------GEPDCL
SFSA_HALHL      A--------SRRREVRVPDAP-MRADWLLEGHPG--------------------GEPPCF
SFSA_THISH      P--------GLRREVRYGDQG-SRIDLLLED-----------------------GERRCY
SFSA_CITBB      Q--------QIRGEVPYGSG--SRIDLLLSGE-----------------------QGLCY
SFSA_GEOSM      R--------QIRGEVPYGSG--SRIDLLLSGE-----------------------RGLCY
SFSA_GEOMG      G--------SIRPEVRYGEER-SRIDLLLEGE-----------------------PGRCW
SFSA_GEOSL      E--------RIRPEVRYGTN--SRVDLLLEG------------------------PGRCW
SFSA_PELPD      D--------SIRPEVAYGQR--SRIDLLLEGP-----------------------AGRCY
SFSA_GEODF      H--------SIRPEVRYGIN--SRIDLLLSRG-----------------------DELCY
SFSA_GEOUR      Q--------TIRPEVRYGEN--SRIDLLLCNA-----------------------DQLCY
SFSA_SYNC1      Q---------VTPEHTYGDS---RIDFLLQQN-----------------------DRQAL
SFSA_DESPS      T--------KVQREITVSK-G-SRLDLLVDHAD-----------------------QKSY
SFSA_BDEBA      GFAHWAAFDEVKPEYKISAET--RLDFALKKNNS---------------------DKMHF
SFSA_PELUB      --------DSIKAEVFFDKET--RFDFLVEKNK-----------------------QKIF
SFSA_DESVH      D--------TFRRERKRGD---SRLDARLDGP----------------------GLPTLW
SFSA_DESVV      D--------TFRRERKRGD---SRLDARLDGP----------------------GLPTLW
SFSA_OLEA2      T--------MFRREARCGA---SRLDARMDAPQ-------------------DSGLPPLW
SFSA_MARSD      T--------AIKREAKVGN---SRLDGLFTDD--------------------SGKLPKLW
SFSA_LAWIP      S--------ICNTETKIGM---SRLDICLHGN----------------------GVPRLW
SFSA_SYNFM      D--------RFQNEKTSGE---SRLDAFAEGP-----------------------AGQVW
SFSA_ALKMQ      N--------EVKREVTYGK---SRLDLALINEEK----------------------ELVL
SFSA_NATTJ      E--------FLRREPSYGR---GRFDMELMSTNS----------------------DRIL
SFSA_ACET2      S--------EIRREVTVLN---SRFDFGLFSEGK----------------------E-YY
SFSA_CARHZ      D--------QVAAEQTKGQ---SRFDFKVQLRDK----------------------T-GF
SFSA_DESRM      E--------EVKKEVGYGE---SRFDIYLKGEAG----------------------R-CF
SFSA_ARCFU      ----------VRRNVKVGN---SIIDYRI---------------------------GESY
SFSA_PYRFU      R--------IIKREPRVGE---SRLDYLLECS-K----------------------GEIF
SFSA_AQUAE      -----------KREVKLEN---ERFDFLI---------------------------DNTL
SFSA_THEM4      T--------HLKAEVKYKN---SRIDFLAEDK--------------------------FW
SFSA_METST      H--------IDKPEIKYKN---SRIDFLLKDDKN----------------------NPLY
SFSA_THEP1      T--------IE-SEKRFEN---SRFDFLIDR--------------------------RTF
SFSA_THESQ      T--------IE-SEKRFEN---SRFDFLIDR--------------------------RTF
SFSA_THEMA      T--------IE-SEKRFEN---SRFDFLIDR--------------------------RTF
SFSA_THENN      R--------IE-REKTSGN---SVLDFLVDG--------------------------KTF
SFSA_METTH      R--------IEKRECSFGR---SRIDFLLASE-N----------------------ERML
SFSA_METBU      L--------EVIPEQKFGD---SRLDFLLKKS-D----------------------TELW
SFSA_THEAC      ----------AVPEVRVGR---KRIDFRYGDD---------------------------Y
SFSA_THEVO      ----------CKPEVKIDD---RRLDFACNDI---------------------------F
SFSA_PICTO      ----------FKKEYKYMD---SRIDFLLDEY---------------------------L
SFSA_SULAC      ----------VKSEVKVNN---SRLDFYYDNT---------------------------F
SFSA_SULTO      ----------AKSEVTVGK---SRIDFAFDNT---------------------------Y
SFSA_SULIA      ----------YEKEIKVGN---SRIDFKYDNT---------------------------Y
SFSA_SULIK      ----------YEKEIKVGN---SRIDFKYDNT---------------------------Y
SFSA_SULIM      ----------YEKEIKVGN---SRIDFKYDNT---------------------------Y
SFSA_SULIL      ----------YEKEIKVGN---SRIDFKYDNT---------------------------Y
SFSA_SACS2      ----------YEKEVKVGN---SRIDFKYDNT---------------------------Y
SFSA_PYRAE      S--------LEKREPAFGR---GRFDLLLKSPEG----------------------RRAL
SFSA_PYRAR      R--------VAKKEPAFGK---GRFDLLLESPTG----------------------GRAL
SFSA_PYRIL      A--------IERYEPAFGK---GRFDLLLRGPNG----------------------QRAL
SFSA_PYRNV      R--------VERHEPAYGK---GRFDLLLRGPKG----------------------EKAL
SFSA_PYRCJ      S--------VAKTEPSYGR---GRFDLLLRRPDG----------------------GLAL
SFSA_CALMQ      E--------VLRREPRFSG---GRFDLMLKSPKG----------------------GYTM
SFSA_CLOB8      T--------LIKPEAKYKN---SRFDFYVETKH-----------------------KKIF
SFSA_RUMCH      T--------LVKAESRYKN---SRFDFYVETKE-----------------------DKIF
SFSA_DESHD      Q--------HIKQEQTFRN---SRFDFYLEAGQ-----------------------RKIF
SFSA_DESHY      Q--------HIKQEQTFRN---SRFDFYLEAGQ-----------------------RKIF
SFSA_ALKOO      T--------HLKREVTFGK---SRFDLYFETLNNGTL-------------------QKGF
SFSA_CLOB6      T--------NIKREKTFGK---SRFDFKLEKENG----------------------EVYY
SFSA_CLOBJ      T--------NIKREKTFGK---SRFDFKLEKENG----------------------EVYY
SFSA_CLOBL      T--------NIKREKTFGK---SRFDFKLEKENG----------------------EVYY
SFSA_CLOBK      T--------NIKREKTFGK---SRFDFKLEKENG----------------------EVYY
SFSA_CLOBM      A--------NIKREKTFGK---SRFDFKLEKENG----------------------EVYY
SFSA_CLOB1      T--------NIKREKTFGK---SRFDFKLEKENG----------------------EIYY
SFSA_CLOBH      T--------NIKREKTFGK---SRFDFKLEKENG----------------------EIYY
SFSA_CLOTE      N--------IIKREKTYGN---SRFDFKLGNDSG----------------------EEYY
SFSA_CLOK5      N--------KIEREKTFGN---SRFDFKLSGDEN----------------------LKCY
SFSA_CLOK1      N--------KIEREKTFGN---SRFDFKLSGDEN----------------------LKCY
SFSA_CLOAB      N--------IIMKEKTFKN---SRFDFRLENDEG----------------------EVYF
SFSA_CLOP1      N--------NISREKTFGN---SRFDFKLQDDNE----------------------NTYF
SFSA_CLOPS      N--------NISREKTFGN---SRFDFKLQDDNE----------------------NIYF
SFSA_CLOPE      N--------NISREKTFGN---SRFDFKLQDDNE----------------------NTYF
SFSA_CLONN      N--------NIKREQTFGN---SRFDFKLWDDSN----------------------NKYY
SFSA_CLOBA      T--------KICREKTFGN---SRFDFKLEDPLN----------------------NEYY
SFSA_THEP3      D--------IVEKEKTFGN---SKFDIKLTKGK-----------------------EICY
SFSA_THEPX      D--------IVEKEKTFGN---SKFDIKLTKGK-----------------------EICY
SFSA_CALS4      E--------LVEKEKSFGN---SKFDIKLTNGK-----------------------EICY
SFSA_LACP3      A--------VHP-ESTWRD---SRLDFAGKAADG----------------------QSWF
SFSA_LACCB      A--------VHP-ESTWRD---SRLDFAGKAADG----------------------QSWF
SFSA_ENTMU      E--------FYKREVTFGK---SKFDIYLETSCG----------------------QKAF
SFSA_METS3      S--------YHQREKQVDD---SRIDIYLANQEDDCCGMEFLV-------------DSCY
SFSA_ALKCK      Q--------LEKREATIGQ---SRFDFLLS-KNGRT----------------------LV
SFSA_ALKHC      A--------YVRQEFTYGG---SRWDVLLR-EGEKQ----------------------LL
SFSA_CHLSY      S--------RVQREVQLGP---HRIDFRLS-EGLDT----------------------CL
SFSA_CHLAA      S--------RVQREVQLGP---HRIDFRLS-EGLDT----------------------CL
SFSA_CHLAD      G--------TVQREVQLGP---HRIDFRLS-EGLDT----------------------CL
SFSA_MOOTA      R--------LRATEVRAGS---SRLDFLLQGDGHPP----------------------CY
SFSA_SYMTH      T--------EVRPEYRYGG---SRIDFLLTAPDLPP----------------------CL
SFSA_AERPE      ---------SIEAEREVFG---SRLDFLISTGR-----------------------GLWA
                             :           *                                  

SFSA_NOSS1      LEVKNTTWTKGT-----------------LALFPDTETTRGQKHLRELTAL--LPQ-MRS
SFSA_TRIV2      LEVKNTTWAKGT-----------------LALFPDTETTRGQKHLRELMTL--LPQ-TRS
SFSA_NOSP7      LEVKNTTLSEGR-----------------LALFPDTETTRGQKHLRELMAL--LPL-TRA
SFSA_CYAP4      VEVKSTTWTKGQ-----------------LALFPDTVTTRGQKHIRELMAL--LPA-HQA
SFSA_SYNE7      VEVKNTTWTAGR-----------------LALFPDTVTTRGQKHLRELTAI--LLE-ARA
SFSA_SYNP6      VEVKNTTWTAGR-----------------LALFPDTVTTRGQKHLRELTAI--LLE-ARA
SFSA_ACAM1      IEVKSTTWAIEK-----------------QALFPDTVTIRGQKHIRELISV--LPA-AQA
SFSA_CROS5      LEVKNTTLAKDK-----------------IALFPDTVTTRGQKHLQELMDL--LPD-AQP
SFSA_RIPO1      VEVKNTTLCQGE-----------------IALFPDTVTSRGQKHLRELMAL--LPD-TKP
SFSA_MICAN      IEVKNTTWNQGE-----------------TALFPDTVTTRGQKHLQELMAL--LPA-AEA
SFSA_SYNP2      VEVKNTTWTKGK-----------------LALFPDTETTRGQKHLQELIDI--VPA-AKA
SFSA_SYNY3      VEVKNTTLSQEK-----------------LALFPDTETTRGQKHLQELIDI--LPT-ARA
SFSA_TRIEI      LEVKNTTWADGR-----------------VALFPDTVTKRGQKHLRELIGV--VEQGERA
SFSA_GLOVI      LEVKSTTLNQGT-----------------LALFPDTVTTRGQKHLRELIRL--CEHGTRA
SFSA_THEVB      VEVKNTTWAQGG-----------------LALFPDTVTSRGQKHLRELQRLRQTQPETRV
SFSA_SYNJB      LEVKNTTWAVGS-----------------RALFPDTVTTRGQKHLEDLIQIR--QQGQRA
SFSA_SYNJA      LEVKNTTWAVGS-----------------RALFPDTVTTRGQKHLEDLIEIR--RQGQRA
SFSA_PROMA      VEIKNTTWAKGS-----------------TAVFPDTVTTRGQKHLQEMINE--VPS-SRA
SFSA_PROM4      LEIKNTTWTDGS-----------------LALFPDTVTERGQKHLQEMIDV--LPN-ARA
SFSA_PROM1      VEVKNTTWCDDS-----------------LALFPDTVTTRGQKHLKELMSV--YPD-SRA
SFSA_PROMT      VEVKNTTWCEDS-----------------LALFPDTVTTRGQKHLKELMSV--YPD-SRA
SFSA_PROM3      LEVKNTTWNEHS-----------------LALFPDTVTERGQKHLKELIGV--LPE-SRA
SFSA_PROMM      LEVKNTTWIEDS-----------------LALFPDTVTERGQKHLKELIGV--LPE-SRA
SFSA_SYNS3      VEVKNTTWSHGD-----------------VALFPDTVTERGQKHLEELTAL--LPD-ARG
SFSA_SYNSC      LEVKNTTWTDGS-----------------TALFPDTVTERGQKHLIELMGV--LPD-ARA
SFSA_PARMW      LEVKNTTWTDGT-----------------TALFPDTVTERGQKHLVELMGV--LPD-SRA
SFSA_SYNS9      LEVKNTTWTDGT-----------------TALFPDTVTERGQKHLIELMGV--LPE-ARA
SFSA_SYNPW      VEVKNTTWSTGS-----------------TALFPDTVTTRGQKHLQELMDV--LPE-ARA
SFSA_SYNR3      VEIKNTTWSAAD-----------------LALFPDTVTERGQKHLEELMHV--LPD-ARA
SFSA_PROMS      IEVKNTTWIKEN-----------------VALFPDTVTKRGQKHLMELKEL--IPE-SKS
SFSA_PROM0      IEVKNTTWIRGN-----------------VALFPDTVTKRGQKHLIELKEL--IPE-SKS
SFSA_PROM2      IEVKNTTWIKDN-----------------IALFPDTVTKRGQKHLIELKEL--IPE-SKS
SFSA_PROM9      IEVKNTTWMKGN-----------------VALFPDTVTKRGQKHLIELKEL--IPA-SKS
SFSA_PROM5      IEVKNTTWKKNK-----------------IALFPDTETKRGQKHLIELKGV--MPE-SKS
SFSA_PROMP      VEVKNTTWTKNN-----------------VALFPDTETKRGQKHLIELKGL--IPE-SKS
SFSA_ECO8A      IEVKSVTLAENEQ-----------------GYFPDAVTERGQKHLRELMSV-AAE-GQRA
SFSA_ECOHS      IEVKSVTLAENEQ-----------------GYFPDAVTERGQKHLRELMSV-AAE-GQRA
SFSA_ECOSE      IEVKSVTLAENEQ-----------------GYFPDAVTERGQKHLRELMSV-AAE-GQRA
SFSA_ECOLI      IEVKSVTLAENEQ-----------------GYFPDAVTERGQKHLRELMSV-AAE-GQRA
SFSA_ECODH      IEVKSVTLAENEQ-----------------GYFPDAVTERGQKHLRELMSV-AAE-GQRA
SFSA_ECOBW      IEVKSVTLAENEQ-----------------GYFPDAVTERGQKHLRELMSV-AAE-GQRA
SFSA_ECOLC      IEVKSVTLAENEQ-----------------GYFPDAVTERGQKHLRELMSV-AAE-GQRA
SFSA_ECO55      IEVKSVTLAENEQ-----------------GYFPDAVTERGQKHLRELMSV-AAE-GQRA
SFSA_ECO5E      IEVKSVTLAENEQ-----------------GYFPDAVTERGQKHLRELMSV-AAE-GQRA
SFSA_ECO57      IEVKSVTLAENEQ-----------------GYFPDAVTERGQKHLRELMSV-AAE-GQRA
SFSA_ECO24      IEVKSVTLAENEQ-----------------GYFPDAVTERGQKHLRELMSV-AAE-GQRA
SFSA_SHIDS      IEVKSVTLAENEQ-----------------GYFPDAVTERGQKHLRELMSV-AAE-GQRA
SFSA_SHIBS      IEVKSVTLAENEQ-----------------GYFPDAVTERGQKHLRELMNV-AAE-GQRA
SFSA_SHISS      IEVKSVTLAENEQ-----------------GYFPDAVTERGQKHLRELMNV-AAE-GQRA
SFSA_SHIB3      IEVKSVTLAENEQ-----------------GYFPDAVTERGQKHLRELMNV-AAE-GLRA
SFSA_SHIFL      IEVKSVTLAENEQ-----------------GYFPDAVTERGQKHLRELMSV-AAE-GQRA
SFSA_SHIF8      IEVKSVTLAENEQ-----------------GYFPDAVTERGQKHLRELMNV-AAE-GQRA
SFSA_ECOSM      IEVKSVTLAENEQ-----------------GYFPDAVTERGQKHLRELMSV-AAE-GQRA
SFSA_ECO7I      IEVKSVTLAENEQ-----------------GYFPDAVTERGQKHLRELMSV-AAE-GQRA
SFSA_ECOUT      IEVKSVTLAENEQ-----------------GYFPDAVTERGQKHLRELMSV-AAE-GQRA
SFSA_ECO27      IEVKSVTLAENEQ-----------------GYFPDAVTERGQKHLRELMSV-AAE-GQRA
SFSA_ECO81      IEVKSVTLAENEQ-----------------GYFPDAVTERGQKHLRELMSV-AAE-GQRA
SFSA_ECOK1      IEVKSVTLAENEQ-----------------GYFPDAVTERGQKHLRELMSV-AAE-GQRA
SFSA_ECO45      IEVKSVTLAENEQ-----------------GYFPDAVTERGQKHLRELMSV-AAE-GQRA
SFSA_ECOL6      IEVKSVTLAENEQ-----------------GYFPDAVTERGQKHLRELMSV-AAE-GQRA
SFSA_ECOL5      IEVKSVTLAENEQ-----------------GYFPDAVTERGQKHLRELMSV-AAE-GQRA
SFSA_ECOLU      IEVKSVTLAENEQ-----------------GYFPDAVTERGQKHLRELMSV-AAE-GQRA
SFSA_ESCF3      IEVKSVTLADHGQ-----------------GYFPDAITQRGQKHLRELMSV-AAE-GQRA
SFSA_CITK8      IEVKSVTLAEQEY-----------------GYFPDAVTLRGQKHLRELMSV-AAE-GHRA
SFSA_SALPA      IEVKSVTLAEKEN-----------------GYFPDAITERGQKHLRELMGV-AAA-GHRA
SFSA_SALPK      IEVKSVTLAEKEN-----------------GYFPDAITERGQKHLRELMGV-AAA-GHRA
SFSA_SALCH      IEVKSVTLAEKEN-----------------GYFPDAITERGQKHLRELMGV-AAA-GHRA
SFSA_SALA4      IEVKSVTLAEKEN-----------------GYFPDAITERGQKHLRELMGV-AAA-GHRA
SFSA_SALG2      IEVKSVTLAEKEN-----------------GYFPDAITERGQKHLRELMGV-AAA-GHRA
SFSA_SALDC      IEVKSVTLAEKEN-----------------GYFPDAITERGQKHLRELMGV-AAA-GHRA
SFSA_SALEP      IEVKSVTLAEKEN-----------------GYFPDAITERGQKHLRELMGV-AAA-GHRA
SFSA_SALHS      IEVKSVTLAEKEN-----------------GYFPDAITERGQKHLRELMGV-AAA-GHRA
SFSA_SALNS      IEVKSVTLAEKEN-----------------GYFPDAITERGQKHLRELMGV-AAA-GHRA
SFSA_SALPB      IEVKSVTLAEKEN-----------------GYFPDAITERGQKHLRELMGV-AAA-GHRA
SFSA_SALSV      IEVKSVTLAEKEN-----------------GYFPDAITERGQKHLRELMGV-AAA-GHRA
SFSA_SALTY      IEVKSVTLAEKEN-----------------GYFPDAITERGQKHLRELMGV-AAA-GHRA
SFSA_SALTI      IEVKSVTLAEKEN-----------------GYFPDAITERGQKHLRELMGV-AAA-GHRA
SFSA_SALAR      IEVKSVTLAEKEN-----------------GYFPDAITERGQKHLRELMGV-AAA-GHRA
SFSA_KLEP3      IEVKSVTLAEKEY-----------------GYFPDAVTTRGQKHLRELMAV-AAN-GDRA
SFSA_KLEP7      IEVKSVTLAEKEY-----------------GYFPDAVTTRGQKHLRELMAV-AAN-GDRA
SFSA_ENT38      IEVKSVTLADRDN-----------------GYFPDAVTLRGQKHLRELMSV-AAT-GKRA
SFSA_CROS8      IEVKSVTLSEQDS-----------------GYFPDAVTARGQKHLRELMSV-VEQ-GDRA
SFSA_PECAS      IEVKSVTLLQHEC-----------------GYFPDAVTLRGQKHLRELQQM-VSN-GKRA
SFSA_PECCP      IEVKSVTLLQHEC-----------------GYFPDAVTLRGQKHLRELQQM-VSN-GKRA
SFSA_YERPE      IEVKSVTLLQQQC-----------------GYFPDAVTLRGQKHLRELQNR-VVN-GHRA
SFSA_YERPP      IEVKSVTLLQQQC-----------------GYFPDAVTLRGQKHLRELQNR-VVN-GHRA
SFSA_YERPA      IEVKSVTLLQQQC-----------------GYFPDAVTLRGQKHLRELQNR-VVN-GHRA
SFSA_YERPN      IEVKSVTLLQQQC-----------------GYFPDAVTLRGQKHLRELQNR-VVN-GHRA
SFSA_YERPS      IEVKSVTLLQQQC-----------------GYFPDAVTLRGQKHLRELQNR-VVN-GHRA
SFSA_YERP3      IEVKSVTLLQQQC-----------------GYFPDAVTLRGQKHLRELQNR-VVN-GHRA
SFSA_YERE8      IEVKSVTLLQQQC-----------------GYFPDAVTLRGQKHLRELQSM-VAN-GHRA
SFSA_PHOLL      IEVKSVTLLQENC-----------------GYFPDAVTTRGQKHLRELQHI-AEQ-GQRA
SFSA_SERP5      IEVKSVTLLQQQR-----------------GYFPDAVTLRGQKHLRELLSV-VES-GQRA
SFSA_EDWI9      IEVKSVTLLQSAC-----------------GYFPDAVTERGQKHLRELQHQ-VQS-GVRA
SFSA_SODGM      IEVKSVTLLQHQS-----------------GYFPDAVTLRGQKHLRELQAM-AEM-GYRA
SFSA_ACTP2      AEVKSTTLLTENDL----------------GMFPDAKTERGQKHLRELAAI-AES-GQQA
SFSA_ACTP7      AEVKSTTLLTENDL----------------GMFPDAKTERGQKHLRELAAI-AES-GQQA
SFSA_ACTPJ      VEVKSTTLLTENGL----------------GMFPDAKTERGQKHLRELAAI-AES-GQQA
SFSA_ACTSZ      VEVKSITLVKNSI-----------------GMFPDAVTTRGQKHVRELLAM-KKQ-GHRA
SFSA_MANSM      VEVKSITLVKNNI-----------------GMFPDAVTTRGQKHVRELLAM-KKQ-GYRA
SFSA_HAEI8      VEVKSITLVKGNL-----------------GMFPDAVTTRGQKHVRELLAM-KKQ-GHRA
SFSA_HAEIE      VEVKSITLVKGNL-----------------GMFPDAVTTRGQKHVRELLAM-KKQ-GHRA
SFSA_HAEIG      VEVKSITLVKGNL-----------------GMFPDAVTTRGQKHVRELLAM-KKQ-GHRA
SFSA_HAEIN      VEVKSITLVKGNL-----------------GMSPDAVTTRGQKHVRELLAM-KKQ-GHRA
SFSA_PASMU      VEVKSVTLVKNTI-----------------GMFPDAVTTRGQKHLRELIAM-KKR-GHRA
SFSA_HAES1      VEVKSVTFVKNHL-----------------GLFPDAVTTRGQKHLRELIAM-KKR-GHRA
SFSA_HISS2      VEVKSVTFVKNHL-----------------GLFPDAVTTRGQKHLRELIAM-KKR-GHRA
SFSA_PSYIN      VEVKSCTLLEQPLAE-------------GKGFFPDTVTTRGQKHLRELIEM-KQQ-GHRS
SFSA_AERHH      IEVKSVTLLDERE-------------QAGMGYFPDAVTTRGAKHLRELMAM-KAA-GHRA
SFSA_AERS4      IEVKSVTLLDERE-------------QPGMGYFPDAVTARGAKHLRELMVM-KAA-GHRA
SFSA_ALIF1      IEVKSVTLLSES----------------GQGFFPDAVTTRGQKHLRELSEM-AQL-GHKA
SFSA_ALIFM      IEVKSVTLLSES----------------GQGFFPDAVTTRGQKHLRELSEM-AQL-GHKA
SFSA_ALISL      IEVKSVTLLDES----------------GQGYFPDSVTTRGQKHLRELTEI-AQN-GQKA
SFSA_PHOPR      IEVKSVTLLD-N----------------GQGFFPDAVTTRGQKHLRELIEV-AQN-GQRS
SFSA_VIBCB      IEVKSVTLLDEE-------------SPSGQGYFPDAVTTRGQKHLRELTEM-AQT-GSRA
SFSA_VIBPA      IEVKSVTLLDET-------------GSAGQGYFPDAVTTRGQKHLRELTEM-AQN-GSRA
SFSA_VIBA3      IEVKSVTLLDEQVSTKQQISTKQQASTEGQGFFPDAVTTRGQKHLRELTEM-VES-GSRA
SFSA_VIBVU      IEVKSVTLLDDT--------------EPGQGFFPDAVTTRGQKHLRELTEM-AQN-GSRA
SFSA_VIBVY      IEVKSVTLLDDT--------------EPGQGFFPDAVTTRGQKHLRELTEM-AQN-GSRA
SFSA_VIBCH      IEVKSVTLLDEIQ------------GDKGQGYFPDAVTTRGQKHLRELAEV-AKD-GSRS
SFSA_VIBC3      IEVKSVTLLDEIQ------------GDKGQGYFPDAVTTRGQKHLRELAEV-AKD-GSRS
SFSA_PROMH      IEVKSVTLLD-----------------AGMGYFPDAKTERGQKHLRELTAI-AKS-GLRA
SFSA_COLP3      IEVKSVTLL-----------------ESGHGYFPDAVTTRGQKHLRELMDM-VAQ-GHKA
SFSA_PSET1      VEVKSVTLLSQDNP------------HSGQGYFPDAPTLRGQKHIRELIEM-VEQ-GHRA
SFSA_IDILO      IEVKSVTLADASQ-----------------GYFPDAVSQRAHKHLNELMQV-VAD-GHRA
SFSA_SHEB8      IEVKSCTLLED-----------------GQGYFPDAVSLRGQKHLRELMHM-VSQ-GHRA
SFSA_SHEB2      IEVKSCTLLED-----------------GQGYFPDAVSLRGQKHLRELMHM-VSQ-GHRA
SFSA_SHEB5      IEVKSCTLLED-----------------GQGYFPDAVSLRGQKHLRELMHM-VSQ-GHRA
SFSA_SHEB9      IEVKSCTLLED-----------------GQGYFPDAVSLRGQKHLRELMHM-VSQ-GHRA
SFSA_SHEPC      IEVKSCTLLED-----------------GQGFFPDAVSLRGQKHLRELMHM-ANL-GHRA
SFSA_SHESW      IEVKSCTLLED-----------------GQGFFPDAVSLRGQKHLRELMHM-ANL-GHRA
SFSA_SHESM      IEVKSCTLLED-----------------GQGYFPDAVSLRGQKHLRELMHM-ASL-GHRA
SFSA_SHESR      IEVKSCTLLED-----------------GQGYFPDAVSLRGQKHLRELMHM-ASL-GHRA
SFSA_SHESA      IEVKSCTLLED-----------------GQGYFPDAVSLRGQKHLRELMHM-ASL-GHRA
SFSA_SHEON      IEVKSCTLQEN-----------------GQGYFPDAVSLRGQKHLRELMHM-ASL-GHRA
SFSA_SHEDO      IEVKSCTLLEEGSTS-------------GRGYFPDSVTVRGQKHLRELIHM-VKQ-GHRA
SFSA_SHEFN      IEVKSCTLLED-----------------QMGYFPDAVTTRGQKHLRELIHM-VEL-GHRA
SFSA_SHEHH      IEVKSCTLLEQ-----------------GLGYFPDAVTTRGQKHLRELMEM-VEQ-GQRA
SFSA_SHEPA      IEVKSCTLLEE-----------------GQGYFPDAVTARGQKHLRELMEM-VEQ-GQRA
SFSA_SHEPW      VEVKSCTLLEN-----------------GQGYFPDAVTTRGQKHLRELMEM-VEQ-GHRA
SFSA_SHESH      VEVKSCTLLEE-----------------GQGYFPDAVTTRGQKHLRELMEM-VES-GHRG
SFSA_SHEWM      IEVKSCTLLED-----------------GQGYFPDAVTTRGQKHLRELMEM-VSM-GHRA
SFSA_SHELP      IEVKSCTLLEQ-----------------GQGYFPDAVTTRGQKHLRELMEM-VKQ-GHRA
SFSA_SHEAM      IEVKSCTLLDH-----------------DWGLFPDAVSTRGQKHLRELMEM-KRQ-GYRA
SFSA_HAHCH      VEVKNVTLCLHGR-----------------GYFPDAVSTRGQKHLEELMSV-VRN-GKRA
SFSA_ALTMD      MEVKSVTLAENSK-----------------GFFPDAVTQRGAKHCLELARL-AES-GIKT
SFSA_PSEA6      VEVKSVTLLEEGQ-----------------GYFPDAKTVRGQKHLRELAAM-VEQ-GYRA
SFSA_MARN8      VEVKNVTLAE-GGE----------------GYFPDAVTERGQKHLRELMAQ-VQN-GDRA
SFSA_MARMS      VEVKSVTLLEEDGL----------------GYFPDAVTDRGRKHLYELAKM-VEE-GHRA
SFSA_AZOVD      VEVKSVTLGFADS---------------PVAAFPDARTERGAKHLRELAVL-ARQ-GVRT
SFSA_PSEMY      VEVKSVTLGFDDS---------------DVAAFPDAVTLRGARHLRELAAL-SRL-GVRT
SFSA_PSEAE      IEVKSVTLGFDET---------------AVAAFPDAVTLRGAKHLRELAAL-ARE-GIRA
SFSA_PSEA8      IEVKSVTLGFDET---------------AVAAFPDAVTLRGAKHLRELAAL-ARE-GIRA
SFSA_PSEAB      IEVKSVTLGFDET---------------AVAAFPDAVTLRGAKHLRELAAL-ARE-GIRA
SFSA_PSEA7      IEVKSVTLGFDET---------------AVAAFPDAVTLRGAKHLRELAAL-ARD-GVRA
SFSA_PSEP1      VEVKSVTLGYPDT---------------AVAAFPDAVTQRGAKHLRELAKL-ARQ-GVRA
SFSA_PSEPK      VEVKSVTLGYPDT---------------AVAAFPDAVTQRGAKHLRELAKL-ARQ-GVRA
SFSA_PSEPG      VEVKSVTLGYPDT---------------AVAAFPDAVTQRGAKHLRELAKL-ARQ-GVRA
SFSA_PSEPW      VEVKSVTLGYPDT---------------AVAAFPDAVTQRGAKHLRELATL-ARQ-GIRA
SFSA_PSEE4      VEVKSVTLGFPDT---------------PVAAFPDAVTQRGAKHLRELAAL-ARQ-GIRA
SFSA_PSEF5      VEVKSVTLGFDGT---------------PVAAFPDAVTQRGAKHLRELASL-ARE-GVRA
SFSA_PSEFS      VEVKSVTLGFDGS---------------AVAAFPDAVTQRGAKHLRELAHL-ARQ-GVRA
SFSA_PSEPF      VEVKSVTLGFDGT---------------AVAAFPDAVTERGAKHLRELAHL-ARD-GIRA
SFSA_PSE14      LEVKSVTLGFDDS---------------SVAAFPDAVTQRGARHLRELATL-ARE-GVRA
SFSA_PSEU2      LEVKSVTLGFDGS---------------SVAAFPDAVTQRGARHLRELATL-ARE-GVRA
SFSA_PSESM      LEVKSVTLGFADS---------------AVAAFPDAVTQRGARHLRELATL-ARE-GVRA
SFSA_SACD2      IEVKSVTLEEG----------------KGEGFFPDAVSTRGQKHLRELMAM-RSQ-GHRA
SFSA_TERTT      VEVKNVTLAEP----------------GGQGLFPDAVSVRGAKHLRELMYV-RAQ-GHRA
SFSA_ALCBS      IEVKNVTLGPGPDDK-----------DDGVIAFPDSVTERGQKHLQTLMDV-VAS-GKRA
SFSA_ACIF2      VEVKSCTLLEE----------------DGVIRFPDAVSSRALRHLGALTEV-VRG-GGRA
SFSA_ACIF5      VEVKSCTLLEE----------------DGVIRFPDAVSSRALRHLGALTEV-VRG-GGRA
SFSA_RHIME      VEVKNVHFSRV----------------RGLAEFPDSPTQRGAKHLEELGDM-VEA-GHRA
SFSA_SINMW      VEVKNVHFSRL----------------SGLAEFPDSPTERGAKHLEELGDM-VAA-GHRA
SFSA_AGRFC      VEVKNVHFMRE----------------KGLAEFPDTATKRGAKHLEELGDA-AEA-GYRS
SFSA_AGRRK      VEVKNVHFMRE----------------PGLAEFPDTVTARGAKHLEELGDM-ADA-GHRA
SFSA_AGRVS      VEVKNVHFIRE----------------TGLAEFPDSVTTRGAKHLTEMAKL-VAA-GKRA
SFSA_BRUAB      VEVKNVHFIRT----------------PGLAEFPDTVTARGAKHLDELVDV-VAA-GHRG
SFSA_BRUSI      VEVKNVHFIRT----------------PGLAEFPDTVTARGAKHLDELVDV-VAA-GHRG
SFSA_BRUC2      VEVKNVHFIRT----------------PGLAEFPDTVTARGAKHLDELVDV-VAA-GHRG
SFSA_BRUA2      VEVKNVHFIRT----------------PGLAEFPDTVTARGAKHLDELVDV-VAA-GHRG
SFSA_BRUA1      VEVKNVHFIRT----------------PGLAEFPDTVTARGAKHLDELVDV-VAA-GHRG
SFSA_BRUO2      VEVKNVHFIRT----------------PGLAEFPDTVTARGAKHLDELVDV-VAA-GHRG
SFSA_BRUSU      VEVKNVHFIRT----------------PGLAEFPDTVTARGAKHLDELVDV-VAA-GHRG
SFSA_BRUME      VEVKNVHFIRT----------------PGLAEFPDTVTARGAKHLDELVDV-VAA-GHRG
SFSA_BRUMB      VEVKNVHFIRT----------------PGLAEFPDTVTARGAKHLDELVDV-VAA-GHRG
SFSA_BRUA4      VEVKNVHFIRT----------------LGLAEFPDTVTARGAKHLDELVDV-VAA-GHRG
SFSA_CHESB      VEVKNVHFMRE----------------AGLAEFPDTRTDRGARHLDELAAM-RRA-GNRA
SFSA_BARHE      LEIKNVHFIRQ----------------KGLAEFPDTETKRGTRHLEELIKI-VQQ-GKRA
SFSA_BARQU      LEVKNVHFIRQ----------------KELAEFPDTETKRGTRHLEELIKI-VQQ-GKRA
SFSA_BART1      LEVKNVHFIRQ----------------KGLAEFPDTETKRGARHLEELMHV-VQQ-GKRA
SFSA_DINSH      VEVKNVHLRRA----------------EDWAEFPDSVTTRGAKHLAELARM-VEA-GHRA
SFSA_JANSC      VEVKNCHLRRE----------------SDWAEFPDCVTDRGAKHLRELTKI-ARS-GGRA
SFSA_ROSDO      VEVKSVTLSRQ----------------TGQAEFPDSVTARGAKHLQELADM-AQA-GHRA
SFSA_RUEPO      VEVKSVTLCRE----------------PGLAEFPDSVTARGAKHLAELAAM-AGL-GHRA
SFSA_RUEST      VEVKSVTLSRQ----------------PGLAEFPDSVTARGTKHLRELAAM-AEA-GHRA
SFSA_AZOC5      VEVKNVHLMRA----------------PGHAEFPDCATARGAKHLAELAAE-VKA-GHRA
SFSA_XANP2      VEVKNVHLMRT----------------PGYAEFPDCVTARGAKHLEELGAE-ADK-GNRA
SFSA_RHOCS      VEVKNVHLRRQ----------------GRLAEFPDCVTSRGAKHLEELAAM-VAA-GHRA
SFSA_MAGSA      VEVKNVHLKR-----------------GDWAEFPDAVTVRGTKHLAELTDR-VRA-GERA
SFSA_RHORT      VEVKNVTLKRDPAW-------------DGPIDFPDAVTTRGAKHLLELADM-VDQ-GHRA
SFSA_CAUVC      LEVKNCHFSRT----------------PGLAEFPDCKAQRSTRHLEDLSAQ-VRE-GHRA
SFSA_CAUVN      LEVKNCHFSRT----------------PGLAEFPDCKAQRSTRHLEDLSAQ-VRE-GHRA
SFSA_CAUSK      LEVKNCHYRRD----------------GTLAEFPDCVAARSAKHLKDLAAE-VAK-GARA
SFSA_PHEZH      LEVKNVHLMRQ----------------PGLAEFPDCVAARSTRHLRELAAM-AAQ-GDRA
SFSA_METC4      VEVKNCHLMRH----------------AGLAEFPDCKAARSARHMEELAGV-VTA-GGRA
SFSA_METEP      VEVKNCHLMRQ----------------AGLAEFPDCKAARSARHMEELAGV-VTA-GGRA
SFSA_METPB      VEVKNCHLMRQ----------------AGLAEFPDCKAARSARHMEELAGV-VAA-GGRA
SFSA_METRJ      VEVKNCHLMRR----------------AGLAEFPDCKAARSARHMRDLAQV-VAD-GGRA
SFSA_METNO      VEVKNCHMMRE----------------AGLAEFPDCVAARSARHMDELADV-VRG-GGRA
SFSA_METS4      VEVKNCHMMRD----------------AGLAEFPDCIAARSARHMEELAAV-VRG-GGRA
SFSA_MARMM      VEVKNVHWQRG----------------PGIAEFPDGVTSRGAKHLVELANQ-VQA-GERA
SFSA_NITOC      VEVKSVTLRQG----------------DGAACFPDAVTTRGAKHLDDLAAT-VCSPRQRA
SFSA_CHRSD      VEVKQVTLREHDG----------------HGYFPDSVSERGRRHLEALAAR-VAE-GDRA
SFSA_MAGMM      VEVKSVTLRLTD-----------------EAAFPDAVTKRGAKHLAALRHA-VKA-GHRG
SFSA_ALKEH      LEVKNVTAAVA----------------DGVALFPDAVSARGTRHLDVLAAE-ARA-GRRT
SFSA_HALHL      VEVKNVTAAVE----------------HGRALFPDAVTERGRRHLEVLTEW-VRG-GGRA
SFSA_THISH      VEVKNVTAAVS----------------EGVAIFPDAVSARGSKHLEELMLM-VRE-GHQA
SFSA_CITBB      VETKNVTLVED----------------GV-ALFPDAVSARGQKHLRELMEM-VRQ-GHRA
SFSA_GEOSM      VETKNVTLVKD----------------GV-ALFPDAVSARGQKHLRELMEM-VRQ-GHRA
SFSA_GEOMG      VEVKNVTLVEG----------------ER-ALFPDAVTERGQKHLRELMEM-VRR-GDRG
SFSA_GEOSL      VEVKNVTLVEG----------------GT-ALFPDAVTERGQKHLRELMEV-VRQ-GDRG
SFSA_PELPD      VEVKNVTLVEG----------------ER-ALFPDAVTVRGQKHLNELMRV-VRE-GDRG
SFSA_GEODF      VEVKNVTLMED----------------GR-ALFPDAATVRGQKHLRELMEM-VRL-GHRA
SFSA_GEOUR      VEVKNVTLVEG----------------NA-VLFPDAATTRGQKHLRELMGV-VRQ-GHRA
SFSA_SYNC1      VEVKNVTLLCD----------------GQCACFPDAVTTRGQKHLRTLMDA-RRA-GMRA
SFSA_DESPS      IEIKNCSMAENRR-----------------AMFPDAVTARGTKHLRELIKL-VKQ-GENA
SFSA_BDEBA      IEVKNVTLA-EEG----------------TAKFPDAVTERGQKHLRELMAL--MEQGHTA
SFSA_PELUB      VEVKNVTLFREEK----------------TAEFPDAVTTRGSKHLKTLIEA--VKKGYKS
SFSA_DESVH      VECKNVTMVEDDV-----------------ACFPDAVTERGSKHLREMMDI--VSRGERA
SFSA_DESVV      VECKNVTMVEDDV-----------------ACFPDAVTERGSKHLREMMDI--VSRGERA
SFSA_OLEA2      VECKNVTMVEDDV-----------------AAFPDAATERGQKHLREMMEI--VRQGQRA
SFSA_MARSD      VECKNVTLVEDDI-----------------ACFPDAQTERGRKHLVELMDL--AAKGDRV
SFSA_LAWIP      VECKNVTLVENNV-----------------ALFPDAVSLRGLKHLQELKKI--IDSGERA
SFSA_SYNFM      IEAKNVTLVEDDV-----------------ACFPDAVTVRGQKHMRELTAL--ARAGRRA
SFSA_ALKMQ      IEAKCVTLVK----------------EGELASFPDAPTERGTRHVRELTEAVKQN--IRG
SFSA_NATTJ      IELKSVTLV-----------------QNNLALFPDAPTDRGRRHLEELTDSLREG--YQP
SFSA_ACET2      IEVKGVTLV-----------------ENRQGFFPDAPTQRGTRHLEELTKIRQNG--KEA
SFSA_CARHZ      IEVKSVTLV-----------------EGKYALFPDAPTPRGVRHLEEL-RALSSQ--YLT
SFSA_DESRM      IEVKSVTLV-----------------DEGVAKFPDAPSERGSKHLSELTRAVGEG--YRS
SFSA_ARCFU      VELKSAALK-----------------KGIYAMYPDCPTARGRKHLRLLEEIGKRS---RA
SFSA_PYRFU      VETKSAVLR-----------------EGEYAMYPDCPSVRGQRHIKELIKLARDG--KRA
SFSA_AQUAE      VEVKSVNLV-----------------KNGVAMFPDAPTKRGTGHIRTLIKLSDKF---KP
SFSA_THEM4      IEIKGCTLS-----------------DGNMARFPDAPTKRGTKHLEDLMELKKQG--FDT
SFSA_METST      LEVKGCTLV-----------------EDTTAKFPDAPTKRGKKHVEELMEIHEKG--IFT
SFSA_THEP1      VEVKGCTYE-----------------EDGVAMFPDAPTERGRRHIEELISSVKSG--FKA
SFSA_THESQ      VEVKGCTYE-----------------EDGVAMFPDAPTERGRRHIEELISSVKSG--FKA
SFSA_THEMA      VEVKGCTYE-----------------EDGVAMFPDAPTGRGRRHIEELIRSVKSG--FKA
SFSA_THENN      VEVKGCTFE-----------------ENGVAMFPDAPTVRGKRHVEELIRCVESG--FRA
SFSA_METTH      VEVKGCTLV-----------------RENLALFPDAPTERGRRHVEELERALSEG--YHS
SFSA_METBU      VEVKGCTLI-----------------YGNTATFPDAPTTRGKRHVGELKKALESG--SEA
SFSA_THEAC      IEVKGCTLM-----------------ANGIAMFPDAPTKRGLEHLKTLETLASSG--YRS
SFSA_THEVO      IEVKGCTLS-----------------IDGVAIFPDAPTLRGYEHLRLLERLAQEG--KGA
SFSA_PICTO      IEVKSCTLV-----------------NSKKAMFPDAVTRRGTHHLNVLLNSIQDG--YRP
SFSA_SULAC      VEVKGCSLV-----------------VDGKALFPDAPTERGKRHLEELIKLKMQG--YRS
SFSA_SULTO      VEVKGCTLA-----------------RDGIALFPDAPTKRGKRHLDELIELRRNG--YSV
SFSA_SULIA      LEVKGCTLV-----------------ENEIAYFPDAPTERGRRHLKELRELMKKG--FNA
SFSA_SULIK      LEVKGCTLV-----------------ENEIAYFPDAPTERGRRHLKELRELMKKG--FNA
SFSA_SULIM      LEVKGCTLV-----------------ENEIAYFPDAPTERGRTHLKELRELMKKG--FNA
SFSA_SULIL      LEVKGCTLV-----------------ENEIAYFPDAPTERGRRHLKELRELMKKG--FNS
SFSA_SACS2      LEVKGCTLV-----------------ENEIAYFPDAPTERGRKHLKELRELMRKG--FNA
SFSA_PYRAE      VEIKGVTLE-----------------VGGRALFPDAPTSRGARHMEELARAVAEG--YEA
SFSA_PYRAR      VEVKGVTLE-----------------AGRRALFPDAPTARGARHMEELARATAEG--YEA
SFSA_PYRIL      VEVKGVTLE-----------------AGGRALFPDAPTSRGARHMEELAKAVTEG--FEA
SFSA_PYRNV      VEVKGVTLE-----------------VGGRALFPDAPTTRGARHMEELARAAADG--FEA
SFSA_PYRCJ      VEVKGVTLE-----------------VGGVALFPDAPTARGARHMEELARAAAEG--YEA
SFSA_CALMQ      VEVKGVTLE-----------------EDGVAKFPDAPTLRGARHMIKLAKAIEEG--YEA
SFSA_CLOB8      IEVKGVTLE-----------------NNGIVKFPDAPTERGVKHLRELIDCIKEG--YDA
SFSA_RUMCH      IEVKGVTLE-----------------ENNIAMFPDAPTERGVRHIKELCDSLHDG--YKA
SFSA_DESHD      VEVKGVTLE-----------------EEGVALFPDAPTERGVKHLRELSQAVAAG--YEA
SFSA_DESHY      VEVKGVTLE-----------------EEGVALFPDAPTERGVKHLRELSQAVAAG--YEA
SFSA_ALKOO      IEVKGVTLE-----------------NEGICMFPDAPTERGTKHVLEMVEAVKQG--YRG
SFSA_CLOB6      LEVKGVTLE-----------------NDGLTMFPDAPTERGTKHILELIDVKNKG--MGA
SFSA_CLOBJ      LEVKGVTLE-----------------NDGLTMFPDAPTERGTKHILELIDVKNKG--MGA
SFSA_CLOBL      LEVKGVTLE-----------------NDGLTMFPDAPTERGTKHILELIDVKNKG--MGA
SFSA_CLOBK      LEVKGVTLE-----------------NDGLTMFPDAPTERGTKHILELIDVKNKG--MGA
SFSA_CLOBM      LEVKGVTLE-----------------NDGLTMFPDAPTERGTKHILELIDVKNKG--MGA
SFSA_CLOB1      LEVKGVTLE-----------------NDGLTMFPDAPTERGTKHILELIDVKNKG--MGA
SFSA_CLOBH      LEVKGVTLE-----------------NDGLTMFPDAPTERGTKHILELIDVKNKG--MGA
SFSA_CLOTE      LEVKGVTLE-----------------DGGVTKFPDAPTERGTKHILELIDVKNKG--IGA
SFSA_CLOK5      VEVKGVTLE-----------------KEGVAMFPDAPTERGRKHLLELIEVKKSG--MDA
SFSA_CLOK1      VEVKGVTLE-----------------KEGVAMFPDAPTERGRKHLLELIEVKKSG--MDA
SFSA_CLOAB      LEVKGVTLE-----------------DKGVARFPDAPTERGAKHLKELVEAKKSG--YGA
SFSA_CLOP1      LEVKGVTLE-----------------ENGETRFPDAPTERGKKHILELIEIKKLG--MGA
SFSA_CLOPS      LEVKGVTLE-----------------ENGETRFPDAPTERGKKHILELIEIKKLG--MGA
SFSA_CLOPE      LEVKGVTLE-----------------ENGETRFPDAPTERGKKHILELIEIKKLG--MGA
SFSA_CLONN      LEVKGVTLE-----------------DKGNCMFPDAPTERGTKHILELIEIKESH--MGA
SFSA_CLOBA      LEVKGVTLE-----------------ENGLCRFPDAPTERGTKHLLELIEVKNNN--IGA
SFSA_THEP3      VEVKGVTLE-----------------VEGVAKFPDAPTERGRKHLKELIKVKKEG--MRA
SFSA_THEPX      VEVKGVTLE-----------------VEGVAKFPDAPTERGRKHLKELIKVKKEG--MRA
SFSA_CALS4      IEVKGVTLE-----------------VDGVAKFPDAPTERGRKHLKELIKVKEEG--MRA
SFSA_LACP3      VETKGVTLA-----------------NGTLAAFPDAPTTRAVKHVHTLTMAQAEG--YQA
SFSA_LACCB      VETKGVTLA-----------------NGTLAAFPDAPTTRAVKHVHTLTMAQAEG--YQA
SFSA_ENTMU      VEVKGMTLE-----------------NKAIGAFPDAPTIRGLKHVNELIGAHQEG--YET
SFSA_METS3      IEVKGVTLI-----------------VDGEARFPDAPTERGAKHLKELIKLKNDG--NRA
SFSA_ALKCK      LEVKSVTLAR-----------------GSKGFFPDAVTKRGAKHVRELTALNLLPE-YES
SFSA_ALKHC      LEIKSVTLSE-----------------AGVAYFPDAVTARGTKHVKELTAIQQSGD-YET
SFSA_CHLSY      LEVKSVTRLV-----------------DGIAVFPDAPTERGGRHLELLINAARNG--QRA
SFSA_CHLAA      LEVKSVTRLV-----------------DGIAVFPDAPTERGGRHLELLINAARNG--QRA
SFSA_CHLAD      LEVKSVTRVI-----------------DGVAVFPDAPTERGSQHLELLTNAARNG--QRA
SFSA_MOOTA      VEVKSVTLVR-----------------GGLALFPDAPTARGSRHLRELMALHSRG--YRA
SFSA_SYMTH      VEVKSVTSVLPDAD------------GARVARFPDAPTARGARHLDELAGAVREG--YRA
SFSA_AERPE      VEVKGVNLSLD-----------------GVGLFPNAPSARAVKHLEVLARLAREG--VKP
                 * *                             *:  : *.  *   :            

SFSA_NOSS1      VMLYFINRGDCTEFAPGDSTDPIYGKLLREAIALGLEVLPCRFDVTPEG------IRYLG
SFSA_TRIV2      VMLYFINRGDCTEFAPGDSTDPIYGKLLREAIALGLEVLPCRFDVTPEG------IRYLG
SFSA_NOSP7      VMLYFINRGDCTEFSPGDRTDPVYGKLLRDAIALGLEVLPCRFDISPEG------IRYLG
SFSA_CYAP4      VMLYFINRGDCHQFAPGESADPVYAQLLRTAVAAGLQVLPCRFEITPEG------ICYLG
SFSA_SYNE7      VMLYFINRGDCTAFAPGDSADPTYGQLLRTGIAAGLEVYPCQFQISPEG------IDFLG
SFSA_SYNP6      VMLYFINRGDCTAFAPGDSADPTYGQLLRTGIAAGLEVYPCQFQISPEG------IDFLG
SFSA_ACAM1      YLLFFINRADCTTFAPGDQADPEYGKLLREAVATGVGLLPCRFEITPEG------IRYLG
SFSA_CROS5      IMLYFINRGDCQQFSPGDDYDPGYGKLFREAVKKGVEILPCRFEITPQG------IRYLG
SFSA_RIPO1      IMLYFINRGDCYSFAPGDEFDPTYGTLLREAVKKGLEVLPCRFEVTPEG------IHYLG
SFSA_MICAN      IMLYFINRGDCYRFAPGDSKDTKYGQLLRQAVAKGVKVLPCRFQVTPTG------IYYLG
SFSA_SYNP2      VMLYFINRGDCTRFAPGDSKDPKYGELFRQAIAAGIQILPCRFAVSPEG------ICYLG
SFSA_SYNY3      VMLYFINRGDCTHFSPGDAYDRRYGELFRQAIAAGVEVMPCRFMVNPEG------VKFLG
SFSA_TRIEI      VCLFLINRGDCYQFAPGDVADHDYGKLLREAMIKGVEILPCRFIVTPQE------INYLG
SFSA_GLOVI      AMLYFINRGDCTAFSPGDSLDPLYGQLLRAGIERGLLVLPCRFEITPQS------VRYLG
SFSA_THEVB      CMLYFINRGDCDRFAPGDSADPTYGQLLRAAYNQGVEILPYRFAIEPRG------IQFLG
SFSA_SYNJB      LLLYWINRADCTEFAPGEERDPRYARLFREALQAGVEMLPYRVEVSPTG------IRPLG
SFSA_SYNJA      LLLYWINRADCTEFAPGEERDPRYAHLFRQALQAGVEVLPYRIAVSPQG------IRPLG
SFSA_PROMA      VLVPCISRNDIEVFVPGDSADAKYGDLFRLALNAGVEVIPCAFDFHLDC------ITWEG
SFSA_PROM4      LLVPCISRNDVDLFAPGDAADPIYGNLFRQALSEGVEVMPCCFGFFSDH------ITWEG
SFSA_PROM1      VLIPCISRSDMELFSPGEIADPEYGRLFREALTKGVEVIPCAFGFFIDH------ITWEG
SFSA_PROMT      VLIPCISRSDIELFAPGEIADPEYGRLFREALTKGVEVIPCAFGFFIDH------ITWEG
SFSA_PROM3      VLVPCLSRHDVQTFAPGDSADPRYGELFRLALTAGVEVIPCCFGFHRDK------ITWEG
SFSA_PROMM      VLVPCLSRHDVQAFAPGDSADPRYGELFRLALTAGVEVIPCCFGFHLDK------ITWEG
SFSA_SYNS3      VLVPCLSRPDVIAFAPGDSADPRYGDLFRQAMAAGVEVLPCCFSFYEDQ------IQWEG
SFSA_SYNSC      VLVPCLSRPDVTAFAPGDSADPRYGELFRQATNSGVEVLPCCFSFSADA------VHWQG
SFSA_PARMW      VLVPCLSRPDVTEFAPGDSADPRYGELFREAIKAGVEVLPCRFRFQADG------IRWEG
SFSA_SYNS9      VLVPCLSRPDVMDFAPGDEADPRYGSLFRDALEAGVEVLPCCFRYQSNE------ISWQG
SFSA_SYNPW      VLIPCLSRPDVTAFAPGDSADPRYGELFRNALDAGVEVLPCCFRFDRDG------VTWQG
SFSA_SYNR3      VLIPCVSRSDVKRFAPGDSADPRYGELFRQAIDAGVEVVPCQFSFAADA------VRFEG
SFSA_PROMS      VLALCITRKDACFFAPGDDADPLYGSLFRESLSAGMITIPCSFEFHKDH------VSWRG
SFSA_PROM0      VLVLCITRKDACFFAPGDEADPLYGNLFRESLSAGMITIPCSFEFHKDH------ISWRG
SFSA_PROM2      VLVLCITRKDACFFAPGDEADPLYGNLFRESLSAGMIPIPCSFEFYKDH------VRWNG
SFSA_PROM9      ILILCITRKDACFFSPGDDADPLYGNLFRESFSAGMIPIPCSFEFHKDH------ITWNG
SFSA_PROM5      VLVPCITRKDVDFFGPGDEADPIYGDLFRDSIDAGMLLIPCCFEFHKDH------ITWKG
SFSA_PROMP      VLVPCITRKDIDYFAPGDESDPLYGELFRESISAGMLLIPCCFEFHSDH------VAWKG
SFSA_ECO8A      VIFFAVLHSAITRFSPARHIDEKYAQLLSEAQQRGVEILAYKAEISAEG------MALKK
SFSA_ECOHS      VIFFAVLHSAITRFSPARHIDEKYAQLLSEAQQRGVEILAYKAEISAEG------MALKK
SFSA_ECOSE      VIFFAVLHSAITRFSPARHIDEKYAQLLSEAQQRGVEILAYKAEISAEG------MALKK
SFSA_ECOLI      VIFFAVLHSAITRFSPARHIDEKYAQLLSEAQQRGVEILAYKAEISAEG------MALKK
SFSA_ECODH      VIFFAVLHSAITRFSPARHIDEKYAQLLSEAQQRGVEILAYKAEISAEG------MALKK
SFSA_ECOBW      VIFFAVLHSAITRFSPARHIDEKYAQLLSEAQQRGVEILAYKAEISAEG------MALKK
SFSA_ECOLC      VIFFAVLHSAITRFSPARHIDEKYAQLLSEAQQRGVEILAYKAEISAEG------MALKK
SFSA_ECO55      VIFFAVLHSAITRFSPARHIDEKYAQLLSEAQQRGVEILAYKAEISAEG------MALKK
SFSA_ECO5E      VIFFAVLHSAITRFSPARHIDEKYAQLLSEAQQRGVEILAYKAEISAEG------MALKK
SFSA_ECO57      VIFFAVLHSAITRFSPARHIDEKYAQLLSEAQQRGVEILAYKAEISAEG------MALKK
SFSA_ECO24      VIFFAVLHSAITRFSPARHIDEKYAQLLSEAQQRGVEILAYKAEISAEG------MALKK
SFSA_SHIDS      VIFFAVLHSAITRFSPARHIDEKYAQLLSEAQQRGVEILAYKAEISAEG------MALKK
SFSA_SHIBS      VIFFAVLHSAITRFSPARHIDEKYAQLLSEAQQRGVEILAYKAEISAEG------MALKK
SFSA_SHISS      VIFFAVLHSAITRFSPARHIDEKYAQLLSEAQQRGVEILAYKAEISAEG------MALKK
SFSA_SHIB3      VIFFAVLHSAITRFSPARHIDEKYAQLLSEAQQRGVEILAYKAEISAES------MALKK
SFSA_SHIFL      VIFFAVLHSAITRFSPARHIDEKYAQLLSEAQQRGVEILAYKAEISAEG------MALKK
SFSA_SHIF8      VIFFAVLHSAITRFSPARHIDEKYAQLLSEAQQRGVEILAYKAEISAEG------MALKK
SFSA_ECOSM      VIFFAVLHSAITRFSPARHIDEKYAQLLSEAQQRGVEILAYKAELSAEG------MALKK
SFSA_ECO7I      VIFFAVLHSAITRFSPARHIDEKYAQLLSEAQQRGVEILAYKAELSAEG------MALKK
SFSA_ECOUT      VIFFAVLHSAITRFSPARHIDEKYAQLLSEAQQRGVEILAYKAELSAEG------MALKK
SFSA_ECO27      VIFFAVLHSAITRFSPARHIDEKYAQLLSEAQQRGVEILAYKAELSAEG------MALKK
SFSA_ECO81      VIFFAVLHSAITRFSPARHIDEKYAQLLSEAQQRGVEILAYKAELSAEG------MALKK
SFSA_ECOK1      VIFFAVLHSAITRFSPARHIDEKYAQLLSEAQQRGVEILAYKAELSAEG------MALKK
SFSA_ECO45      VIFFAVLHSAITRFSPARHIDEKYAQLLSEAQQRGVEILAYKAELSAEG------MALKK
SFSA_ECOL6      VIFFAVLHSAITRFSPARHIDEKYAQLLSEAQQRGVEILAYKAELSAEG------MALKK
SFSA_ECOL5      VIFFAVLHSAITRFSPARHIDEKYAQLLSEAQQRGVEILAYKAELSAEG------MALKK
SFSA_ECOLU      VIFFAVLHSAITRFSPARHIDEKYAQLLSEAQQRGVEILAYKAELSAEG------MALKK
SFSA_ESCF3      VILFAVLHSAITRFSPARHIDMKYAQLLTEAQQRGVEILAYKAEISAEG------MSLKK
SFSA_CITK8      VVLFAVLHSAITRFSPARHIDAKYAQLLIEAQLKGVEILVYKAELSAEG------MTLKE
SFSA_SALPA      VVVFAVLHSAITRFSPARHIDIKYAQLLSEAQNKGVEVLAYKAELSAQK------MELNE
SFSA_SALPK      VVVFAVLHSAITRFSPARHIDIKYAQLLSEAQNKGVEVLAYKAELSAQK------MELNE
SFSA_SALCH      VVVFAVLHSAITRFSPARHIDIKYAQLLSEAQNKGVEVLAYKAELSAQK------MELNE
SFSA_SALA4      VVVFAVLHSAITRFSPARHIDIKYAQLLSEAQNKGVEVLAYKAELSAQK------MELNE
SFSA_SALG2      VVVFAVLHSAITRFSPARHIDIKYAQLLSEAQNKGVEVLAYKAELSAQK------MELNE
SFSA_SALDC      VVVFAVLHSAITRFSPARHIDIKYAQLLSEAQNKGVEVLAYKAELSAQK------MELNE
SFSA_SALEP      VVVFAVLHSAITRFSPARHIDIKYAQLLSEAQNKGVEVLAYKAELSAQK------MELNE
SFSA_SALHS      VVVFAVLHSAITRFSPARHIDIKYAQLLSEAQNKGVEVLAYKAELSAQK------MELNE
SFSA_SALNS      VVVFAVLHSAITRFSPARHIDIKYAQLLSEAQNKGVEVLAYKAELSAQK------MELNE
SFSA_SALPB      VVVFAVLHSAITRFSPARHIDIKYAQLLSEAQNKGVEVLAYKAELSAQK------MELNE
SFSA_SALSV      VVVFAVLHSAITRFSPARHIDIKYAQLLSEAQNKGVEVLAYKAELSAQK------MELNE
SFSA_SALTY      VVVFAVLHSAITRFSPARHIDIKYAQLLSEAQNKGVEVLAYKAELSAQK------MELNE
SFSA_SALTI      VVVFAVLHSAITRFSPARHIDIKYAQLLSEAQNKGVEVLAYKAELSATK------MELNE
SFSA_SALAR      VVLFAVLHSAITRFSPARHIDIKYAQLLSEAQNKGVEVLAYKAELSATK------MELNK
SFSA_KLEP3      VILFAVLHSAIDRFSPAHHIDARYAQLLTEARDKGVEILAWKAELSTTK------MTLNK
SFSA_KLEP7      VILFAVLHSAIDRFSPAHHIDARYAQLLTEAQDKGVEILAWKAELSTTR------MTLNK
SFSA_ENT38      VLLFAVLHSAIERFSPARHIDPKYAQLLNEAQKQGVEILAYKAELSADN------MTLKS
SFSA_CROS8      VLLFAVLHSAITQVAPARHIDERYAELLSEAQRKGVEVLAWKASLSASE------ITLTS
SFSA_PECAS      VLFFAVLHSGIQQVSPARHIDSRYAELFIEAQQAGVEILCYGSTLCPDG------IKLTN
SFSA_PECCP      VLFFAVLHSGIQQVSPARHIDSRYAELFTEAQRAGVEILCYGSTLCPDG------ITLTH
SFSA_YERPE      VLFFAVLHTGIKQVAPARHIDRRYAELLVQAQQAGVEVICYGFQLSPDG------IELNT
SFSA_YERPP      VLFFAVLHTGIKQVAPARHIDRRYAELLVQAQQAGVEVICYGFQLSPDG------IELNT
SFSA_YERPA      VLFFAVLHTGIKQVAPARHIDRRYAELLVQAQQAGVEVICYGFQLSPDG------IELNT
SFSA_YERPN      VLFFAVLHTGIKQVAPARHIDRRYAELLVQAQQAGVEVICYGFQLSPDG------IELNT
SFSA_YERPS      VLFFAVLHTGIKQVAPARHIDRRYAELLVQAQQAGVEVICYGFQLSPDG------IELNT
SFSA_YERP3      VLFFAVLHTGIKQVAPARHIDRRYAELLVQAQQAGVEVICYGFQLSPDG------IALNT
SFSA_YERE8      VLFFAVLHTGIRQVAAARHIDNRYAELLAQAQQAGVEVICYGFQLSPDG------IALDA
SFSA_PHOLL      VLFFAVLHSGINQVAAAAHIDHNYSSLLEQAQNSGVEVICYQANMTGKG------MVLGD
SFSA_SERP5      VLFFAVLHSGIEQVAPAHHIDERYATLLAQVQQLGVEVVCYGAKLSPDG------IYLCD
SFSA_EDWI9      VLFFAVLHSGITHVRAARHIDPRYAQLLAQASDLGVEVLCYGAQINPAG------IRLTQ
SFSA_SODGM      VLFFAVLHSGIDRVSPARHIDPHYADLVLQAQQYGVEVLCYGCQLSRHG------MRIHT
SFSA_ACTP2      VILFAILHTGIQRFAVAKQIDPQYAALFEQAKNVGVKVLAYKAQIELVL------GKPIS
SFSA_ACTP7      VILFAILHTGIQRFAVAKQIDPQYAALFEQAKNVGVKVLAYKAQIELVL------GKPIS
SFSA_ACTPJ      VIFFAILHTGIQRFAVAKQIDPQYAALFEQAKNTGVKVLAYKAQIELVQ------GKPEA
SFSA_ACTSZ      VVLFAGLHNGFDCFKIAEHIDPEYDRLLKDAMRQGVEAYAYAGAFEKTQ------EIPTA
SFSA_MANSM      VVLFAGLHNGFDCFKTAEYIDPDYDKLLRQAMKEGVEVYAYAGKFDKIQ------EIPTA
SFSA_HAEI8      VVLFAGLHNGFDRFKIAEYIDPEYDRLLKEAMEQGVEAYAYAGQFEISN------EIPTA
SFSA_HAEIE      VVLFAGLHNGFDRFKIAEYIDPEYDRLLKEAMEQGVEAYAYAGQFEISN------EIPTA
SFSA_HAEIG      VVLFAGLHNGFDRFKIAEYIDPEYDRLLKEAMEQGVEAYAYAGQFEISN------EIPTA
SFSA_HAEIN      VVLFAGLHNGFDRFKIAEYIDPEYDRLLKEAMEQGVEAYAYAGQFEISN------EIPTA
SFSA_PASMU      VVFFAGLHNGFDCFKVAEYIDPEYDKLLQEAIQEGVEVYAYAGKFDFSD------KKPTA
SFSA_HAES1      VVFFAGLHDGFNRFTVAKSIDPDYAELLQQAVKEGVEVYSYAVKFDFSH------QKPTA
SFSA_HISS2      VVFFAGLHDGFNRFTVAKSIDPDYAELLQQAVKEGVEVYSYAVKFDFSH------QKPTA
SFSA_PSYIN      VLLFAVLHSGIKSVQAAGHLDVKYAQLFEQAKKAGVEVYCYYPELTLP------------
SFSA_AERHH      VLLFMVLHSGIVRMRPAAHIDPHYSLLIEQAITAGVEILCYRPHVGVQS------MVAQD
SFSA_AERS4      VLLFMVLHSGIVRMRPAAHIDPHYSLLIEQAITAGVEILCYRPHVGVQS------MVAQD
SFSA_ALIF1      ILFFAVLHSGIEKVSIAHHIDQQYHSLLIDAIENGVNILCYQAEMSSKE------MKIVR
SFSA_ALIFM      VLFFAVLHSGIEKVSIAHHIDQQYHSLLIDAIENGVNILCYQAEMSSKE------MKIVR
SFSA_ALISL      VLFFAVLHSGIEKVSIAHHIDQQYYSLLLEAIESGVTVLCYQAEMSPTE------MKIVR
SFSA_PHOPR      VLFFAILHSGIENVSAAHHIDPDYYRLIKQAEQAGVEIICYKATLNQDE------IKLNH
SFSA_VIBCB      ILLFTVLHSGIEKVSAAHHIDAKYSTLLKQAQDAGVEVLCYKAELSNTE------VKLIS
SFSA_VIBPA      ILLFTVLHSGIEKVSAAHHIDAKYSLLLKQAQDAGVEVLCYKAELSNTE------MKLIS
SFSA_VIBA3      VLLFTVLHSGIEKVSAAHHIDAKYSLLLKQAQDAGVEVLCYKAELSSTQ------IQLKQ
SFSA_VIBVU      ILLFAVLHSGIEKVAAALHIDAKYSQLLKQAQKAGVEVLCYKAEISNTE------IKLNS
SFSA_VIBVY      ILLFAVLHSGIEKVAAALHIDAKYSQLLKQAQKAGVEVLCYKAEISNTE------IKLNS
SFSA_VIBCH      ILLFAVLHSGIEKVAPALHIDANYSQLLKAAQEAGVEVLCYKASLSKHE------IRMVS
SFSA_VIBC3      ILLFAVLHSGIEKVAPALHIDANYSQLLKAAQEAGVEVLCYKASLSKHE------IRMVS
SFSA_PROMH      ILFYAVPHTGITQVSVAKEIDPKYDLLLKQACDAGVEILCYRINISEYD------LTIGK
SFSA_COLP3      VLLFAVLHSGINDISAASHVDPIYAKLLKEARLAGVEIIAYKAGFSLQL------GELDV
SFSA_PSET1      VLLFAVLHQGINQVSAAAHIDNKYAQLLNEAINQGVEVLAYKADISTN----------EI
SFSA_IDILO      VQLYMVMHDGIERVSPAAHIDSQYAELCRKAASVGVEFYAVKCRASAKE------IKLER
SFSA_SHEB8      VLLFVVQHSDIFSVAPAAHIDPEYAKLLKKAVLAGVEVLAYRCEMSPTE------IHLAQ
SFSA_SHEB2      VLLFVVQHSDIFSVAPAAHIDPEYAKLLKKAVLAGVEVLAYRCEMSPTE------IHLAQ
SFSA_SHEB5      VLLFVVQHSDIFSVAPAAHIDPEYAKLLKKAVLAGVEVLAYRCEMSPTE------IHLAQ
SFSA_SHEB9      VLLFVVQHSEIFSVAPAAHIDPEYAKLLKIAVLAGVEVLAYRCEMSPTE------IHLAQ
SFSA_SHEPC      VLLFVVQHSEIFSVAPAAHIDHEYANLLKKATLSGVEVLAYRCEMSPTE------IRLAQ
SFSA_SHESW      VLLFVVQHSEIFSVAPAAHIDHEYANLLKKATLSGVEVLAYRCEMSPTE------IRLAQ
SFSA_SHESM      VLLFVVQHTDIHSVAPAAHIDPEYANLLKKAILSGVEVLAYRCEISPDE------IHLAQ
SFSA_SHESR      VLLFVVQHTDIHSVAPAAHIDPEYANLLKKAILSGVEVLAYRCEISPDE------IHLAQ
SFSA_SHESA      VLLFVVQHTDIHSVAPAAHIDPEYANLLKKAVLSGVEVLAYRCEISASE------IHLAH
SFSA_SHEON      VLLFVVQHTDIMSVAPAAHIDPEYANLLKKSVLSGVEVLAYRCEISPSE------IHLAQ
SFSA_SHEDO      VLLFVVQHSGINSVSPARHIDVAYSELFTQALDAGVEVLAYQTQMSPQE------SQILT
SFSA_SHEFN      VLLFVVQHSAITSVKPARHIDPHYADLLEQAVANGVEVLAYKTALSPQG------SLITS
SFSA_SHEHH      VLLFVVQHSGINCVQAAAHIDPSYAALLSEAHAKGVEIIAYKADSSPIE------ARLVK
SFSA_SHEPA      VLLFVVQHSGIKSVQAATHIDAEYAELLSKAYHKGVEIIAYSTDSSPLG------ASLVK
SFSA_SHEPW      VLLFVVQHTGIHSVKAAEHIDPAYAKLLSEAHATGVEVLAYSADMSPIA------ASLVK
SFSA_SHESH      VLLFVVQHTGIDSVQAAAHIDPDYASLLTKAHSAGVEVIAYSAEMSPKG------ASLLK
SFSA_SHEWM      VLLFVVQHTGIESVMAAKHIDPDYAELLSQAHQAGVEILAYNTEMSPNQ------ASLLK
SFSA_SHELP      VLLFVVQHTGITTVAAARHIDPEYAELLTQAHQAGVEILAYSCELSPSA------AKLIK
SFSA_SHEAM      VLLFVVQHQGIHRVAPAEAIDPKYAALLREAIAAGVEVLAYGCMMNNKG------LQLNI
SFSA_HAHCH      ALVFCVNHSGISVVSPATHIDARYGALLSEAIEAGVEVLAYKSEITPGE------IRLTQ
SFSA_ALTMD      SLLFCVQHTAIESVQVAEYIDPTYAESVKKAADAGVSLLAASCIIDEQK------ILLNQ
SFSA_PSEA6      VLLFCVQHSGIQSVKIAEHIDPKYAQMFKHAVDVGVEVLAYSCAINEQN------ITLNQ
SFSA_MARN8      VLFFVVNHTGIEQVRPADHIDARYGQLLREACEAGVEVIAYRAALAGEDGDPSGRLELVE
SFSA_MARMS      VMFFCVSHTGINSVTPAAHIDKKYAQAFVEVVKKGVEVIAYQVAIDSQE------MKVVR
SFSA_AZOVD      VQLYCVNLSGIAAVRPAAEIDPGYAQALREAVAAGVEVLAYGAELSPAA------IRLVR
SFSA_PSEMY      VLLYCVNLSGIVAVRAAEDIDPAYAAGLREARAAGVEVLAYGAELSPEG------ISLVR
SFSA_PSEAE      VQLYCVNLSGVEAVRPADEIDPAYGKALREAAQAGVEVLAYGAEVTTEG------LNLAR
SFSA_PSEA8      VQLYCVNLSGVEAVRPADEIDPAYGKALREAAQAGVEVLAYGAEVTTEG------LHLAR
SFSA_PSEAB      VQLYCVNLSGAEAVRPADEIDPAYGKALREAAQAGVEVLAYGAEVTTEG------LHLAR
SFSA_PSEA7      VQLYCVNLSGIEAVRPADEIDPAYGKALREAAQAGVEVLAYGAEVTTEG------LRLAR
SFSA_PSEP1      VQLYCVNLTGIDAVRPAEEIDTAYAQALRAAVADGVEVLAYGTRLDAEG------IVIDR
SFSA_PSEPK      VQLYCVNLTGIDAVRPAEEIDTAYAQALRAAVADGVEVLAYGTRLDAEG------IVIDR
SFSA_PSEPG      VQLYCVNLTDVEAVRPAEEIDAAYAQALRAAVADGVEVLAYGTRLDAEG------IVIDR
SFSA_PSEPW      VQLYCVNLTGIEAVRPADEIDAAYARALRAAVADGVEVLAYGARLDAEL------IVIDR
SFSA_PSEE4      VQLYCVNLTGIEAVRPAEEIDAAYAQALRAAVAEGVEVLAYGTRLDARG------IVIDR
SFSA_PSEF5      VQLYCVNLSGIDAVRPAQEIDPGYAAALREARAAGVEVLAYGVCLTAEQ------VFIDR
SFSA_PSEFS      VQLYCVNLSGIDAVRPAVEIDAAYAAALREAKSAGVEVLAYGVRVTSEE------ICVDR
SFSA_PSEPF      VQLYCVNLTGVEAVRPAEEIDFAYAAALREAVACGVEVLAYGVRLSHEE------MVIDR
SFSA_PSE14      VLLYCVNLTGIDAVRPAKEIDPVYAAALREAIDAGVQILAYGVHLTPDE------IVIDR
SFSA_PSEU2      VLLYCVNLTGIDAVRPAQEIDPAYAAALREAIDAGVQILAYGAQLTSEE------IFIDR
SFSA_PSESM      VLLYCVNLTGIEAVRPAKEIDPAYAAALREAVDAGVQILAYGVQLTPEA------VYIDR
SFSA_SACD2      VLFFCVQHSGITKVAAAEHIDPAYAALFKQAVNEGVEVIAYGVDLGIEG------SVITK
SFSA_TERTT      VLFFCVQHTGVNLVSPADDIDAVYGQLLREAAGAGVEIFAVRATLGSCE------IKLRE
SFSA_ALCBS      VLFFCVQHSGATAARPADEIDARYGQLLREAIENGVEVLAWKSEVSAQC------FRLKE
SFSA_ACIF2      VMLFLIGREDGRGFAPADAIDPAYGKALRRARTDGVEILAYRTRLSP------DKISLSV
SFSA_ACIF5      VMLFLIGREDGRGFAPADAIDPAYGKALRRARTDGVEILAYRTRLSP------DKISLSV
SFSA_RHIME      IMLYLIQRGDCSRFRICRELDPVYARAFERASARGVEAYAVKCAVSP------GQIVAAG
SFSA_SINMW      IMLYLVQRDDCSRFRICRELDPVYARAFERASTRGVEAYAVKCQVSP------LQIVATG
SFSA_AGRFC      VMLYLIQRDDCERMRICADLDPIYALAFQRAMARGVEAYAVKCAVSP------TQISVSG
SFSA_AGRRK      VMLFVIQRHDCDRFRVCGDLDVVYATAFQRALKRGVEVYALKCRVSP------TEITPAG
SFSA_AGRVS      AMLYVIQRQDCDALAICADLDPVYGRAFTAAISQGVEAYAVKCAITP------RGIIPAC
SFSA_BRUAB      IMLFIIQRADCSRFGISGDLDPFYARAFERAIASGVEAWAVRCHITE------NGIDATE
SFSA_BRUSI      IMLFIIQRADCSRFGISGDLDPFYARAFERAIASGVEAWAVRCHITE------NGIDATE
SFSA_BRUC2      IMLFIIQRADCSRFGISGDLDPFYARAFERAIASGVEAWAVRCHITE------NGIDATE
SFSA_BRUA2      IMLFIIQRADCSRFGISGDLDPFYARAFERAIASGVEAWAVRCHITE------NGIDATE
SFSA_BRUA1      IMLFIIQRADCSRFGISGDLDPFYARAFERAIASGVEAWAVRCHITE------NGIDATE
SFSA_BRUO2      IMLFIIQRADCSRFGISGDLDPFYARAFERAIASGVEAWAVRCHITE------NGIDATE
SFSA_BRUSU      IMLFIIQRADCSRFGISGDLDPFYARAFERAIASGVEAWAVRCHITE------NGIDATE
SFSA_BRUME      IMLFITQRADCSRFGISGDLDPFYARAFERAIASGVEAWAVRCHITE------NGIDATE
SFSA_BRUMB      IMLFITQRADCSRFGISGDLDPFYARAFERAIASGVEAWAVRCHITE------NGIDATE
SFSA_BRUA4      VMLFIIQRNDCSRFSISGDLDPTYARAFERARANGVEAWAVRCHITD------KSIDASE
SFSA_CHESB      VMIYVVQRADCSRFRLCADLDASYAAAFGRARDAGVEAFVIGCQISA------DAIAPDR
SFSA_BARHE      VMLYIIQREDCSAFTICRDLDPTYGRKFDLALESGVEFYAIKCQVSV------EGIFPIQ
SFSA_BARQU      AMLYMIQREDCSAFTICRDLDPTYGRKFDLALKSGVEFYAVKCHVSV------EGIFPIH
SFSA_BART1      AMLYIIQREDCTAFTICHDLDPLYGRKFDLALKSGVECYAIKCHISV------EGIFPIQ
SFSA_DINSH      VMLYLVQRTDCTRLRLAPDLDPSYARAFDAARATGVEMLCYGTLIDT------GGVTLGR
SFSA_JANSC      VMLYVVQRTDCARFRLAPDLDPAYARAFDAARDAGVEVLCHGTDITP------EGITLTG
SFSA_ROSDO      IMLYLVQRTDCTSFTLAGDIDPTYAAAFRSARDRGVETLCLGTNITP------QGIEVAG
SFSA_RUEPO      IMLYLVQRTDCDRFTLAADIDPAYARAFETARAQGVEKLILTTHISP------QGVEIAD
SFSA_RUEST      VMLYLVQRTDCDRFALAADIDPAYAAEFETAHAKGVERLVIGTTITP------EGVKIGD
SFSA_AZOC5      VMVYLSQIASARDIRLARDLDPAYGRAFDLARTAGVEAIGLVCRIDA------QGIEVTG
SFSA_XANP2      VMVYLSQIGSARSIGLARDLDPAYGRAFDRARERGVEAIGLVCRIDP------EGIEVAD
SFSA_RHOCS      VMVYLVQRADCDTFRIAADIDPAYAAGLRVALDHGVEALVLGCALTP------DGIGIDR
SFSA_MAGSA      VMVYLVQREDCAGFRPAADIDPVYARTLAQATRDGVEAICYTCRLAP------DGIDLGA
SFSA_RHORT      AMVYLVQRTDGGAVAMAADIDPAYAAGLKTAIAKGVEVYCLGCEVDPL-----RGIWVNR
SFSA_CAUVC      VVLFVVQREDCETFSACAELDPAFAAGLEAAAKAGVEVLVYACEMGT------QAVRIAR
SFSA_CAUVN      VVLFVVQREDCETFSACAELDPAFAAGLEAAAKAGVEVLVYACEMGT------QAVRIAR
SFSA_CAUSK      VQLFVIQRTDCNSFAACEDLDPVYARGLSHAAAAGVEVLCYRCDISP------DEIRISR
SFSA_PHEZH      VVLFVVQRTDCDRFSPAADCDPKFAAALAEVASAGVEVLVYGCEIDA------ARVRLGR
SFSA_METC4      MLIVVIQ-MRAGAFDVARDIDPVFDRALRMALEVGVEAYAYTCAVGP------EGVAIDT
SFSA_METEP      MLIVVIQ-MRAGAFDVARDIDPVFDRALRMALEVGVEAYAYTCAVGP------EGVAIDT
SFSA_METPB      MLIVVIQ-MRADAFDVARDIDPAFDRALRAALAAGVEAYAYTCAVGP------EGVEIAE
SFSA_METRJ      LVVIVVQ-MRAEAFDVARDIDPAFDRAFREARAAGVAVRAYRCAVGP------EGVAIAE
SFSA_METNO      LLIVVVQ-MRAARFDVAGDIDPGFAAAFRRARAAGVETVAYACRLDP------DEVTIDR
SFSA_METS4      MVIVVVQ-MRAGRFTVAGDVDPAFAASFRRAQEAGVATVAYRCRLDP------DEVAIEA
SFSA_MARMM      VQLFIVQRSDCDVLRPAEDIDPVYARTLRDSAAAGVEVLAYACEVSP------TAVIIHR
SFSA_NITOC      VMFYLVQREDCRYFTPADDIDPRYGAKLRSAIEQGVEILAYACQVSS------QGIQVTQ
SFSA_CHRSD      VLLFCVAHTGIDAVAPAAHLDPAYAETLRRVAAQGVEVLAYGMSATWTHDGVPGDIALTR
SFSA_MAGMM      VILFIVQRSDLDHFRPAHEIDPGYAQTLQWAISEGVEILVYACALT------TASIYVER
SFSA_ALKEH      ALVFCVQRPDVREVHPADAIDRAYGQALRAALADGMEAYALQGGPSP------EGIELTR
SFSA_HALHL      ALVFCVQRSDAQEVRPAEAIDPRYADALRAAAAEGVEIRAVRLHPSA------TGIRPDC
SFSA_THISH      ALVFCVQRGDVHTVRPADAIDPLYGQRLREAAQAGVRVLACGARVWP------GGVVLER
SFSA_CITBB      VNLFIVQRADGAALAPADAIDPVYGRLLREAAQNGVEILAYRAEVTR------TEVRLER
SFSA_GEOSM      VNLFIVQRADGVALAPADAIDPVYGRLLREAAQNGVEILAYRAEVTR------TEVRLER
SFSA_GEOMG      VIFYVVQRGDGEAVSPADAIDPKYGQLLRLAVANGVEALAYRALVTP------EEIRLTE
SFSA_GEOSL      VIFFVVQRGDGSAVAPADAIDPVYGRLLRQAVTAGVEALAYRALVTP------EEIRLTE
SFSA_PELPD      VIFFTVQRGDAESVSPADAIDPEYGRLLRLALDSGVEALAYRAVVSP------EEIRLKE
SFSA_GEODF      VNFFVVQRPDCSSVSPADAIDPEYGRLLRLAAANGVELLAYQAQVSR------ETIHLTH
SFSA_GEOUR      VNFFVVQRADGEFVAPADLIDPEYGRLLRQAAANGVEILAYRAHVAP------EGINITG
SFSA_SYNC1      AILFVVQRGEATAFRPADTIDPEYGRLLRQAVSEGVEALAYRTRISP------TQTFIDR
SFSA_DESPS      YIFFLIQREDADSFSPATHIDPLYANTLKEALQQGVQALAYQASVILRA----LPIILNG
SFSA_BDEBA      EIVFTIQRHDCGSFSPADDIDPEYGRLLREAYQKGLRVSPFVLDLTPES------VELSE
SFSA_PELUB      YLLFLVQIEGVDNFKIAKDIDKEYYENYLLAKKAGVNFLAYQCKINSKE------IKIDK
SFSA_DESVH      AMFYLVQRPDGLCFGPADVIDPQYAALFWEAVDAGVEMYPHRGIVSPVG------IDLSG
SFSA_DESVV      AMFYLVQRPDGVCFGPADVIDPQYAALFWEAVDAGVEMHPHRGIVSPAG------IDLGE
SFSA_OLEA2      AMFYLVQRADGHCFGPADYVDPVYAGLFYEAAAAGVEMYPHRALVSEHG------IDLGP
SFSA_MARSD      ALFFFVQRTDGSCFGPADFIDPEYAELFYKALDAGVKCWAYEAVLSERG------IGIGR
SFSA_LAWIP      ATFYCVQRKDGKFFGPAASIDPQYTEMFWKVKKRGVEIYPYHIDITTKG------LSLGP
SFSA_SYNFM      ACFFLVQRPDASCFAPADFIDPVYAELFHAAVHAGVEIWPYEAVVTRQG------IALGR
SFSA_ALKMQ      AVFFIVQREDAVRFTPNKEMDPQFQQAVTEAKKAGVEFYAYNCIVTED--------YIAI
SFSA_NATTJ      AVIFLVQRDDALCFAPNWEMDEAFSKALVQAQEQGVAVESYAFKVTPE--------GLNY
SFSA_ACET2      GVAFIVQREDADVVRPNDRTDKNFANALRIAAEAGVDLMAYVCKVDAEQ------RRMDI
SFSA_CARHZ      AVVFLICREDAEVFKPNDKCDPYFASALKKAAMAGVYIKAYRLKLDLK--------GVYF
SFSA_DESRM      AVIFIIQRDDARSFSPNSITDPVFSQTLSQAIEAGVEIYALACDVSLN--------TVRL
SFSA_ARCFU      LVVFVAALPSVRAFMPNREGDEELYRLIKRS--KNVEFRSIQVEYLNGK------VFLRN
SFSA_PYRFU      MIVFIGALPNVSKFKPYKKGDPKIAELLKEALEAGVEIRALGLHMELSG------EIIYR
SFSA_AQUAE      LLVFVVQRSDFLSFEPNCETDPEFCKAYYEYVSKGFEVLVLKCRVSLEE------INVVE
SFSA_THEM4      FIYFLIFAN-ANYFSPNYETDLSFSKKLEEAYSLGVKIVPLLFS--LEN------NWIVF
SFSA_METST      MVLILVLHNDADEFKPNYDTDIDFSQTLHEAYISGVKIYPLKINTELKN------NSIIL
SFSA_THEP1      LLLILVFLES-DCFLPNRNVDPAFSRVFWRALKSGVNIDVFRVKYDGEY------LCSTE
SFSA_THESQ      LLLILVFLES-DCFLPNRSVDPAFSRVFWRALKSGVNIDVFRVKYDGEY------LCSTE
SFSA_THEMA      LLLILVFLES-DCFLPNRSVDPAFSEIFWRALNSGVNIDVFRVKYDGEY------LCSTE
SFSA_THENN      LLLILVFLES-RCFLPNRKVDPFFSEIFWHALSKGVDVCVFRLKYDGEY------LHSMG
SFSA_METTH      SVLFLVFGRSARFFSPNHEMDPEFSSALRRAHEAGVNVIPYTLATDINE------KVLVY
SFSA_METBU      LILIIILRKDALCFKANASIDPDFAEVFKDAVNAGVQVCPLVFGYEGRE------LFYKG
SFSA_THEAC      HVMMIITRDDVRCFYPNFETDPKFAEAFLRLVPAYVKAHFLTFGFDGLY------LRYAG
SFSA_THEVO      YVLFLIF-SDATSFRPNSETDPRFSDEFYKALKNGVKFSFKRFSFDGKY------LKYSG
SFSA_PICTO      YIMFLIFNERAECFTPNKCRDPEFSGTFYRAVKNGVSSKFLVFYIRENS------IYFDK
SFSA_SULAC      LILILVMRDDAICFSPNWKTDKKFSMAFKNAVEEGVEVTIKLLKLIDNK------IWYIK
SFSA_SULTO      LLMILVFRTDVVCFSPNFDTDRDFSNTFIKALKEGVNVEVKVFQLDKEN------IVYKG
SFSA_SULIA      ILLILVMRDDAKCFLPNEKTDPKFSIEFWNSIKEGLNVNIKTFKLVGNK------IIYVR
SFSA_SULIK      ILLILVMRDDAKCFLPNEKTDPKFSIEFWNSIKEGLNVNIKTFKLVGNK------IIYVR
SFSA_SULIM      ILLILVMRDDAKCFLPNEKTDPKFSIEFWNSIKEGLNVNIKTFKLVGNK------IIYVR
SFSA_SULIL      ILLILVMRDDAKCFLPNEKTDPKFSIEFWNSINEGLNVNIKTFKLVGNK------IIYVR
SFSA_SACS2      ILLILVMRNDAKCFLPNEKTDPKFSVEFWDSIKEGLKVYIKTFSLIGNK------IVYVG
SFSA_PYRAE      HVIFLVLRKRAESMSPHWEMDRKFAESLLRAHKAGVKIHAVKLEMFK-W------GLRFS
SFSA_PYRAR      YVLFLVFRKRAASFSPNWDMDRKFAESLLRAHNAGVGVRAVKLEMFK-W------GLRYV
SFSA_PYRIL      HVIFLVFRKRAKVFSPNWEMDRKFAEALVRAYRSGVYIHAVKLEMFK-W------GLRYI
SFSA_PYRNV      HVVFLVLRKKAAVFSPNWEMDRRFAEALARAYKSGVYVHAVKLETSR-W------CLKYV
SFSA_PYRCJ      HVLFLVLRRRARLFSPNWALDAKFAEALAKAADAGVKISAVKLEMFK-W------GLKFA
SFSA_CALMQ      YVIFLVLRSNALLFTPNVSLDPRFSNALKYAIEHGVKVLAYKLALTRDW------VLLPM
SFSA_CLOB8      YVIFVIQMKEVVHFEPNVETHKEFGDTLKYAKENGVNIVAVDCLVDEDS------INIRD
SFSA_RUMCH      YIIFVIQMKDVDYFIPNETTHREFSDALKSAYRKGVNILALDCVVEEGF------IEIEK
SFSA_DESHD      YVVFIIQMKDIHYFTPNIKTHQAFGDSLIQAEKQGVKILALDCEVTEDS------IEAGD
SFSA_DESHY      YVVFIIQMKDIHYFTPNIKTHQAFGDALIQADKQGVKILALDCEVTEDS------IEAGD
SFSA_ALKOO      ILLFVIQMKGPNLFKLNWEMDRAFSQAVQFASENGVEVLAYDAVIEKDE------IILGD
SFSA_CLOB6      GVLFLIQLNGVKKFTPNHKMDKNFGEALRLAKEKGVDILAYDCLVEESS------ISLNN
SFSA_CLOBJ      GVLFLIQLNGVKKFTPNHKMDKNFGEALRLAKEKGVDILAYDCLVEESS------ISLNN
SFSA_CLOBL      GVLFLIQLNGVKKFTPNHKMDKNFGEALKLAKEKGVDILAYDCLVEESS------ISLNN
SFSA_CLOBK      GVLFLIQLNGVKKFTPNHKMDKNFGEALKLAKEKGVDILAYDCLVEESS------ISLNN
SFSA_CLOBM      GVLFLIQLNGVKKFTPNHKMDKNFGEALRLAKEKGVDILAYDCLVEESS------ISLNN
SFSA_CLOB1      GVLFLIQLNGVKKFTPHHKMDKNFGEALRLAKEKGVDILAYDCLVEESS------ISLNN
SFSA_CLOBH      GVLFLIQLNGVKKFTPHHKMDKNFGEALRLAKEKGVDILAYDCLVEESS------ISLNN
SFSA_CLOTE      GVLFLIQMKDVKYFTPNIEMDKNFSEALVSAHKAGVDIFAYECDVDEDF------ITLKK
SFSA_CLOK5      AVLFLIQMKDVKYFRPHDEMDKKFGEALRHAKENYVQVVAYDCDVGENF------IILRD
SFSA_CLOK1      AVLFLIQMKDVKYFRPHDEMDKKFGEALRHAKENYVQVVAYDCDVGENF------IILRD
SFSA_CLOAB      GVLFLMQMDNISEFRPHDEMDKMFGEALRYAAINGVDVMAYECSVDEKS------ITLTK
SFSA_CLOP1      GIIFLIQIDNVNKFSPNDETDPKFGEALRLAKKERVDIFAYNCKVTEEE------IELLN
SFSA_CLOPS      GIIFLIQIDNVNKFSPNDETDPKFGEALRLAKKEGVDIFAYNCKVTEEE------IELLN
SFSA_CLOPE      GIIFLIQIDNVNKFSPNDETDPKFGEALRLAKKEGVDIFAYNCKVTEEE------IELLN
SFSA_CLONN      GILFLVQLSGAKTFSPHKEMDKKFSEALTLAHKKGVDIFCYDCNVGEDY------IEIKD
SFSA_CLOBA      GVLFLVQLENVKSFSPNDDTDPKFAAALKKAKSSGVDIFVYKCSVSENH------IELSQ
SFSA_THEP3      AVIFLIQMDDIKYFTPNDEQDPEFGKFLREAVGKGVEAYAYTCDVGENY------VFLKD
SFSA_THEPX      AVIFLIQMDDIKYFTPNDEQDPEFGKFLREAVGKGVEAYAYTCDVGENY------VFLKD
SFSA_CALS4      AVVFLIQMDDIKYFTPNDEQDPQFGQFLREAFTKGVEVYAYTCDVGENF------INLKN
SFSA_LACP3      FLLFIVQLPDIRQMTIYRDRFPELVTAITTAKQNGVRVLAYDTMTGPDQ------ITLGN
SFSA_LACCB      FLLFIVQLPDIRQMTIYRDRFPELVTAITTAKQNGVRVLAYDTMTGPDQ------ITLGN
SFSA_ENTMU      YILFIAQFEHLHQATIHEQMQPELATAFRFAQQAGVQVIVYNCQVTEKQ------VVLKQ
SFSA_METS3      VVFFLIQHPAGNDFRPNWENDPKFSQTLVEAENAGVEILVYKCNNTLEG------IELVP
SFSA_ALKCK      AVLFVSQHSNISTVEMESSIDADFAKAIKEANDKGVFISAVSTELSKQN------ICLKN
SFSA_ALKHC      AILLLAQREDVTEIRPAYHIDPHFSAALQEAEKCGVRLLGHTSKVTLEG------IELGK
SFSA_CHLSY      AVVFIIQRSRGCAFAPDVTVDPAFSRSLREARSVGVEIYAYRCPVDPSG------ITLGQ
SFSA_CHLAA      AVVFIIQRSRGCAFAPDVTVDPAFSRSLREARSVGVEIYAYRCPVDPSG------ITLGQ
SFSA_CHLAD      AVVFIIQRSQGVAFAPDETIDRAFSRALRTARALGVEIYAYLCPVTPTG------ITLGH
SFSA_MOOTA      AAVFIIQREDAISLAPNEVTDPCFSSTIREAAAAGVEIYAYRCHIDP--------VTVSL
SFSA_SYMTH      AVCFITQRDDAQAFGPWDEIDPFFGETLRKVARAGVEIRAFVTHVTPEG------AVLGG
SFSA_AERPE      LMAFVALRPDIRVFAPNYRVDRRFASLACTLLRRGLVGMVGIRVSIDLEPG-VVRIRPVA
                                                   .                        

SFSA_NOSS1      LAKLVI----------------
SFSA_TRIV2      LAKLVI----------------
SFSA_NOSP7      LAKLKI----------------
SFSA_CYAP4      LADLVL----------------
SFSA_SYNE7      VAPLQL----------------
SFSA_SYNP6      VAPLQL----------------
SFSA_ACAM1      LATVEESSLTR-----------
SFSA_CROS5      LADLKF----------------
SFSA_RIPO1      LAEFLTKL--------------
SFSA_MICAN      LAELQL----------------
SFSA_SYNP2      LAPWESTEISGVG---------
SFSA_SYNY3      MAELVV----------------
SFSA_TRIEI      IAEFIN----------------
SFSA_GLOVI      TASILLA---------------
SFSA_THEVB      TAKLLL----------------
SFSA_SYNJB      LAKIVV----------------
SFSA_SYNJA      LAKIVA----------------
SFSA_PROMA      TKPFLKGENF------------
SFSA_PROM4      MRPFRETQTIFPLP--------
SFSA_PROM1      TRPLKSSR--------------
SFSA_PROMT      IRPFQKSRENKQF---------
SFSA_PROM3      LRPTKTTQS-------------
SFSA_PROMM      LRPTKTTQS-------------
SFSA_SYNS3      VRTVCPRL--------------
SFSA_SYNSC      TRLVDLG---------------
SFSA_PARMW      IRPLKQL---------------
SFSA_SYNS9      LRPLKKFQNL------------
SFSA_SYNPW      TRPAQGQQPSAAL---------
SFSA_SYNR3      VLPVQRTESG------------
SFSA_PROMS      IKPLK-----------------
SFSA_PROM0      IKPLK-----------------
SFSA_PROM2      IKPLK-----------------
SFSA_PROM9      IKPLK-----------------
SFSA_PROM5      FKPLKLDG--------------
SFSA_PROMP      FKPLKLN---------------
SFSA_ECO8A      SLPVTL----------------
SFSA_ECOHS      SLPVTL----------------
SFSA_ECOSE      SLPVTL----------------
SFSA_ECOLI      SLPVTL----------------
SFSA_ECODH      SLPVTL----------------
SFSA_ECOBW      SLPVTL----------------
SFSA_ECOLC      SLPVTL----------------
SFSA_ECO55      SLPVTL----------------
SFSA_ECO5E      SLPVTL----------------
SFSA_ECO57      SLPVTL----------------
SFSA_ECO24      SLPVTL----------------
SFSA_SHIDS      SLPVTL----------------
SFSA_SHIBS      SLPVTL----------------
SFSA_SHISS      SLSVTL----------------
SFSA_SHIB3      SLPVTL----------------
SFSA_SHIFL      SLPVTL----------------
SFSA_SHIF8      SLPVTL----------------
SFSA_ECOSM      SLPVTL----------------
SFSA_ECO7I      SLPVTL----------------
SFSA_ECOUT      SLPVTL----------------
SFSA_ECO27      SLPVTL----------------
SFSA_ECO81      SLPVTL----------------
SFSA_ECOK1      SLPVTL----------------
SFSA_ECO45      SLPVTL----------------
SFSA_ECOL6      SLPVTL----------------
SFSA_ECOL5      SLPVTL----------------
SFSA_ECOLU      SLPVTL----------------
SFSA_ESCF3      LLPITL----------------
SFSA_CITK8      PLPMTL----------------
SFSA_SALPA      PVPITL----------------
SFSA_SALPK      PVPITL----------------
SFSA_SALCH      PVPITL----------------
SFSA_SALA4      PVPITL----------------
SFSA_SALG2      PVPITL----------------
SFSA_SALDC      PVPITL----------------
SFSA_SALEP      PVPITL----------------
SFSA_SALHS      PVPITL----------------
SFSA_SALNS      PVPITL----------------
SFSA_SALPB      PVPITL----------------
SFSA_SALSV      PVPITL----------------
SFSA_SALTY      PVPITL----------------
SFSA_SALTI      PVPITL----------------
SFSA_SALAR      SVPIML----------------
SFSA_KLEP3      PIAVVLNPGK------------
SFSA_KLEP7      PIAVVLNPGK------------
SFSA_ENT38      TLPVVL----------------
SFSA_CROS8      PLPVRL----------------
SFSA_PECAS      KLPLLG----------------
SFSA_PECCP      KLPLLG----------------
SFSA_YERPE      RLPLLLDEMLSSENAE------
SFSA_YERPP      RLPLLLDEMLSSENAE------
SFSA_YERPA      RLPLLLDEMLSSENAE------
SFSA_YERPN      RLPLLLDEMLSSENAE------
SFSA_YERPS      RLPLLQDEMLSSENAE------
SFSA_YERP3      RLPLLLDEMLSSENAE------
SFSA_YERE8      RLPLLLDETPNS----------
SFSA_PHOLL      KLTFLLK---------------
SFSA_SERP5      KLPFFID---------------
SFSA_EDWI9      PLPVTV----------------
SFSA_SODGM      PLPIIIS---------------
SFSA_ACTP2      MNLQFSCEI-------------
SFSA_ACTP7      MNLQFSCEI-------------
SFSA_ACTPJ      MNLQFSCEI-------------
SFSA_ACTSZ      LSLTGKVPFIE-----------
SFSA_MANSM      LSLAEVVPLCFN----------
SFSA_HAEI8      LSLTESVPYIK-----------
SFSA_HAEIE      LSLTESVPYIK-----------
SFSA_HAEIG      LSLTESVPYIK-----------
SFSA_HAEIN      LSLTESVSYIK-----------
SFSA_PASMU      LSLTHCVPYIGKK---------
SFSA_HAES1      LYLTNLVNYLE-----------
SFSA_HISS2      LYLTNLVSYLE-----------
SFSA_PSYIN      -CLEE-----------------
SFSA_AERHH      FIPFESCHLLPEGSE-------
SFSA_AERS4      FIPFESCHLLPEGSE-------
SFSA_ALIF1      KLPFSI----------------
SFSA_ALIFM      KLPFSI----------------
SFSA_ALISL      KLPFSI----------------
SFSA_PHOPR      CMNFNQ----------------
SFSA_VIBCB      AIEFIN----------------
SFSA_VIBPA      AIDFIN----------------
SFSA_VIBA3      AVEFINS---------------
SFSA_VIBVU      AIAFNNS---------------
SFSA_VIBVY      AIAFNNS---------------
SFSA_VIBCH      EVKFAHQVTKN-----------
SFSA_VIBC3      EVKFAYQVTKN-----------
SFSA_PROMH      QLPFISKG--------------
SFSA_COLP3      KLVEKIPFIER-----------
SFSA_PSET1      ILKEKLPFI-------------
SFSA_IDILO      PVPVSL----------------
SFSA_SHEB8      ACVVRV----------------
SFSA_SHEB2      ACVVRV----------------
SFSA_SHEB5      ACVVRV----------------
SFSA_SHEB9      ACDVRV----------------
SFSA_SHEPC      ACPVRV----------------
SFSA_SHESW      ACPVRV----------------
SFSA_SHESM      SCPVRV----------------
SFSA_SHESR      SCPVRV----------------
SFSA_SHESA      ACPVRV----------------
SFSA_SHEON      SCPVRV----------------
SFSA_SHEDO      SCPVIT----------------
SFSA_SHEFN      ACKVML----------------
SFSA_SHEHH      SCPVRL----------------
SFSA_SHEPA      SCPVRL----------------
SFSA_SHEPW      SCPVKL----------------
SFSA_SHESH      SCPVKL----------------
SFSA_SHEWM      SCPVKL----------------
SFSA_SHELP      SCPVKL----------------
SFSA_SHEAM      PIPFHPDAG-------------
SFSA_HAHCH      KLEVTPFDSEAF----------
SFSA_ALTMD      TLPLIL----------------
SFSA_PSEA6      RLPMIV----------------
SFSA_MARN8      EVPVSLEP--------------
SFSA_MARMS      SVPVVMPTLLD-----------
SFSA_AZOVD      RLEVCL----------------
SFSA_PSEMY      RLDVLT----------------
SFSA_PSEAE      RLPVRL----------------
SFSA_PSEA8      RLPVRL----------------
SFSA_PSEAB      RLPVRL----------------
SFSA_PSEA7      RLPVRL----------------
SFSA_PSEP1      RLPVLLTP--------------
SFSA_PSEPK      RLPVLLTP--------------
SFSA_PSEPG      RLPVLLNP--------------
SFSA_PSEPW      PLPVLLNP--------------
SFSA_PSEE4      PLPVLLNP--------------
SFSA_PSEF5      RLEVLLGD--------------
SFSA_PSEFS      RLDVLLD---------------
SFSA_PSEPF      RLDVLLNG--------------
SFSA_PSE14      RLQVHWLD--------------
SFSA_PSEU2      RLQVHGLD--------------
SFSA_PSESM      HLEVHWPD--------------
SFSA_SACD2      KLKVV-----------------
SFSA_TERTT      LLPVVL----------------
SFSA_ALCBS      PLPLDL----------------
SFSA_ACIF2      AEPLLF----------------
SFSA_ACIF5      AEPLLF----------------
SFSA_RHIME      PIVVDEPVPAVL----------
SFSA_SINMW      PMMVDEAVPAVL----------
SFSA_AGRFC      TVKMDEWRPAVL----------
SFSA_AGRRK      LIPIDEPGIAALNTKYKISAEG
SFSA_AGRVS      GVPVRLTV--------------
SFSA_BRUAB      LVPIEDMRRIE-----------
SFSA_BRUSI      LVPIEDMRRIE-----------
SFSA_BRUC2      LVPIEDMRRIE-----------
SFSA_BRUA2      LVPIEDMRRIE-----------
SFSA_BRUA1      LVPIEDMRRIE-----------
SFSA_BRUO2      LVPIEDMRRIE-----------
SFSA_BRUSU      LVPIEDMRRIE-----------
SFSA_BRUME      LVPIEDMRRIE-----------
SFSA_BRUMB      LVPIEDMRRIE-----------
SFSA_BRUA4      LVPIE-----------------
SFSA_CHESB      LIDLDF----------------
SFSA_BARHE      QVKIENRK--------------
SFSA_BARQU      RVKIEND---------------
SFSA_BART1      RVKIENRRNND-----------
SFSA_DINSH      ALPVDPAAQAPQNED-------
SFSA_JANSC      PLPVDPSPQARD----------
SFSA_ROSDO      AIPIRL----------------
SFSA_RUEPO      ML--------------------
SFSA_RUEST      ILPS------------------
SFSA_AZOC5      TIPMLG----------------
SFSA_XANP2      IIPMTG----------------
SFSA_RHOCS      TLRLSA----------------
SFSA_MAGSA      PLTMDLTERI------------
SFSA_RHORT      ALPLIAP---------------
SFSA_CAUVC      RILWSHAHLTAI----------
SFSA_CAUVN      RILWSHAHLTAI----------
SFSA_CAUSK      NLPWRDAPAI------------
SFSA_PHEZH      PLPWDTSGTGRPA---------
SFSA_METC4      PVPILTPGATVQPARTSG----
SFSA_METEP      PVPILTPGATLQPARTSG----
SFSA_METPB      PVQILTSPASPAGSGTS-----
SFSA_METRJ      EIPVITPP--------------
SFSA_METNO      EIPIVTA---------------
SFSA_METS4      EIPMLPA---------------
SFSA_MARMM      PMRVELSQ--------------
SFSA_NITOC      SLPIHL----------------
SFSA_CHRSD      ALPVSLERRLASATPLSD----
SFSA_MAGMM      PLSYTLG---------------
SFSA_ALKEH      ELPVHCP---------------
SFSA_HALHL      ALPVHYQEEP------------
SFSA_THISH      VLDVDLSRAG------------
SFSA_CITBB      ALPVLL----------------
SFSA_GEOSM      ALPVLL----------------
SFSA_GEOMG      RLPVIL----------------
SFSA_GEOSL      RLPVLAGE--------------
SFSA_PELPD      RLPVIL----------------
SFSA_GEODF      RLPVIL----------------
SFSA_GEOUR      KLSVRM----------------
SFSA_SYNC1      RLPVWLD---------------
SFSA_DESPS      SNSPHLPQR-------------
SFSA_BDEBA      TVLPLKM---------------
SFSA_PELUB      KIKIINA---------------
SFSA_DESVH      VLPLTRCR--------------
SFSA_DESVV      VLPLTRCR--------------
SFSA_OLEA2      LLPVVPPPGV------------
SFSA_MARSD      KLPLAACR--------------
SFSA_LAWIP      ILPLLSE---------------
SFSA_SYNFM      RLKVVGH---------------
SFSA_ALKMQ      NDELEIF---------------
SFSA_NATTJ      CQRLPVTTQREVE---------
SFSA_ACET2      VREIPVIIK-------------
SFSA_CARHZ      DREMEVVL--------------
SFSA_DESRM      KKYIPVQL--------------
SFSA_ARCFU      PDLKVVI---------------
SFSA_PYRFU      GELGVEI---------------
SFSA_AQUAE      VFFT------------------
SFSA_THEM4      KRE--IQLIFDG----------
SFSA_METST      KKDRILSIKFKERNK-------
SFSA_THEP1      KLSICEEV--------------
SFSA_THESQ      KLSICEEV--------------
SFSA_THEMA      KLSICEEV--------------
SFSA_THENN      NLPICEEV--------------
SFSA_METTH      PLRRIAVRWPGESP--------
SFSA_METBU      MVPLCTEEYNSI----------
SFSA_THEAC      SIGLCADVGHGTNGRL------
SFSA_THEVO      DI-LTFDGDDKS----------
SFSA_PICTO      EISMCVD---------------
SFSA_SULAC      DIQLCPDAFNYSH---------
SFSA_SULTO      EIPVCHQILEKSTNFSLP----
SFSA_SULIA      DIPLCKTNLT------------
SFSA_SULIK      DIPLCKTNLT------------
SFSA_SULIM      DIPLCKTNLT------------
SFSA_SULIL      DIPLCKTNLT------------
SFSA_SACS2      DIPLCKTNLT------------
SFSA_PYRAE      SELPVDLSPRDF----------
SFSA_PYRAR      GELPVDLTPPF-----------
SFSA_PYRIL      EELPIDLLAL------------
SFSA_PYRNV      EKLPIDLQL-------------
SFSA_PYRCJ      GELPVKLR--------------
SFSA_CALMQ      GRVNVIL---------------
SFSA_CLOB8      YVDVIL----------------
SFSA_RUMCH      QVEVRL----------------
SFSA_DESHD      FVTVKLVEG-------------
SFSA_DESHY      FVTVKLVEG-------------
SFSA_ALKOO      RVDIDYRA--------------
SFSA_CLOB6      PVSIEI----------------
SFSA_CLOBJ      PVSIEI----------------
SFSA_CLOBL      PVSIEI----------------
SFSA_CLOBK      PVSIEI----------------
SFSA_CLOBM      PVSIEI----------------
SFSA_CLOB1      PISIEI----------------
SFSA_CLOBH      PISIEI----------------
SFSA_CLOTE      EVKVIL----------------
SFSA_CLOK5      EIKVQL----------------
SFSA_CLOK1      EIKVQL----------------
SFSA_CLOAB      SVKIVL----------------
SFSA_CLOP1      PVEIVL----------------
SFSA_CLOPS      PVEIVL----------------
SFSA_CLOPE      SVEIVL----------------
SFSA_CLONN      PVEIIL----------------
SFSA_CLOBA      SVELKL----------------
SFSA_THEP3      RVEVVL----------------
SFSA_THEPX      RVEVVL----------------
SFSA_CALS4      RVQVVL----------------
SFSA_LACP3      EIPFDEHLPFSEINLNSL----
SFSA_LACCB      EIPFDEHLPFSEINLNSL----
SFSA_ENTMU      AIPFDLNTVFEDPNL-------
SFSA_METS3      KSLDYDLSRK------------
SFSA_ALKCK      RIPVVV----------------
SFSA_ALKHC      PVKVDTSERKETSD--------
SFSA_CHLSY      EVPVFASFAAVPFELRQH----
SFSA_CHLAA      EVPVFASFAAVPFELRQH----
SFSA_CHLAD      EVPVFMSLSAVPSELRRRL---
SFSA_MOOTA      IAPVMVKL--------------
SFSA_SYMTH      ELPVRLAR--------------
SFSA_AERPE      TAPVQCPPLQPGR---------