CLUSTAL format seed alignment for MF_00097

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

THIE_ROSS1       -----------MVLSTLIEPLPSVQSDPIPFPSGGGIVYVITDRRAAGE--------RAL
THIE_ROSCS       -----------MAWSTLVDPSPSVLTNPIPFPSGRGIVYVITDRRAAGE--------RSL
THIE_MOOTA       ------------------------------MPQWD--LYVVITTKLGGG--------RPT
THIE_CHLAA       -------------------------MSIAHIVDWR--LYVVTDAGLSRG--------RSH
THIE_METMJ       ---------------------------------MGYDLYVVTDETIGRG--------RTH
THIE_METB6       ---------------------------------MRLDLYVITDGAIGGG--------RSH
THIE_METAR       ---------------------------------MQYDLYVVTDEGLSRG--------LTH
THIE_METHJ       ---------------------------------MDCGLYIITDEILAPG--------CSH
THIE_CHLTE       ------------------------------MTLPRRVLCVITDEH------------SNP
THIE_CHLPD       ------------------------------MIPAKPFLCVITDEQC-----------SSP
THIE_CHLL3       -----------------------------MNSPHSPILCVITDED------------TSP
THIE_CHLPM       -----------------------------MMFPSRPMLCVITDEE------------LPP
THIE_ALKCK       --------------------------------MKPFRLYAITGEEFHPG--------RDV
THIE_ALKHC       --------------------------------MRDFRLYAITGEEFHPD--------RSL
THIE_PELTS       -----------------------MVRRRGLSGLLEADIYGITAWEYSLG--------RSN
THIE_LAWIP       -----------------------MAYILPGSS-LDADLYAITDDALSFN--------RSV
THIE_CALS8       ---------------------MSLSKEEKLQLFKSYNIYGLTAEKFSNG--------RSN
THIE_CLOTE       ----------------------------MHNKNLDCTLYLVTDRDILKG--------RDL
THIE_ALKOO       ---------------------------MKYNHTVDYGLYLVSDRDVLKG--------RDF
THIE_CLOB8       -----------------------------MKPKIDYSIYLVTDRDLMST--------ETL
THIE_CLOD6       -------------------------MIDKESLKKCLKLYLVTDSEMLKG--------RDF
THIE_CLOAB       ------------------------------MKNVDYKLYLVTDRKVLKE--------RDL
THIE_ALKMQ       ---------------------------MSPIVKTDYSLYLVTDRSLLNG--------KDL
THIE_METS3       ------------------------------MNNLDLSLYLVTNNSEDEE--------K-F
THIE_FUSNN       ------------------------------MDLKDCKIYLVTDEKACNG--------KDF
THIE_CLOB1       -------------------------------MEINYELYLITDRRFLKG--------RQL
THIE_CLOBH       -------------------------------MEINYELYLITDRRFLKG--------RQL
THIE_CLOBL       -------------------------------MEINYELYLITDRRFLKG--------RQL
THIE_CLOBK       -------------------------------MEINYELYLITDRRFLKG--------RQL
THIE_CLOBM       -------------------------------MEINYGLYLITDRRFLKG--------RQL
THIE_CALS4       ------------------------------MKRIDFTLYAITDRSFIKG--------MDI
THIE2_STRPN      ------------------------------MNREALRLYLVTNRYQDSV--------ESF
THIE2_STRR6      ------------------------------MNREALRLYLVTNRYQDSV--------ESF
THIE_LACP3       ------------------------------MNATDLKLYLVTHRYDDNE--------ATF
THIE_ENTFA       -------------------------------MREKLKVYLVTGRYDFSD--------TEF
THIE_CAMJ8       -----------------------------MKNKLDLSLYLVASQGNKSE--------ECF
THIE_CAMJJ       -----------------------------MKNKLDLSLYLVASQGNKSE--------ECF
THIE_CAMJR       -----------------------------MKNKLDLSLYLVATKGNKSE--------ECF
THIE_CAMJE       -----------------------------MKNKLDLSLYLVATKGSKSE--------ECF
THIE_DESHY       -------------------------------MAVDYSLYLVTDRILVGP--------KDF
THIE_SYNWW       ------------------------------MVNSDYSLYLVTDRSLLQG--------RSL
THIE_NATPD       -------------------------------MTQDFGVYLVTGAEHSAG--------RST
THIE_HALWD       -------------------------------MNTSMQTYLVTQEDRSAG--------RST
THIE_HALMA       --------------------------------MVDWDVYLVTQASLSAG--------RTT
THIE_STRAW       ----------------MPDTA----RDRLAD---ARVYLCTDARRRQ----------GDL
THIE_STRCO       ----------------MPDTAPTAARARLAD---ARLYLCTDARRSQ----------GDL
THIE_ACIC1       ------------------------MKASLAD---ARLYLCVDSRRRQ----------GDL
THIE_THEFY       ----------------MDETL----RKRLES---ARLYLCTDARADR----------GDL
THIE_SACEN       ----------------MPGLDGFGIRARLEE---ALLYLCTDARTER----------GDL
THIE_MYCTA       -----------------------MHESRLAS---ARLYLCTDARRER----------GDL
THIE_MYCBO       -----------------------MHESRLAS---ARLYLCTDARRER----------GDL
THIE_MYCTU       -----------------------MHESRLAS---ARLYLCTDARRER----------GDL
THIE_MYCBP       -----------------------MHESRLAS---ARLYLCTDARRER----------GDL
THIE_MYCPA       ------------------------MHQRLATLAAARLYLCTDARRER----------GDL
THIE_MYCA1       ------------------------MHQRLATLAAARLYLCTDARRER----------GDL
THIE_MYCUA       ------------------------MHSRLAT---ARLYLCTDARRER----------GDL
THIE_MYCLE       -------------MQEPHRQPAICLSTRLAK---ARLYLCTDARRER----------GDL
THIE_MYCSS       -----------------MREPLDPLGPALAQ---ASLYLCTDARRER----------GDL
THIE_MYCSK       -----------------MREPLDPLGPALAQ---ASLYLCTDARRER----------GDL
THIE_MYCSJ       -----------------MREPLDPLGPALAQ---ASLYLCTDARRER----------GDL
THIE_MYCS2       -----------------MDQAVELPVQRLQR---ASLYLCTDARRER----------GDL
THIE_MYCVP       ----------------------MRESRKLDS---AALYLCTDARRER----------GDL
THIE_MYCGI       ------MWSRSSLRRLTATVSTVPESPSLQG---ARLYLCTDARRER----------GDL
THIE_NOCFA       -------------MHPSHPKRPLPPRDRLAT---ARLYLCTDARREK----------GDL
THIE_ARTS2       ----------------------MTEQALLTD---ARLYLCTDARTDR----------GDF
THIE_THET8       ----------------------------MLG----RLYLVVTPRPGWSL--------EAT
THIE_THET2       ----------------------------MLG----RLYLVVTPRPGWSL--------EAT
THIE_DEIGD       -------------------------MSRSLG----RLYLVATPRPDQPE--------AEF
THIE_NEIMA       ----------------------------------MTFLPLKSPLKFYAV--------VPT
THIE_NEIMB       ----------------------------------MTFPPLKSPLKFYAV--------VPT
THIE_NEIG1       ----------------------------------MTFPPLKSLLKFYAV--------VPT
THIE_SALTY       ----------------------------MYQ---PDFPTVPFRLGLYPV--------VDS
THIE_SALPB       ----------------------------MYQ---PDFPTVPFRLGLYPV--------VDS
THIE_SALCH       ----------------------------MYQ---PDFPTVPFRLGLYPV--------VDS
THIE_SALPA       ----------------------------MYQ---PDFPTVPFRLGLYPV--------VDS
THIE_SALTI       ----------------------------MYQ---PDFPTVPFRLGLYPV--------VDS
THIE_CITK8       ----------------------------MYQ---PDFPAVPFRLGLYPV--------VDS
THIE_SHIF8       ----------------------------MYQ---PDFPPVPFRLGLYPV--------VDS
THIE_SHIFL       ----------------------------MYQ---PDFPPVPFRLGLYPV--------VDS
THIE_ECOHS       ----------------------------MYQ---PDFPPVPFRLGLYPV--------VDS
THIE_SHISS       ----------------------------MYQ---PDFPPVPFRLGLYPV--------VDS
THIE_ECOLI       ----------------------------MYQ---PDFPPVPFRSGLYPV--------VDS
THIE_ECO24       ----------------------------MYQ---PDFPPVPFRSGLYPV--------VDS
THIE_ECOLC       ----------------------------MYQ---PDFPPVPFRSGLYPV--------VDS
THIE_SHIBS       ----------------------------MYQ---PDFPPVPFRLGLYPV--------VDS
THIE_ECO57       ----------------------------MYQ---PDFPPVPFRLGLYPV--------VDS
THIE_SHIDS       ----------------------------MYQ---PDFPPVPFRLGLYPV--------VDS
THIE_ECOUT       ----------------------------MYQ---PEFPPVPFRLGLYPV--------VDS
THIE_ECOK1       ----------------------------MYQ---PEFPPVPFRLGLYPV--------VDS
THIE_ECOL5       ----------------------------MYQ---PEFPPVPFRLGLYPV--------VDS
THIE_ECOL6       ----------------------------MYQ---PEFPPVPFRLGLYPV--------VDS
THIE_SALAR       ----------------------------MYQ---PDFPPVPLRLGLYPV--------VDS
THIE_KLEP7       ----------------------------MYQ---PDFPPVPFRLGLYPV--------VDS
THIE_ENT38       ----------------------------MYQ---PDFPPVPFRLGLYPV--------VDS
THIE_CROS8       -----------------------------MT---PLFAPVPHRLGLYPV--------VDS
THIE_SERP5       ----------------------------MTDI-TTPFPATPHKLGLYPV--------VDS
THIE_PECAS       ----------------------------MTD--STPFAPTAQRLGLYPV--------VDS
THIE_YERPA       ----------------------------MAT---PGFPSTEQRLGLYPV--------VDS
THIE_YERPE       ----------------------------MAT---PGFPSTEQRLGLYPV--------VDS
THIE_YERPN       ----------------------------MAT---PGFPSTEQRLGLYPV--------VDS
THIE_YERPP       ----------------------------MAT---PGFPSTEQRLGLYPV--------VDS
THIE_YERPS       ----------------------------MAT---PGFPSTEQRLGLYPV--------VDS
THIE_YERP3       ----------------------------MAT---PGFPSTEQRLGLYPV--------VDS
THIE_PHOLL       -------------------------MNNLPN---APFAPTEHRLGLYPV--------VDS
THIE_RHIEC       ----------------------------------------MRLDPFYLI--------VDS
THIE_KORVE       ------------------------MASGLKLPRLYAIVDADCFGPEPSL--------ATL
THIE_AGRFC       ------------------------------MNKVDYRLNALVDASLADV--------APL
THIE_SALAI       -------------------------------MSSLGRLHLITDNRPGQD--------PLA
THIE_SALTO       -------------------------------MSSLGRLHLITDARAGRN--------PLT
THIE_SALRD       ------------------MENTSTNGEPARAEKSIGRLHVLTDFHLQQD--------RSH
THIE_MYXXD       -------------------------MNAPSRPHLPRGPYLLCDDSVLPE--------ISL
THIE_ANADE       ------------------------MPVSEASVSAGRRARLGGLYVIVGG--------ADP
THIE_BACFN       ------------------------------------MLSLQFITHQTEN--------YSY
THIE_BACFR       ------------------------------------MLSLQFITHQTEN--------YSY
THIE_BACTN       ------------------------------------MVSLQFITHQTDR--------YTY
THIE_PHOV8       --------------------------------MEDKTVELQFITHFTDT--------YSY
THIE_FLAJ1       -----------------------------------MYNKLQYISQGNTI--------EDQ
THIE_FLAPJ       -----------------------------------MYNKLQYISQGKTI--------EEQ
THIE_COREF       -------------------------------MRPTPDLRCYFITGHGSH--------EHI
THIE_CORJK       -------------------------------MSASLDLRCYLVTG-APH--------EKV
THIE_VIBCB       --------------------------------MNAYRLYLVTDDQ-QDL--------ATL
THIE_VIBPA       --------------------------------MNAYRLYLVTDDQ-QDL--------PTL
THIE_RHOFT       --------------------MVGASTLAHDVRLQALRLYLVTDQFCAGG--------RTL
THIE_CHLCV       ------------------------------MEEDFFKLILITDRQNIPM--------EEY
THIE_CHLAB       ------------------------------MEENFFKLILITNKQQISV--------EEY
THIE_AZOC5       -----------------------------MPHPFDLSLYLVTDRRLTAE--------RGL
THIE_PSYWF       -------------------------MNKHNKSADALSLYLVTDSALCAD--------KGL
THIE_KINRD       ---------------------------MSPRPAFDPTLYLVTDTGLCGP--------RGV
THIE_PYRHO       ----------------------------MNFKEKLKLYIITDRRL------------KPE
THIE_PYRAB       ----------------------------MGFREKLKLYVITDRRL------------KPE
THIE_PYRFU       ----------------------------MNLRNKLKLYVITDRRL------------KPE
THIE_METMP       ----------------------------MKFKDKLKFYVITDSNY------------SDE
THIE_METM5       ----------------------------MKFKDKLKFYVITDSNY------------SDE
THIE_METM7       ----------------------------MKFKDKLKFYVITDNNY------------SNE
THIE_METVS       ----------------------------MTFKNKLKFYVITDRKY------------SCE
THIE_ARCFU       ---------------------------MSRLEDYLSVYFITDSEFG-----------RTH
THIE_CALMQ       ------------------------------MRLPKGIYGITDDSYNV----------KNH
THIE1_AQUAE      --------------------------------MNLTIYLITDDKYFKD---------RDL
THIE_THEAC       --------------------------MKLEGRRIKGLYLVTEDYSRKN-----------F
THIE_THEVO       ----------------------------MNEKKLRGLYLVTYDYYGAE-----------F
THIE_PICTO       -------------------------------MKLSGLYLVTKDYYNGN-----------F
THIE_PSEP1       -------------------------------MKLRGLYAITDSQLLA----------GRF
THIE_PSEPK       -------------------------------MKLRGLYAITDSQLLA----------GRF
THIE_PSEPG       -------------------------------MKLRGLYAITDSQLLA----------GRF
THIE_PSEE4       -------------------------------MTLRGLYAITDSQLLA----------GRF
THIE_PSEF5       -------------------------------MKLRGLYAITDSQLLA----------GKF
THIE_PSEPF       -------------------------------MKLRGLYAITDSQLLA----------GKF
THIE_PSE14       -------------------------------MKLRGLYAITDSQLLS----------GKF
THIE_PSEU2       -------------------------------MKLRGLYAITDSQLLS----------GKF
THIE_PSESM       -------------------------------MKLRGLYAITDSQLLT----------GKF
THIE_PSEAB       -------------------------------MKLRGLYAITDSQLLDD---------GRL
THIE_PSEAE       -------------------------------MKLRGLYAITDSQLLDD---------GRL
THIE_PSEA7       -------------------------------MKLRGLYAITDSQLLDD---------GRL
THIE_PSEU5       ---------------------------MKESSRLRGLYAITDSKLLAD---------GRL
THIE_PSEMY       -----------------------------MTAALRGLYAITDTPLLAG---------GKL
THIE_MARN8       -------------------------MGTVRSQIRPGLYAITDNRLTPA---------DTL
THIE_SACD2       -----------------------------MPHNKHTVYAITDATLMPTT--------ASL
THIE_ALCBS       ----------------------------MPLHRLHGLYAITDPALTPD---------EHL
THIE_NITOC       -----------------------------MSSSIRGLYAIADTHLLPR---------QDL
THIE_HALHL       --------------------------MNKQPSQLAGVYAVTQP--RPD-----------L
THIE_NITEU       ---------------------MVPAAEPMKQGGVSGLYAITPDMADTG----------RL
THIE_NITEC       -----------------------MIDPPMDRIKVSGLYAITPDIENID----------RL
THIE_NITMU       --------------MRTVSRNEIKRCSAAPRREITGLYAITPDTGDTS----------HL
THIE_METCA       -----------------------MKNSMYLPFPSKGLYAITPDRLQGD----------AL
THIE_AROAE       ----------------------------MPDTRLRGLYLITPDSPDTT----------TL
THIE_AZOSB       -----------------------------MGERIRGLYLVTPDAADSA----------TL
THIE_DECAR       ----------------------------MATNKLRGLYAITPDRADGA----------RL
THIE_THIDA       -----------------------------MRTFPGGVYALTRETPDTE----------RL
THIE_METFK       -------------------------MTRHSLPPIQGLYAITPDETDTS----------RL
THIE_CHRVO       -----------------------------MPPRVEGLYAVTPDGLDDA----------RL
THIE_BORPA       ---------------------------MKTLRFPAGLYGITPEWDDTD----------RL
THIE_BORPE       ---------------------------MKTLRFPAGLYGITPEWDDTD----------RL
THIE_BORBR       ---------------------------MKTLRFPAGLYGITPEWDDTD----------RL
THIE_BORA1       ---------------------------MNTLRFPAGLYGVTPEWDDTS----------RL
THIE_XANCP       ---------------------------MPTLQNARGVYLITPDTRDTA----------QL
THIE_XANC8       ---------------------------MPTLQNARGVYLITPDTRDTA----------QL
THIE_XANAC       ---------------------------MPNRPNVRGVYLITPDEPNTQ----------RL
THIE_XYLFT       MEVSSIGSFQEHIDKTTDIVTLHPLLRNPIMPQPRGIYLITPDETDTA----------RL
THIE_XYLFA       MEVSRIGSFQEHIDKTTGIVTPHPLLRKPLMSQPRGIYLITPDETDTA----------RL
THIE_HYPNA       ------------------------MTDTAQPRPRTRLYLITPPQIGDV---------SAF
THIE_ERYLH       ------------------------MAETEIP---TQLYLISPLDVR-----------GGF
THIE_WOLSU       ----------------------------MQDMRLQGLYGISESGWYKRP--------HEA
THIE_METAC       ---MNQKNSNPKNPPR-----------KISLLKQIDFYLVTDSGLSKK----------GT
THIE_METMA       ---MEKKNCNPKETSSQKASDKNHLTLKNSLLKDIDFYLVTDSGLSKK----------GT
THIE_METBF       ---MKQKGFSRK----------------SSLLKEIDFYLVTDSGLSMK----------GT
THIE_CLOPE       ---MSNKD-------------------------YKKLYLVTDYRIPFN----------EL
THIE_CLOP1       ---MINKD-------------------------YKKLYLVTDYRIPFN----------EL
THIE_CLOPS       ---MSNKD-------------------------YKKLYLVTDYRIPFN----------EL
THIE_GEOKA       ----------------------MVRIASGEMKERLAVYFIMGSQNSE----------RPA
THIE_GEOTN       ----------------------MARITSEEMKERLAVYFIMGSQNSE----------RPA
THIE_BACAH       ----------------------MSRISKAEMSKLLSVYFIMGSNNCT----------KDP
THIE_BACAN       ----------------------MSRISKAEMSKLLSVYFIMGSNNCT----------KDP
THIE_BACHK       ----------------------MSRISKAEMSKLLSVYFIMGSNNCT----------KDP
THIE_BACCZ       ----------------------MSRISKAEMSKLLSVYFIMGSNNCT----------KDP
THIE_BACC1       ----------------------MSRISKAEMSRLLSVYFIMGSNNCT----------KDP
THIE_BACCR       ----------------------MARIEIDKMSKLLQVYFIMGSNNCT----------RDP
THIE_BACCN       ----------------------MARIETEKMSQLLQVYFIMGSNNCH----------KGP
THIE_BACVZ       ----------------------MTRISREMMKDMLSVYFIMGSNNTS----------ADP
THIE_BACSU       ----------------------MTRISREMMKELLSVYFIMGSNNTK----------ADP
THIE_BACLD       ----------------------MTRVSEEAMKDLLSVYFIMGSNNTA----------GDP
THIE_BACP2       ----------------------MTKTDQQQIKQQLSVYFIMGTANTS----------RQP
THIE_STRA5       ------------------------------MKDTLKLYFVCGTVDCS---------RKNI
THIE_STRA1       ------------------------------MKDTLKLYFVCGTVDCS---------RKNI
THIE_STRA3       ------------------------------MKDTLKLYFVCGTVDCS---------RKNI
THIE1_STRR6      ----------------------------MFHKELLKLYFICGTTTCQ---------GKNL
THIE1_STRPN      ----------------------------MFHKELLKLYFICGTTTCQ---------GKNL
THIE_STRS2       -----------------------------MNRKMLQVYFICGTSDCP---------KGKF
THIE_STAAM       ----------------------------MFNQSYLNVYFICGTSDVPS--------HRTI
THIE_STAA9       ----------------------------MFNQSYLNVYFICGTSDVPS--------HRTI
THIE_STAAN       ----------------------------MFNQSYLNVYFICGTSDVPS--------HRTI
THIE_STAA1       ----------------------------MFNQSYLNVYFICGTSDVPS--------HRTI
THIE_STAAC       ----------------------------MFNQSYLNVYFICGTSDVPS--------HRTI
THIE_STAAE       ----------------------------MFNQSYLNVYFICGTSDVPS--------HRTI
THIE_STAA2       ----------------------------MFNQSYLNVYFICGTSDVPS--------HRTI
THIE_STAA3       ----------------------------MFNQSYLNVYFICGTSDVPS--------HRTI
THIE_STAA8       ----------------------------MFNQSYLNVYFICGTSDVPS--------HRTI
THIE_STAAS       ----------------------------MFNQSYLNVYFICGTSDVPS--------HRTI
THIE_STAAW       ----------------------------MFNQSYLNVYFICGTSDVPS--------HRTI
THIE_STAAR       ----------------------------MFNQSYLNVYFICGTSDVPS--------HRTI
THIE_STAAB       ----------------------------MFNQSYLNVYFICGTSNVPS--------HRTI
THIE_STAEQ       ----------------------------MFDSKQLSVYFICGTQDIPK--------NKSI
THIE_STAES       ----------------------------MFDSKQLSVYFICGTQDIPK--------NKSI
THIE_STAHJ       ----------------------------MFNSSSLNVYFICGTQDVPE--------GKDI
THIE_STACT       ----------------------------MFQSKDLNVYFICGTQDIPE--------GRTI
THIE_STAS1       ----------------------------MFDKNNLKLYFICGTQDIES--------KTTI
THIE_OCEIH       ---------------------------MKFDKHMLRKYFIMGSQNC----------HRDP
THIE_LISIN       ------------------------------MRAELAVYFIAGTQDIV---------RGTL
THIE_LISMF       ------------------------------MRAELAVYFIAGTQDIV---------RGTL
THIE_LISMO       ------------------------------MRAELAVYFIAGTQDIV---------RGTL
THIE_LISW6       ------------------------------MKEELAVYFIAGTQDIV---------RGTL
THIE_HAEIN       ---------------------------MKNIQKILPLYFVAGTQDCRHLGE---NLSENL
THIE_HAEIG       ---------------------------MKNIQKILPLYFVAGTQDCRHLGE---NLSENL
THIE_HAEI8       ---------------------------MKNIQKILPLYFVAGTQDCRHLGE---NLSENL
THIE_HAEIE       ---------------------------MKNIQKILPLYFVAGTQDCRHLGE---NLSENL
THIE_PASMU       ---------------------------MKPVHAFMRLYFIAGTQDCLHLDG---DPAQNL
THIE_HAES1       ------------------------MQHKYDIATAMRLYFIAGSQDVTHFAS---DPADNL
THIE_ACTSZ       ---------------------------MNKIKSMLSVYFIAGSQDCRHLPG---SPVENL
THIE_MANSM       ---------------------------MNKIKSMLSVYFIAGSQDCRHLPG---EPTENL
THIE_HELPH       ----------------------------MFDANCLKLMFVAGSQDFYHIKGGKNDRINAL
THIE_HELPY       ----------------------------MFDADCLKLMFVAGSQDFYHIKGGKNDRINAL
THIE_HELPJ       ----------------------------MFDANCLKLMFVAGSQDFYHIKG---DRTNAL
THIE_LIMRD       ---------------------------MIFDPKMLQVYLVGGTQDVHNDVV-------KF
THIE_PEDPA       ---------------------------MKFNSDMLKIYFVAGTQDVANKA--------DF
THIE_LACPL       -------------------------MTLKFEPTQLRAYFVCGTQDVPGQD---------L
THIE_LEVBA       -------------------------MSVTFEPGLLRAYFVAGSQDVPGQD---------L
THIE_LATSS       --------------------------MTNIAQEILQTYLVAGTQDTGREN---------F
THIE_LACLM       ---------------------------MTKKTLDLSVYFIAGSQNFSECSL------DEA
THIE_LACLS       ---------------------------MTNKTLDLSVYFIAGAQNFSECSL------DGA
THIE_LACLA       ---------------------------MKNKILDLRAYFIAGPQDFPKLSI------DDA
                                                                             

THIE_ROSS1       TDIVSAALRGGA---HVIQLRDKD---------VPARDMVALGQALLPLTRDAG--VPLI
THIE_ROSCS       IDIVHAALRGGA---NAIQLRDKD---------VPARAMIALGEALLPLTRAAG--VPLI
THIE_MOOTA       LELVRGALAGGA---TAIQLREKE---------LPARELVELGRAIRELTRDAG--ATFI
THIE_CHLAA       RAVIEAAIVGGA---TVVQYREKH---------ASTRQMIEEALELRDLTRRAG--VPLI
THIE_METMJ       TDLARLAAAGGA---DVIQLRDKR---------LPGRDLLSAAVAIREITTDAG--ALFI
THIE_METB6       AEIARFACAGGA---DAIQLRDKA---------CGPDALCRIGREIRAITRDTG--TLFI
THIE_METAR       PELARRAIAGSA---DVIQLRDKK---------CDCDYLLRCAMEMREDCNKAG--VTFI
THIE_METHJ       IQIAKESLSGGA---KIIQLRDKR---------RNAAELYAIAQEIRSLCTQHH--ARFI
THIE_CHLTE       VELARMALQGGA---GMVQLRRKT---------ASGQELYEWAIRIQALCSEQQ--ALFI
THIE_CHLPD       VDLALMALEGGA---EMIQLRHKS---------ASGKQLFQWALDIQRLCRIHH--AQFI
THIE_CHLL3       LDMVPRALRGGA---NMIQLRRKT---------ASGRELCRLAEALIPFCRQAG--ALFI
THIE_CHLPM       VTFARQALWGGA---TILQLRNKT---------ASGRDLCRWSEAILPLTRQHN--ALFI
THIE_ALKCK       VEVMEEAIQGGV---DIIQLRDKT---------SSKKAVLEKARRLKKLAADYG--IPFI
THIE_ALKHC       QAVMEEAILGGV---DIIQLRDKK---------SHKREVLEKARVLQALAKKYD--IPLI
THIE_PELTS       IEVVAQMIEAGI---KVIQYREKE---------RPARQKYEECLKIREMTREAG--VTFI
THIE_LAWIP       IEVVKQLLDAGI---RIIQYREKN---------KSSNSMLKDCITIKKLTEEAN--ACFI
THIE_CALS8       IEVVKAMLESGI---KIIQYREKH---------KSLKEKYEECLQIRELTKQYG--ALLI
THIE_CLOTE       KKVLEEAILGGT---TLVQLREKN---------VSSKEFYEIAKDIKVITDKYN--IPLI
THIE_ALKOO       IKSLEEAILGGA---TIVQLREKE---------ASSLEFYQLALKAKALTEKYN--VPLI
THIE_CLOB8       EEAVEKAIIGGC---TLIQLREKD---------CSSLDFYNTAVRVKEITDKHN--IPLI
THIE_CLOD6       YKCLEDAISSGI---TTVQLREKN---------ASGREFLRKAMKLREITKRYG--VKFI
THIE_CLOAB       YKSIEEAIKGGV---TLVQLREKE---------MSTLDFYESALKLKKITETYK--IPLI
THIE_ALKMQ       MESIEAAIKGGV---SIVQLREKQ---------ATSAVFYETALALKKLTDQYQ--IPLI
THIE_METS3       LNIIEESLKGGV---SVVQLREKK---------AETLDFYNLALKVKEITQKYN--VPLI
THIE_FUSNN       YKCIEESIKGGV---KIVQLREKN---------ISTKDFYKKALKVKEICKNYE--VLFI
THIE_CLOB1       KKVVEDAILGGV---TIVQVREKD---------VSTREFYNVAKEVKEVTDYYK--VPII
THIE_CLOBH       KKVVEDAILGGV---TIVQVREKD---------VSTREFYNVAKEVKEVTDYYK--VPII
THIE_CLOBL       KKVVEDAILGGV---TIVQVREKD---------VSTREFYNVAKEVKEVTDYYK--VPII
THIE_CLOBK       KKVVEDAILGGV---TIVQVREKD---------VSTREFYNIAKEVKEVTDYYK--VPII
THIE_CLOBM       KKVVEDAILGGV---TIVQVREKD---------VSTREFYNVAKEVKEVTDYYK--VPII
THIE_CALS4       AEAVEIAIKNGV---TVVQLREKD---------ISSREFYEIALKVKEVTRKYN--VPLI
THIE2_STRPN      LAKVETACRSGV---TIVQLREKN---------LTTNQYYQLAKQVKEITDAYQ--VPLI
THIE2_STRR6      LAKVETACRSGV---TIVQLREKN---------LTTNQYYQLAKQVKEITDAYQ--VPLI
THIE_LACP3       LAKIAAACENSV---TMVQLREKM---------LSTRAYFELAQRVKLITDRYQ--IPLI
THIE_ENTFA       LKRIETACRSGV---TLVQLREKE---------VSTRRFYELAVKVKVVTDAYQ--IPLI
THIE_CAMJ8       LNTLENAIKGGV---SIIQLREKE---------LNAREFYKLGLKVQKLCKAYK--IPFL
THIE_CAMJJ       LNTLENAIKGGV---SIIQLREKE---------LNAREFYKLGLKVQKLCKAYK--IPFL
THIE_CAMJR       LNTLENAIKGGV---SIIQLREKE---------LNAREFYKLGLKVQKLCKSYK--IPFL
THIE_CAMJE       LNTLENAIKGGV---SIIQLREKE---------LNAREFYKLGLKVQKLCKSYK--IPFL
THIE_DESHY       LLSIRKALEGGV---TLLQLREKE---------TNSREFYDIGVKVKELAAEFG--VPLI
THIE_SYNWW       LEEVRKAVKGGV---SMVQLREKE---------AGSREFYELAQTLQTELRELG--VPLL
THIE_NATPD       AEVVEAAIRGGV---DIVQLRDKT---------ATARERYEVGTELRTLTRDAG--VPLV
THIE_HALWD       TEIVEAAIDGGI---DIVQLREKE---------TTARRRYEIGQTVRTQTAQAG--VTFL
THIE_HALMA       DEIVAEAIESGV---GVVQLREKN---------RTARERYELGQKLRELTREAD--VTFV
THIE_STRAW       AEFLDAALAGGV---DIVQLRDK---------GMEAAEELEHLQVFADACRRHG--KLLA
THIE_STRCO       PEFLDAVLAGGV---DIVQLRDK---------GMEAAEELEHLAVFADACARHG--KLLA
THIE_ACIC1       PAFLDAVLGAGV---DVVQLREK---------GLEAKEELRLLDVFAEACRRHG--ALLA
THIE_THEFY       AEFLDAALAGGV---DIVQLRDK---------TLDARDELAALEVVREACDRHG--ALLA
THIE_SACEN       AEFADAALDGGV---DIIQLRDKSAGG----APLEARHELAALEVLAEACVRHG--ALLA
THIE_MYCTA       AQFAEAALAGGV---DIIQLRDKGSPGELRFGPLQARDELAACEILADAAHRYG--ALFA
THIE_MYCBO       AQFAEAALAGGV---DIIQLRDKGSPGELRFGPLQARDELAACEILADAAHRYG--ALFA
THIE_MYCTU       AQFAEAALAGGV---DIIQLRDKGSPGELRFGPLQARDELAACEILADAAHRYG--ALFA
THIE_MYCBP       AQFAEAALAGGV---DIIQLRDKGSPGELRFGPLQARDELAACEILADAAHRYG--ALFA
THIE_MYCPA       AEFADAALAGGV---DVIQLRDKGSPGEQRFGPLEARDELAACEILADAARRHG--ALFA
THIE_MYCA1       AEFADAALAGGV---DVIQLRDKGSPGEQRFGPLEARDELAACEILADAARRHG--ALFA
THIE_MYCUA       ADFADAALAGGV---DIIQLRDKGSAGEQRFGPLEARDELAACEILADAAARHA--AMFA
THIE_MYCLE       AQFVNAALAGGV---DIVQLRDKGSVGEQQFGPLEARDALAACEIFTDATGRHD--ALFA
THIE_MYCSS       AEFADAALAGGV---DLIQLRDKGSAGERRFGPLEAREELAALEILAEAARRHG--ALLA
THIE_MYCSK       AEFADAALAGGV---DLIQLRDKGSAGERRFGPLEAREELAALEILAEAARRHG--ALLA
THIE_MYCSJ       AEFADAALAGGV---DLIQLRDKGSAGERRFGPLEAREELAALEILAEAARRRG--ALLA
THIE_MYCS2       AEFADAALAGGV---DLIQLRDKGSAGEKQFGPLEARQELEALEILADAARRHG--ALLA
THIE_MYCVP       AEFADAALAGGV---DIIQLRDKGSAGEQRFGPLEAREEIEVLATLADAARRHG--ALFA
THIE_MYCGI       ADFADAALAGGV---DIIQLRDKGSPGEKAFGPLEARAEIDALHVLAEAARRHN--ALVA
THIE_NOCFA       AKFAEAAFAGGV---DIIQLRDKGSPGEAKFGPLEAKAELGALAELKAVARRHG--GLVA
THIE_ARTS2       ADFVDAAYAGGV---DIIQLRDKG---------LEAAEELELLEVLETAARRHG--RLWS
THIE_THET8       LDRTERALAGGV---EVVQLRAKDW---------EARPTLALGERMLALARRYG--VPFF
THIE_THET2       LDRTERALAGGV---EVVQLRAKDW---------EARPTLALGERMLALARRYG--VPFF
THIE_DEIGD       LARVEAALDGGV---DTLQLRCKAGSPQ----YGEARPYIALARRVGALAQARD--VPFF
THIE_NEIMA       ADWVERMVEAGA---DTVQLRCKA---------LHGDELKREIARCVAACQGSH--TQLF
THIE_NEIMB       ADWVGRMVKAGA---DTVQLRCKA---------LHGDELKREIARCAAACQGSR--TQLF
THIE_NEIG1       ADWVGRMVKAGA---DTVQLRCKT---------LHGNELKREIARCVAACQGSR--TQLF
THIE_SALTY       VEWIERLLESGV---RTIQLRIKD---------KRDEEVEADVIAAIALGRRYN--ARLF
THIE_SALPB       VAWIERLLEAGV---RTIQLRIKD---------KRDEEVEADVIAAIALGRRYN--ARLF
THIE_SALCH       VAWIERLLEVGV---RTIQLRIKD---------KRNEEVEADVIAAIALGRRYD--ARLF
THIE_SALPA       VEWIERLLEAGV---RTIQLRIKD---------KRDEEVEADVIAAIALGRRYD--ARLF
THIE_SALTI       VAWIERLLEAGV---RTIQLRIKD---------KRDEEVEADVIAAIALGRCYD--ARLF
THIE_CITK8       VQWIERLLEAGV---RTLQLRIKD---------KRDEEVEDDVSAAIALGRRYN--ARLF
THIE_SHIF8       VQWIERLLDAGV---RTLQLRIKD---------RRDEEVEADVVAAIALGRRYN--ARLF
THIE_SHIFL       VQWIERLLDAGV---RTLQLRIKD---------RRDEEVEADVVAAIALGRRYN--ARLF
THIE_ECOHS       VQWIERLLDAGV---RTLQLRIKD---------RRDEEVEADVVAAIALGRRYN--ARLF
THIE_SHISS       VQWIERLLDAGV---RTLQLRIKD---------RRNEEVEADVVAAIALGRRYN--ARLF
THIE_ECOLI       VQWIERLLDAGV---RTLQLRIKD---------RRDEEVEADVVAAIALGRRYN--ARLF
THIE_ECO24       VQWIERLLDAGV---RTLQLRIKD---------RRDEEVEADVVAAIALGRRYN--ARLF
THIE_ECOLC       VQWIERLLDAGV---RTLQLRIKD---------RRDEEVEADVVAAIALGRRYN--ARLF
THIE_SHIBS       VQWIERLLDAGV---RTLQLRIKD---------RRDEEVEADVVAAIALGRRYN--ARLF
THIE_ECO57       VQWIERLLDAGV---RTLQLRIKD---------RRDEEVEADVVAAIALGRRYN--ARLF
THIE_SHIDS       VQWIERLLDAGV---RTLQLRIKD---------RRDEEVEADVVAAIALGRRYN--ARLF
THIE_ECOUT       VQWIERLLDAGV---RTLQLRIKD---------RRDEEVEADVVAAIALGRRYN--ARLF
THIE_ECOK1       VQWIERLLDAGV---RTLQLRIKD---------RRDEEVEADVVAAIALGRRYN--ARLF
THIE_ECOL5       VQWIERLLDAGV---RTLQLRIKD---------RRDEEVEADVVAAIALGRRYN--ARLF
THIE_ECOL6       VQWIERLLDAGV---RTLQLRIKD---------QRDEEVEADVVAAIALGRRYN--ARLF
THIE_SALAR       VAWIECLLAAGV---RTIQLRIKD---------KRDAEVEADVVAAITLGRRYD--ARLF
THIE_KLEP7       VAWIERLLEAGV---RTLQLRIKD---------RRDSEVEDDVIAAIALGRRYH--ARLF
THIE_ENT38       VVWIERLLQAGV---KTLQLRIKD---------KCDEDVEPDVANAIKLGRRYG--ARLF
THIE_CROS8       VEWVTRLLDAGV---RTLQLRIKD---------KTDAEVETDIAAAIALGQRYH--ARLF
THIE_SERP5       VEWIARLLDAGV---TTLQLRIKD---------LPDEQVEDDIAAAIALGKRYD--ARLF
THIE_PECAS       VEWIERLLGVGV---KTIQLRIKD---------RSDEQAETDVIQAIALGSRYQ--AQLF
THIE_YERPA       LLWIERLLAAGV---TTLQLRIKN---------ADDAQVEQDIVAAIELGKRYQ--ARLF
THIE_YERPE       LLWIERLLAAGV---TTLQLRIKN---------ADDAQVEQDIVAAIELGKRYQ--ARLF
THIE_YERPN       LLWIERLLAAGV---TTLQLRIKN---------ADDAQVEQDIVAAIELGKRYQ--ARLF
THIE_YERPP       LLWIERLLAAGV---TTLQLRIKN---------ADDAQVEQDIVAAIELGKRYQ--ARLF
THIE_YERPS       LLWIERLLAAGV---TTLQLRIKN---------ADDAQVEQDIVAAIELGKRYQ--ARLF
THIE_YERP3       LLWIERLLAAGV---TTLQLRIKN---------ADDAQVEQDIVAAIELGKRYQ--ARLF
THIE_PHOLL       LAWISRLLQTGV---TTIQLRIKD---------LPEDQVEEEIQQAIMLGRQYN--ARLF
THIE_RHIEC       ADWVERLVPLGV---KLVQLRIKD---------RPEPVLREEIRRAKAACAAAA--CQLI
THIE_KORVE       THFAKELVAGGV---TLLQYRNKQ----------GSAREILSHARELKRALPPE--VTLL
THIE_AGRFC       PELALAAALNGA---TILQYRDKH---------GSTREMIENARAIREAIGGTG--VPLV
THIE_SALAI       VVRAALSVARAE---LVVQVRVTD--------ETTDRQAYDLARRVTVLCARYG--ATCL
THIE_SALTO       VVQAALSVARTE---LVVQVRVAD--------DATDRQAYDLARRVIALCARYD--ATCL
THIE_SALRD       AELARLAIRGGA---DTIQFRQKH--------GGIQNKLLE-ARKVATVCADAS--TPLL
THIE_MYXXD       VDKAARLVAGGA---RLVQLRMKR--------TPI-REALAATRQVVALCRREG--ALCL
THIE_ANADE       VAQARAAIGGGA---RAIQVRMKD--------APA-GAVLEATRRILALATGR---ALVL
THIE_BACFN       LESARMALEGGC---KWIQLRMKE--------ASP-EEVEAVALQLKPLCKAK--EAILI
THIE_BACFR       LESARMALEGGC---KWIQLRMKE--------ASP-EEVEAVALQLKPLCKAK--EAILI
THIE_BACTN       FESALMALEGGC---KWIQLRMKE--------APC-EEVEAVALQLKPLCKEK--EAILL
THIE_PHOV8       YDSARMALEGGC---RWIQLRMKD--------TPV-DEVEREAIRLQGLCKDY--GATFV
THIE_FLAJ1       VRNIHQALDSGC---DWIQMRFKN--------QTE-KDSFILAEEIKLLCEKY--LASFI
THIE_FLAPJ       LLNIRKALENGC---QWIQMRFKD--------THS-DNVFTLAEAVKRMCQEY--TATFI
THIE_COREF       VDVARRAVAGGA---RTVQVRSKP--------ITA-RELYALTEAVALAVGET---AHVL
THIE_CORJK       VDVAAAAAAGGA---GVVQVRSKP--------ISV-RDLTALAVEVAAAVQKANPATRVL
THIE_VIBCB       KRVVRKAVEGGV---TMVQVREKH---------GDVRAFIERAQAVKDILKDTD--VPLI
THIE_VIBPA       KHVVRKAVEGGV---TMVQVREKH---------GDVREFIERAQAVKTILEGTG--VPLI
THIE_RHOFT       ADVVAAAVQGGV---TCVQLREKQ---------LNTRDFLAQALALKDLLAPHG--IPLV
THIE_CHLCV       LDFVSACVQSGV---TAVQLREKG---------LSHRELLSFGGALKSILDPLD--IPLI
THIE_CHLAB       LDFVCACVQSGV---TSVQLREKE---------LSYRELLGFGEALKSILDPLE--IPLI
THIE_AZOC5       LETVEEAVAGGV---TLVQLRDPE---------AKGRALAEEARALIGLLRPKG--IPLI
THIE_PSYWF       IETVLAAIDGGV---TLVQLRDKH---------ASDEALYTTACELKEAIAGR---VPLV
THIE_KINRD       PAVVRAAVAGGV---SAVQVRAKD---------GGDRERLALVRAVQDVLRGTG--VALI
THIE_PYRHO       IASVKQALEGGA---TSIQLRIKN---------APTREMYEIGKEIRKLTNEYG--ALFF
THIE_PYRAB       VKSVRQALEGGA---TSIQLRIKD---------ASTKEMYEVGKEIRRLTQEYD--ALFF
THIE_PYRFU       VESVREALEGGA---TAIQMRIKN---------APTREMYEIGKTLRQLTREYD--ALFF
THIE_METMP       VISVEESLKGGA---TSIQLRMKT---------SSTRKMIEVGNKLRKLTSEYD--ALFF
THIE_METM5       VSSVEKALKGGA---SSIQLRMKT---------SSTRKMIEVGNKLRTLTSEYD--ALFF
THIE_METM7       VVSVEEALKGGA---SSIQLRMKN---------STTREMIEVGNELRKLTLEYD--ALFF
THIE_METVS       VYSVEQALKGGA---TAVQLRMKS---------SNTREMVEVGQKIRKLTLEYD--ALFF
THIE_ARCFU       EELAEMALRAGV---RAIQFREKK---------LSTKRMYEIGKRLRALTRDYD--ALFF
THIE_CALMQ       VDAAKVFLEGGV---RIIQYRRKE---------GSIRQMLNEAKEIRKLCNQYG--AVMI
THIE1_AQUAE      FNTIEQALQGGV---TAVQYRFEN---------KTTRQMYEELVKLRELTRKYN--ADLV
THIE_THEAC       FNIIEEAIIGGV---DIVQYRDKS---------NPRSVRLDVARKVKQICNRYD--ILFF
THIE_THEVO       YEKIIDAIEGGV---DILQYRDKT---------NAYSVKLQVARKLTSIAADYG--IPFF
THIE_PICTO       FNIVEESLSAGV---NILQYRDKT---------NPYNIKIEAGRRLKNLAYKYN--VPFI
THIE_PSEP1       LSHVEAALEGGV---CLLQYRDKS---------DDAARRLREAEGLMKLCERYG--TQLL
THIE_PSEPK       LSHVEAALEGGV---CLLQYRDKT---------DDAARRLREAEGLMKLCERYG--TQLL
THIE_PSEPG       LSHVEAALDGGV---CLLQYRDKS---------DDAARRLREAEGLMKLCERYG--TQLL
THIE_PSEE4       LSHVEAALEGGV---CLLQYRDKS---------DDAGRRLREAEGLKKLCERYG--TQLI
THIE_PSEF5       LKYVEAALEGGV---TLLQYRDKS---------DDQARRLREAETLLALCERYK--TRLI
THIE_PSEPF       LSYVEAALEGGV---TLLQYRDKS---------SDEARRLREAEALRDLCERYK--TQLI
THIE_PSE14       LSYVEAALDGGV---TLLQYRDKT---------SDESRRLREATELLKLCERYK--TRLI
THIE_PSEU2       LSYVEAALDGGV---TLLQYRDKN---------SDESRRLREATELLKLCERYK--TRLI
THIE_PSESM       LSYVEAALDGGV---TLLQYRDKT---------GDDSRRLREATELLKLCERYK--TRLI
THIE_PSEAB       LPYVEAALRGGA---RLLQYRDKS---------SDQARRLREAESLRELCERYG--AQLI
THIE_PSEAE       LPYVEAALRGGA---RLLQYRDKS---------SDQARRLREAESLRELCERHG--AQLI
THIE_PSEA7       LPYVEAALRGGA---RLLQYRDKS---------CDQARRLREAASLRELCERHG--AQLI
THIE_PSEU5       LPYVEAALKGGA---RLLQYRDKT---------SDEARRLREADALQELCARHG--AQLI
THIE_PSEMY       LPYAEAALIGGA---RLLQYRDKS---------GDAVRRLDEAQALAELCQRHG--ATLI
THIE_MARN8       IVSVEAALAGGA---RLVQYRDKG---------STASERLVQARNLNSLCQGFD--VPLL
THIE_SACD2       CHRVELALRSGV---TWLQYRDKS---------SNTSKRSEQAQALKALCQTYN--AKLI
THIE_ALCBS       LPAAEAALRGGA---KLLQYRDKT---------ASPTQREYRAAQLRQLCHQYH--ALFI
THIE_NITOC       GNAVALALQGGA---SLIQYRDKS---------QEITRRYKEAESLQRICHQYQ--APLI
THIE_HALHL       QEAVAAVLRGGV---GIVQYRDKS---------EDADRRREEAGALCRLCEEYG--ALFL
THIE_NITEU       CDAVRQALAGGV---SWLQYRNKT---------ADSRLRLVQAAEIHLLCRQFQ--VPLI
THIE_NITEC       CEMAYHVLAGGV---SWLQYRNKK---------ANSRLRLMQALEIHLLCKQFQ--VPLI
THIE_NITMU       VAMTWRALAGGA---RLVQYRSKT---------LNEELHREQARSLAHLCRRFD--VPLL
THIE_METCA       LAAAESAILGGA---AVVQYRPKS---------GPASDRLSDGIRLQELCRTAG--IPLI
THIE_AROAE       VAQVERALRGQP---ALLQYRSKQ---------RDAALRLGQARQIAALCREAG--VPFI
THIE_AZOSB       LASVERVLPARP---ALLQYRNKL---------ADPLRQLDEARSLRQLCSSAG--VPLI
THIE_DECAR       LADVEAALAGGC---RVVQYRDKL---------STMPEQVARAQALRELTRRFA--ATLL
THIE_THIDA       LAEVEAALAGGV---AAVQYRDKS---------GDVAQRHAQASELAALCRRFG--VPLI
THIE_METFK       VTISEAVLAGGA---GALQYRNKR---------VSGTQASNQAGALLDLCRRFQ--TPLI
THIE_CHRVO       FALAAAALAGGA---RALQYRDKS---------GDAGRRLRQAAELQRLCRAHG--ALFI
THIE_BORPA       LAAVRAAAAGGM---TALQLRRKL---------ADERLRAAQARALAPLCRELG--VVFL
THIE_BORPE       LAAVRAAAAGGM---TALQLRRKL---------ADERLRAAQARALAPLCRELG--VVFL
THIE_BORBR       LAAVRAAAAGGM---TALQLRRKL---------ADERLRAAQARALAPLCRELG--VVFL
THIE_BORA1       LAAVRDAAAGGM---RALQLRRKH---------LSREQRLLQARALAPLCRELG--VTFI
THIE_XANCP       LACTLPLL-PHI---TWLQYRNKQ---------ADAALRLAQATALRAACTAHG--VPLI
THIE_XANC8       LACTLPLL-PHI---TWLQYRNKQ---------ADAALRLAQATALRAACTAHG--VPLI
THIE_XANAC       LLRTAPLL-GSI---TWLQYRNKQ---------ADAALRLRQAGALREACAAHG--VPLI
THIE_XYLFT       IAHTAPLL-NGI---VWLQYRNKL---------ANTALRTEQAQALLALCRPTG--IPLL
THIE_XYLFA       IARTAPLL-NGI---VWLQYRNKL---------ANTALRTEQAQALLALCRQTG--IPLL
THIE_HYPNA       RKSLEETLSAGD--VASLQLRLKGQDGM-----IDMQATQEVGAAVTAMAQEAG--VAVL
THIE_ERYLH       PQRLERALEAGRGVVTAFQFRVKG---------IDQHEAARLAEPLQAICAAHD--VAFV
THIE_WOLSU       IELLLEAIEGGM---KIFQLREKE---------GSDEEILPLARALWNHCRQKG--VLFI
THIE_METAC       LSDVREAVDAGC---KIVQYREKN---------KSTKEMIDEASEIKRICGD-R--AIFL
THIE_METMA       LSDVKESVEAGC---KIVQYREKC---------KSTGEMIDEAAEIKKICSG-R--AIFL
THIE_METBF       LSDVRDAVESGC---RIVQYREKD---------KSTKEMVEEASEIKRICSG-R--AIFL
THIE_CLOPE       LEKTKEALIGGV---SIVQYRAKN---------KKTKEMCKEAKELKKLCDEFG--ALFL
THIE_CLOP1       LEKTKEALIGGV---SIVQYRAKN---------KKTKEMCKEAKELKKLCDEFG--ALFL
THIE_CLOPS       LEKTKEALIGGV---SIVQYRAKN---------KETKEMCKEARALKKLCDEFG--ALFL
THIE_GEOKA       ADVLKEALDGGV---TLFQFREKGPGALK------GADKEALARQLQRLCRAYG--VPFI
THIE_GEOTN       EDVLKEALDGGV---TLFQFREKGSAALE------GEEKEALARQLQRLCRTYG--VPFI
THIE_BACAH       LQVLREALEGGI---TIFQFREKGEGALT------GEERICFAKELQAICKEYG--VPFI
THIE_BACAN       LQVLREALEGFI---TIFQFREKGEGALT------GEERICFAKELQAICKEYG--VPFI
THIE_BACHK       LQVLREALEGGI---TIFQFREKGEGALT------GEERICFAKELQAICKEYG--VPFI
THIE_BACCZ       LQVLREALEGGI---TIFQFREKGEGALT------GEERICFAKELQAICKEYG--VPFI
THIE_BACC1       LQILKDALEGGI---TIFQFREKGEGALT------GEERICFAKELQAICKEYG--VPFI
THIE_BACCR       LAVLKEALDGGV---TIFQFREKGEGSLI------GEDRVRFAKELQTLCNEYS--VPFI
THIE_BACCN       LQVMKEALDGGI---TLFQFREKGEGALT------GEKRVQFAKQLQALCREYR--VPFI
THIE_BACVZ       VSVVEKAIEGGA---TLFQFREKGSGSLT------GEERLLFAKRVQDVCRQAG--IPFI
THIE_BACSU       VTVVQKALKGGA---TLYQFREKGGDALT------GEARIKFAEKAQAACREAG--VPFI
THIE_BACLD       LTVIEKALKGGA---TLFQFREKGEGALK------AGDQTAFARQVQALCKQFN--VPFI
THIE_BACP2       LDVLKEAIQGGI---TMFQFREKGEGALQ------GEEKKQLARQLQVLCQEAN--VPFV
THIE_STRA5       LTVVEEALQAGI---TLFQFREKGFTALQ------GKEKIAMAKQLQILCKQYQ--VPFI
THIE_STRA1       LTVVEEALQAGI---TLFQFREKGFTALQ------GKEKIAMAKQLQILCKQYQ--VPFI
THIE_STRA3       LTVVEEALQAGI---TLFQFREKGFTALQ------GKEKIAMAKQLQILCKQYQ--VPFI
THIE1_STRR6      YTVVEEALKGGI---TLFQFREKGESALE------GLEKLELAIQIKELCKKYN--VPFI
THIE1_STRPN      YTVVEEALKGGI---TLFQFREKGEGALE------GLEKLELAIQIKELCKKYN--VPFI
THIE_STRS2       LDVLEKALQAGI---TCFQFREKGEQGLT------GADKLLLAKQVQHLCHRYQ--VPLI
THIE_STAAM       HEVLEAALKAGI---TLFQFREKGESALK------GNDKLVLAKELQHLCHQYD--VPFI
THIE_STAA9       HEVLEAALKAGI---TLFQFREKGESALK------GNDKLVLAKELQHLCHQYD--VPFI
THIE_STAAN       HEVLEAALKAGI---TLFQFREKGESALK------GNDKLVLAKELQHLCHQYD--VPFI
THIE_STAA1       HEVLEAALKAGI---TLFQFREKGESALK------GNDKLVLAKELQHLCHQYD--VPFI
THIE_STAAC       HEVLEAALKAGI---TLFQFREKGESALK------GNDKLVLAKELQHLCHQYD--VPFI
THIE_STAAE       HEVLEAALKAGI---TLFQFREKGESALK------GNDKLVLAKELQHLCHQYD--VPFI
THIE_STAA2       HEVLEAALKAGI---TLFQFREKGESALK------GNDKLVLAKELQHLCHQYD--VPFI
THIE_STAA3       HEVLEAALKAGI---TLFQFREKGESALK------GNDKLVLAKELQHLCHQYD--VPFI
THIE_STAA8       HEVLEAALKAGI---TLFQFREKGESALK------GNDKLVLAKELQHLCHQYD--VPFI
THIE_STAAS       HEVLEAALKAGI---TLFQFREKGESALK------GNDKLVLAKELQHLCHQYD--VPFI
THIE_STAAW       HEVLEAALKAGI---TLFQFREKGESALK------GNDKLVLAKELQHLCHQYD--VPFI
THIE_STAAR       HEVLEAALKAGI---TLFQFREKGESALK------GNDKLVLAKELQHLCHQYD--VPFI
THIE_STAAB       HEVLEAALKAGI---TLFQFREKGESALK------GNDKLVLAKELQHLCHQYN--VPFI
THIE_STAEQ       EQVLKEALEAGI---TLYQFREKGPNALK------GEKKKQLALKLKQLCHSYH--VPMI
THIE_STAES       EQVLKEALEAGI---TLYQFREKGPNALK------GEKKKQLALKLKQLCHSYH--VPMI
THIE_STAHJ       REILKQALEAGI---TLFQFREKGPTSLD------GVEKEHLAIDLLKLCHDYQ--VPFI
THIE_STACT       QEVLKEALEGGI---TLYQFREKGNGAKT------GQDKVALAKELQALCKSYN--VPFI
THIE_STAS1       IDVVTEALESGI---TMFQFREKGNGALI------GDEKEDLARKLLALCHDYA--VPFI
THIE_OCEIH       REILKEAASAGI---TAFQYREKGKNSLT------GTAKVELAKDLKAICHDFQ--IPFI
THIE_LISIN       PSVLEEALKAGI---TCFQYREKGAGALQ-----TASERKEMALECQQLCAKYQ--VPFI
THIE_LISMF       PGVLEEALKAGI---TCFQYREKGAGSLQ-----TASERKEMALECQQLCTKYQ--VPFI
THIE_LISMO       PSVLEEALKGGI---TCFQYREKGAGSLQ-----TASERKEMALECQKLCAKYQ--VPFI
THIE_LISW6       PSVLEEALKGGI---TCFQYREKGAGSLQ-----TASERKEMALECQKLCAKYQ--VPFI
THIE_HAEIN       LFVLKQALEGGI---TCFQFRDKGKFSLEH----TPSAQKALAINCRDLCREYG--VPFI
THIE_HAEIG       LFVLKQALEGGI---TCFQFRDKGKFSLEH----TPSAQKALAINCRDLCREYG--VPFI
THIE_HAEI8       LFVLKQALEGGI---TCFQFRDKGKFSLEH----TPSAQKALAMSCRDLCREYG--VPFI
THIE_HAEIE       LFVLKQALEGGI---TCFQFRDKGKFSLEH----TPSAQKALAMSCRDLCREYG--VPFI
THIE_PASMU       LNILQQALQSGI---TCYQFREKGKKALQ-----DPDKIKALAIQCRDLCRQYQ--VPFV
THIE_HAES1       LSVLEQALQAGI---TCYQFREKGKRALQ-----NPIAYKALAIACRNLCRKYK--VPFV
THIE_ACTSZ       LNILQQALEAGI---TCFQFREKGERSLAQ----NPQLKHRLALQCQQLCRQFN--VPFI
THIE_MANSM       LTILQRALEAGI---TCFQFREKGEQSLAC----DLQLKRRLALKCLQLCRQFQ--VPFI
THIE_HELPH       LDTLELALQSQI---TAFQFRQKGDLALQ-----DPVEIKQLALKCQKLCQKYG--TPFI
THIE_HELPY       LDTLELALQSKI---TAFQFRQKGDLALQ-----DPTQIKQLAMKCQKLCQKYG--APFI
THIE_HELPJ       LDTLELALQSKI---TAFQFRQKGDLALQ-----DPVEIKRLALECQKLCKKYG--TPFI
THIE_LIMRD       LEKVELAMKSGI---TAFQYREKG--NSKL----RPNERVDLGLELRTLCTHYG--IPLI
THIE_PEDPA       LPKVEEILQAGA---TAFQLREKGY-NSID----NPAELTELAEKCHQLTQKYH--VPLF
THIE_LACPL       NMVVQTALDAGV---TAFQYRDKG--NSQL----TTVERFALGQQLRERCAQAH--VPFI
THIE_LEVBA       RDVLAKMLAAGI---TAFQFRDKA--TSTL----TPEQRLALGRDLRAQCRVAN--VPFI
THIE_LATSS       LPILDQALQAGI---TCFQFRDKGP-NSLP----TDAMRSDYAKKAQALCRTYH--VPFI
THIE_LACLM       TQKIALIIKSGV---TVYQFRDKGTIYKE------QKQRLSIAQKLQKVSEEAG--VSFI
THIE_LACLS       TQKIALIIKSGV---TVYQFRDKGTIYKE------QKQRLSIAQKLQKVSEEAG--VSFI
THIE_LACLA       IDKISVIIKSGV---TVYQFRDKGTIYKN------KNQRLEVAKRLQEVAQKAA--VSFI
                                   * *                                       

THIE_ROSS1       VNDRVDVALAL-----DADGVHVGQDDIPAEMVRRIIGPE-RILGVSVATVEQAQRAMDA
THIE_ROSCS       VNDRVDVALAL-----DADGVHVGQDDIPADMVRRIIGPA-RILGVSVATVEQAQQAARD
THIE_MOOTA       VNDRLDIALAV-----EADGLHIGQEDLPAPVARKLLGPE-KILGVSAGTTDEARQAEVD
THIE_CHLAA       VNDRVDVALAV-----DADGVHVGQDDMPVALARRLIG-N-KLLGVSAHNLSEALQAVRD
THIE_METMJ       VNDRLDVAIAA-----GADGVHLGANDLPVGEARRIVPPG-FLIGASVGSVAAAVRAAAE
THIE_METB6       VNDRLDVALAC-----GADGVHLGQGDLRVDTARRLAPRP-FMIGVSVGNAEEAISAVVA
THIE_METAR       VNDRLDVALQS-----QADGVHIGQSDMPLKFARRVAPKG-FIIGVSAGTVEEALRAEHD
THIE_METHJ       VNDRLDIALAV-----QADGVHLGQDDLPLSAARLLAPRP-FIIGVSVGTVEEAVLAEKG
THIE_CHLTE       VNDRVDIAMAV-----HADGVHLGQQDLPASAARALLAPD-AIIGVSVSNATEAIKAAEE
THIE_CHLPD       VNDRVDIALAM-----NADGVHLGQQDLQPGEARKLLGTD-KIIGVSTSSLTEALNAERA
THIE_CHLL3       INDRADIALAT-----DADGVHLGQDDLPVAAARQLFGPG-KIIGASTSSVDEALKAERN
THIE_CHLPM       VNDRLDIALAT-----GADGVHLGQDDLPATVARKLLGPD-RIIGVSTGTREEALQAEKE
THIE_ALKCK       VNDHIDVALAV-----DASGVHVGQDDLPLPEVRKLLGPD-KIIGVSTHKLEEALEAEKN
THIE_ALKHC       INDHIDVALAV-----DADGIHLGQDDLPLSEARKIMGRD-KIIGISTHKIEEAREAEKG
THIE_PELTS       VNDHVDLALLV-----DADGVHLGQDDLPADRVRELVGDK-MIIGLSTHSPAQARAAEKM
THIE_LAWIP       VNDHVDIAVLC-----NADGVHLGQDDLPVDKVRELIGKE-KIIGLSTHSPQQAQKAIEM
THIE_CALS8       VNDHVDLCQMV-----GADGVHLGQEDYPAKEVRKILGED-FIIGVTTHTKEQVEKAVED
THIE_CLOTE       INDRVDIALAV-----NAEGIHIGQKDLPANIVRKIIGED-KILGVSANTIEDALKAQRD
THIE_ALKOO       INDRVDIALAV-----DADGVHVGQSDLPAHIVRSMIGQN-KILGVSTATLEESKKAAED
THIE_CLOB8       INDRVDIALAV-----DAAGVHVGQSDIPAAIVRKVIGND-KILGVSTGSVNEALEAEKN
THIE_CLOD6       INDRVDIALIC-----DADGVHVGQSDIDVREVRKLIGNN-KILGVSARTLEEAICAKND
THIE_CLOAB       INDRIDIALAI-----NADGVHIGQSDMPLIKARELLGKD-KIIGVSAHSIEEALEAERN
THIE_ALKMQ       INDRLDIALAV-----DAAGLHIGPDDLPIKKARELLGPH-KTLGYSAATLAEALEAESL
THIE_METS3       INDRIDIALAI-----DADGVHVGQSDMPAKTARSMIGED-KILGVSAANIKEAKKAQRE
THIE_FUSNN       INDRLDITQAV-----EADGVHLGQSDMPIEKAREILKDK-FLIGATARNIEEAEKAQLL
THIE_CLOB1       INDRLDIAQAI-----DASGVHLGQKDMHLNIAREILGKD-KIIGISVGNVKEALQAQNN
THIE_CLOBH       INDRLDIAQAI-----DASGVHLGQKDMHLNIAREILGKD-KIIGISVGNVKEALQAQNN
THIE_CLOBL       INDRLDIAQAI-----DASGVHLGQKDMHLNIAREILGKD-KIIGISVGNVKEALEAQNN
THIE_CLOBK       INDRLDIAQAI-----DASGVHLGQKDMHLNIAREILGKD-KIIGISVGNVKEALEAQNN
THIE_CLOBM       INDRLDIAQAI-----DANGVHLGQKDMHLNIAREILGKD-KIIGISVGNVKEALEAQNN
THIE_CALS4       INDRVDIALAV-----DAEGVHVGPDDLPVGVVRRILGPD-KIVGGSAYSVEEALKAEKE
THIE2_STRPN      IDDRLDVCLAV-----DAAGLHIGDDELPVSVARKVLGPE-KILGVTAKTVKRALEAEKS
THIE2_STRR6      IDDRLDVCLAV-----DAAGLHIGDDELPVSVARKVLGPE-KILGVTAKTVKRALEAEKS
THIE_LACP3       IDDRVDICLAV-----DAAGVHIGDDELPVAMTRQLIGPD-KVLGVSTKTVETAVAAVAA
THIE_ENTFA       INDRVDICLAV-----DAAGVHIGDDELPVALVRKLVGST-KIVGVSAKTVARGVEAENE
THIE_CAMJ8       INDRVDIALAL-----DADGVHLGQEDLEVKLARKLLGDE-KIIGLSLKKLEQLEFIQ--
THIE_CAMJJ       INDRVDIALAL-----DADGVHLGQEDLEVKLARKLLGDE-KIIGLSLKKLEQLEFIQ--
THIE_CAMJR       INDRVDIALAL-----DADGVHLGQEDLEAKLARKLLGDE-KIIGLSLKKLEQLEFIQ--
THIE_CAMJE       INDRVDIALAL-----DADGVHLGQEDLEAKLARKLLGDE-KIIGLSLKKLEQLEFIQ--
THIE_DESHY       INDRVDLALAL-----DADGVHVGQQDLPLAKVRNIIGPD-KILGYSVSSLEEALQGERM
THIE_SYNWW       INDRLDIALAV-----DADGLHLGQDDLPLPVARSLLGKE-KIIGLSINKREEAREGEKM
THIE_NATPD       VNDRLDLAAAI-----DADGVHLGDDDLPIEVAREQLGSD-AIVGRSVSTPDAAREAEQA
THIE_HALWD       VNDRVDLAAAV-----NADGVHLGDDDLPVTAAREVLGQD-AIIGRSVSTPAAAQRAEDI
THIE_HALMA       VNDRIDLAQAI-----DADGVHLGDDDLPVSVARDILGDD-AVIGRSVSTVEDAREAATA
THIE_STRAW       VNDRADVAHAV-----DSDVLHLGQGDLPVPAARAILGAD-VLIGRSTHAEAEAEAAAVQ
THIE_STRCO       VNDRADVAHAA-----RADVLHLGQGDLPVPAARAILGDD-VLIGRSTHAESEAAAAAAQ
THIE_ACIC1       VNDRADIAYAA-----RSDVLHLGQDDLPVGIARSIVGDD-VVIGLSTHSVEQVQAAVSD
THIE_THEFY       VNDRADIAHAV-----NADVLHLGQRDLPVRYARAILGDR-PLIGRSTNAAELSAAADRE
THIE_SACEN       VNDRADVAMAA-----DADVLHLGQDDLPVELARRIVGDQ-VVVGRSTHDVVQADSAATE
THIE_MYCTA       VNDRADIARAA-----GADVLHLGQRDLPVNVARQILAPD-TLIGRSTHDPDQVAAAAA-
THIE_MYCBO       VNDRADIARAA-----GADVLHLGQRDLPVNVARQILAPD-TLIGRSTHDPDQVAAAAA-
THIE_MYCTU       VNDRADIARAA-----GADVLHLGQRDLPVNVARQILAPD-TLIGRSTHDPDQVAAAAA-
THIE_MYCBP       VNDRADIARAA-----GADVLHLGQRDLPVNVARQILAPD-TLIGRSTHDPDQVAAAAA-
THIE_MYCPA       VNDRADIARAA-----GADVLHLGQGDLPLEVARAFVGPD-VLLGLSSHDRDQMAAAAA-
THIE_MYCA1       VNDRADIARAA-----GADVLHLGQGDLPLDVARAFVGPD-VLLGLSSHDRDQMTAAAA-
THIE_MYCUA       VNDRADIARAA-----RADVLHLGQRDLPVDVARAITGPA-TLIGQSTHDRDQVSAAAI-
THIE_MYCLE       VNDRADIARAA-----GADVLHLGQGDLPPGVARQIVCRQ-MLIGLSTHDRHQVAAAVAA
THIE_MYCSS       VNDRADIALAA-----GADVLHLGQDDLPLPVARRIIGPS-PLIGRSTHDSAQVAAAVA-
THIE_MYCSK       VNDRADIALAA-----GADVLHLGQDDLPLPVARRIIGPS-PLIGRSTHDSAQVAAAVA-
THIE_MYCSJ       VNDRADIALAA-----GADVLHLGQDDLPLPVARRIIGPR-PLIGRSTHDSAQVSAAVA-
THIE_MYCS2       VNDRADIALAA-----GADVLHLGQDDLPLDVARGIIGRR-PVIGRSTHDAAQMAVAIE-
THIE_MYCVP       VNDRADIALAA-----DADVLHLGQDDLPLTVARRIVGDR--IVGRSTHDLDQVRAAVG-
THIE_MYCGI       VNDRADIARAS-----GAEVLHLGQDDLPLTVARQIVGDR--VIGRSTHDLAQAEAAIA-
THIE_NOCFA       VNDRADIALAA-----GADVLHLGQGDLPPWYARRIVGPD-VVIGRSTHNRAQAGLAAID
THIE_ARTS2       VNDRADIASLS-----GAPVLHVGQKDLPLASARKFLGGE-AVIGLSTHSHGQIDAAIAA
THIE_THET8       LNDRPDLAALL-----GADGVHLGQNDLTPEEARRF-FAG-M-VGRSTHAPEQALRALE-
THIE_THET2       LNDRPDLAALL-----GADGVHLGQNDLTPEEARRF-FAG-M-VGRSTHAPEQALRALE-
THIE_DEIGD       VNDRVDVALAS-----GADGVHLGQDDLPAEWARRL-APG-LQIGLSTHSPEQAARAQA-
THIE_NEIMA       INDHWREAIEA-----GAYGVHLGQEDMDTADLAAIAAAG-LRLGLSTHSVAELDRALSV
THIE_NEIMB       INDHWREAIEA-----GAYGVHLGQEDMDTADLAAIAAAG-LRLGLSTHSVAELDRALSV
THIE_NEIG1       INDHWREAIEA-----GAYGVHLGQEDMDTADLAAIAAAG-LRLGLSTHSVAELDRALFV
THIE_SALTY       INDYWRLAIKH-----RAYGVHLGQEDLETTDLKAIQAAG-LRLGVSTHDDMEIDVALAA
THIE_SALPB       INDYWRLAIKH-----RAYGVHLGQEDLETTDLKAIQAAG-LRLGVSTHNDMEIDVALAA
THIE_SALCH       INDYWRLAIKH-----RAYGVHLGQEDLETTDLKAIQAAG-LRLGVSTHDDMEIDVALAA
THIE_SALPA       INDYWRLAMKH-----NAYGVHLGQEDLETTDLKAIQAAG-LRLGVSTHDDMEIDIALAA
THIE_SALTI       INDYWRLAIKH-----NAYGVHLGQEDLETTDLKAIQAAG-LRLGVSTHDDMEIDIALAA
THIE_CITK8       INDYWRLAIKH-----NAYGVHLGQEDLETTDLKAIQAAG-LRLGVSTHDDMEIDIALAA
THIE_SHIF8       INDYWRLAIKH-----QAYGVHLGQEDLQATDLNAIRAAG-LRLGVSTHDDMEIDVALAA
THIE_SHIFL       INDYWRLAIKH-----QAYGVHLGQEDLQATDLNAIRAAG-LRLGVSTHDDMEIDVALAA
THIE_ECOHS       INDYWRLAIKH-----QAYGVHLGQEDLQATDLNAIRAAG-LRLGVSTHDDMEIDVALAA
THIE_SHISS       INDYWRLAIKH-----QAYGVHLGQEDLQATDLNAIRAAG-LRLGVSTHDDMEIDVALAA
THIE_ECOLI       INDYWRLAIKH-----QAYGVHLGQEDLQATDLNAIRAAG-LRLGVSTHDDMEIDVALAA
THIE_ECO24       INDYWRLAIKH-----QAYGVHLGQEDLQATDLNAIRAAG-LRLGVSTHDDMEIDVALAA
THIE_ECOLC       INDYWRLAIKH-----QAYGVHLGQEDLQATDLNAIRAAG-LRLGVSTHDDMEIDVALAA
THIE_SHIBS       INDYWRLAIKH-----QAYGVHLGQEDLQATDLNAIRAAG-LRLGVSTHDDMEIDVALAA
THIE_ECO57       INDYWRLAIKH-----QAYGVHLGQEDLQATDLNAIRAAG-LRLGVSTHDDMEIDVALAA
THIE_SHIDS       INDYWRLAIKH-----QAYGVHLGQEDLQATDLSAIRAAG-LRLGVSTHDDMEIDVALAA
THIE_ECOUT       INDYWRLAIKH-----QAYGVHLGQEDLQATDLSAIRAAG-LRLGVSTHDDMEIDVALAA
THIE_ECOK1       INDYWRLAIKH-----QAYGVHLGQEDLQATDLSAIRAAG-LRLGVSTHDDMEIDVALAA
THIE_ECOL5       INDYWRLAIKH-----QAYGVHLGQEDLQATDLSAIRAAG-LRLGVSTHDDMEIDVALAE
THIE_ECOL6       INDYWRLAIKH-----QAYGVHLGQEDLQATDLSTIRAAG-LRLGVSTHDDMEIDVALAA
THIE_SALAR       VNDYWRLAIKH-----QAYGVHLGQEDLKTTDLNAIRTAG-LRLGVSTHDDMEIDIALAA
THIE_KLEP7       INDYWQLAIKH-----QAYGVHLGQEDLETTDLSAIRQAG-LRLGVSTHDDMEIDVALAA
THIE_ENT38       INDYWQLAIQH-----QAYGVHLGQEDLETTDLSAIRNAG-LRLGVSTHDDMEIDVALAA
THIE_CROS8       INDYWRLAIKH-----QAYGVHLGQEDLETADPDAIRRAG-LRLGVSTHDDMEIDVALAV
THIE_SERP5       INDYWQLAIKH-----GAYGVHLGQEDLDTTDLAAIHRAG-LRLGVSTHDDSELARAIAV
THIE_PECAS       INDYWTLAVKH-----QAYGVHLGQEDLDTADLAAIKKAG-LRLGVSTHYDRELARAVAI
THIE_YERPA       INDYWQLAVKH-----GAYGVHLGQEDLEAADLAAIQQAG-LRLGISTHDEHELAVAKTL
THIE_YERPE       INDYWQLAVKH-----GAYGVHLGQEDLEAADLAAIQQAG-LRLGISTHDEHELAVAKTL
THIE_YERPN       INDYWQLAVKH-----GAYGVHLGQEDLEAADLAAIQQAG-LRLGISTHDEHELAVAKTL
THIE_YERPP       INDYWQLAVKH-----GAYGVHLGQEDLEAADLAAIQQAG-LRLGISTHDEHELAVAKTL
THIE_YERPS       INDYWQLAVKH-----GAYGVHLGQEDLETADLAAIQQAG-LRLGISTHDEHELAVAKTL
THIE_YERP3       INDYWQLAVKH-----GAYGVHLGQEDLETADLAAIQQAG-LRLGISTHDEHELAVAKTL
THIE_PHOLL       INDYWRLAIKH-----GAYGVHLGQEDLVIADLNAIQKTG-LRLGISTHDEQELARAKSL
THIE_RHIEC       INDYWRLAIDE-----GCDFIHLGQEDLMAADLAAIRRAG-LKLGLSTHDPSELETALAA
THIE_KORVE       LNDRADLAIAA-----GFHGVHVGQDDLSPEGARLVVGPE-MFVGTSTHNPEQLQIADKA
THIE_AGRFC       INDRVDVALAS-----GADGVHLGADDMDAKTARRILGEK-AIIGLTVKNRADAERAASM
THIE_SALAI       VNDRLHVALAV-----GADGGHVGADDLPVGAARAVLGSA-AVLGATAREADTAV--EAV
THIE_SALTO       VNDRLHVALAV-----GAAGGHVGADDLPVGAARAVLGSA-AVLGVTARDADTAV--EAV
THIE_SALRD       IDDHLDIAQAT-----DADGVHLGQDDFPIDAARSVLGPS-PIIGGTASKPHEAA--EAY
THIE_MYXXD       VNDRVDLALLA-----DADGVHVGDEDVPAEDARALLGPG-RLVGVTVRDVVGAR--AAQ
THIE_ANADE       VNDRADLALLA-----GADGVHLGDDDLPVPEARRLLGPD-LLVGRTTRTLEEAR--AAL
THIE_BACFN       LDDHVELAKKL-----EVDGVHLGKKDMPIGEARQMLGEA-FIIGGTANTFEDVK--LHH
THIE_BACFR       LDDHVELAKKL-----EVDGVHLGKKDMPIGEARQMLGEA-FIIGGTANTFEDVK--LHH
THIE_BACTN       LDDHVELAKKL-----EVDGVHLGKKDMPIDQARQLLGEA-FIIGGTANTFEDVV--QHY
THIE_PHOV8       IDDHVELVKKI-----HADGVHLGKKDMPVAEARGILGKE-FIIGGTANTFDDVK--MHY
THIE_FLAJ1       INDNLYLAQQI-----NADGVHLGLSDMKIDEARTILGAE-KIIGGTANTFEDIQ--NHV
THIE_FLAPJ       INDNVYLAKKI-----NADGVHLGLNDMNIAEARTILGEA-KIIGGTANTFEEVL--QRT
THIE_COREF       VDDRVDIALALRHRGLPVHGVHVGQDDLPVRDVRALLGEE-AIIGLTTGTRELVEAANEH
THIE_CORJK       IDDRVDVAAALMPEH-NIHGVHIGQDDLDPRLARQLLGKD-AIIGLTTGTLPLVQQANEY
THIE_VIBCB       INDRVDVALAV-----DADGVHLGQSDMPATIARELIGPN-KILGLSIENEEQLTEAD--
THIE_VIBPA       INDRVDVALAV-----DADGVHLGQSDMPAEIARQLIGPN-KILGLSIETEDQLAEAD--
THIE_RHOFT       INDRIDVALAC-----GAQGVHLGQSDMPVTQARRLLPPE-VFIGWSVETLEDVARSA--
THIE_CHLCV       VSDSVSVCLDL-----DASGVHLGQTDGDVIEARELLGPD-KIIGWNVHTLDQLLNAN--
THIE_CHLAB       VSDSVSVCLDL-----DATGVHLGQTDGDVIEARELLGSD-KIIGWNVNTLDQLLNAN--
THIE_AZOC5       INDRVDVAAAV-----GAEGVHLGQDDLDPAAARAILGPD-AIIGLSVGSLEELSASN--
THIE_PSYWF       INDKVQIAHKA-----KLDGAHIGQGDLSVKQARNILGHD-AWLGLSINTLAQLQQTHHH
THIE_KINRD       VDDAVDIALIA-----GADGVHLGQSDLPAAEVRR-LAPD-LLLGLSVSTPAQAAAVD--
THIE_PYRHO       VDDRIDVALAVN-----ADGVQLGPDDMPIEIAREIA-PN-LIIGASVY-SLEEALEAEM
THIE_PYRAB       VDDRIDVALAVN-----ADGVQLGPEDMPIEVAREIA-PN-LIIGASVY-SLEEALEAEK
THIE_PYRFU       VDDRVDVALAVD-----ADGVQLGPEDMPIEVAKEIA-PN-LIIGASVY-SLEEALEAEK
THIE_METMP       VNDRLDVAQAVN-----ADGIHVGIDDMPVSKIKEIA-PN-LIIGASAY-NLDEMKTAES
THIE_METM5       VNDRLDVAQAVN-----ADGIHVGIDDMPVSKIKEIA-PN-LIIGASAY-NIDEMKTAEY
THIE_METM7       VNDRLDVAQVVN-----ADGIHVGIDDMPVSKIKEIA-PN-LIIGASAY-NMEEMKTAES
THIE_METVS       VNDRLDIAQAVK-----SDGIHVGIDDISISKIKEIA-PE-LIIGASAY-NINEMKIAES
THIE_ARCFU       VNDRIDVALAVD-----ADGVHIGQDDMPAFAAREIF-PG-YI-GVSAG-NVEEAKKDE-
THIE_CALMQ       VDDRVDIAVLSD-----ADGVHVGLEDAPVDEVKRRF-SG-IIIGASAS-TVDEAKEGEK
THIE1_AQUAE      VNDRVDLALAVE-----ADGVHIGKDDLPPEVVRKIVGDK-MYIGYTAN-SLEEVKRAQE
THIE_THEAC       IDDDVQLAIEVQ-----ADGVHIGKDDMPLPDARRIFDG---LIGYSTYGDREMAIFAEK
THIE_THEVO       VDDDPKLAKEAG-----ADGVHIGRDDPPIEQVRDVFNG---LIGVSTYGNLELATEAEK
THIE_PICTO       VDDSPVLLDILD-----ADGIHIGKDDPPFEYIKERFPGK--IIGVSTYGDINLGIKYER
THIE_PSEP1       INDDAELAARLG-----V-GVHLGQTDGPLTPARALLGRQ-AIIGSTCHASLELAAQAAS
THIE_PSEPK       INDDAELAARLG-----V-GVHLGQTDGPLTPARALLGRQ-AIIGSTCHASLELAAQAAS
THIE_PSEPG       INDDAELAARLG-----V-GVHLGQTDGPLTPARTLLGRQ-AIIGSTCHASLELAAQAAS
THIE_PSEE4       INDDAELAARLG-----V-GVHLGQTDGPLTPARALLGRQ-AIIGSTCHASLELAEQAAS
THIE_PSEF5       INDDAELAARIG-----A-GVHLGQTDGPLTPARALLGRQ-AIIGATCHSQLPLAEQAAK
THIE_PSEPF       INDDAELAARLN-----V-GVHLGQTDGPLSPTRALLGYK-AIIGSTCHAQLELAEQAAR
THIE_PSE14       INDDAELAARLG-----V-GVHLGQTDGSLPDARALLGHK-AIVGATCHGSLELAEQAKA
THIE_PSEU2       INDDAELAARLG-----V-GVHLGQSDGSLPDARALLGHK-AIVGATCHGRVELAEQAKA
THIE_PSESM       INDDAELAARLG-----V-GVHLGQTDGSLPDARALLGHK-AIVGATCHGQLELAEQAKA
THIE_PSEAB       VNDDAELAARLG-----V-GLHLGQTDGSLSAARALLGRQ-AIIGATCHARLELAEQAVA
THIE_PSEAE       VNDDAELAARLG-----V-GLHLGQTDGSLSAARALLGRQ-AIIGATCHAQLELAEQAVA
THIE_PSEA7       VNDDAELAARLG-----V-GVHLGQTDGSLSAARALLGRQ-ALVGATCHASLELAEQAVA
THIE_PSEU5       INDDAELAARLG-----V-GLHLGQEDGSLAAARALLGRQ-AIIGATCHAQLPLAEQAAR
THIE_PSEMY       INDDLELAAHLG-----V-GLHLGQTDGSLAAARARLGAD-VVIGGTCHAQLELAERAVA
THIE_MARN8       INDDPELAARVG-----AAGVHLGQDDCSLVDARRLLGEH-AIIGITCHHSLNLAQTAVD
THIE_SACD2       INDDTALAKQVG-----ADGVHLGQTDGCIVSARELLGPQ-AIIGSTCHASLELAERALA
THIE_ALCBS       VNDDPALAAQVN-----ADGVHIGQSDGGIKAARDQLGGS-RIIGVTCHGDLTLAARAAE
THIE_NITOC       INDDALLAAEIG-----AEGVHLGQDDSSITSARKILGAK-AIIGISCYNDLARAIAAEQ
THIE_HALHL       VNDDVDLAAAVA-----AHGVHLGRDDGAVVAARQQLGDT-AWIGVSCYDDLDRARRLVA
THIE_NITEU       VNDHLDLAMEID-----AEGLHVGGDDISPAVARCHLGQD-KIIGVSCYNQLDRAIEAEE
THIE_NITEC       INDHMDLVMEID-----AEGLHVGGEDTSVAAARHYLGRN-KIIGVSCYNQLSHAIEAEK
THIE_NITMU       INDHIDLALEVG-----ADGVHLGREDAPISQARLKLGHE-KIIGISCYNELESAIEAEC
THIE_METCA       VNDSPRLAAEIG-----ADGVHLGKNDGSVAAARHVLGDR-AIVGISCYDSLERALRAEA
THIE_AROAE       VNDSLELALATD-----ADGVHLGREDGDLDAARRALGPG-RILGVTCYNEWPRAVAGCA
THIE_AZOSB       INDDVALARAVA-----ADGVHLGRDDGSPAAARAVLGAD-ALIGVSCYDEWVRAEDAAA
THIE_DECAR       INDDLALAALVQ-----ADGVHLGKDDGNLVVARAILGPD-KILGASCYADFAAAEAASR
THIE_THIDA       VNDDLRLADLAG-----ADGVHLGRDDASIREARIILGPA-KFVGASCYQSLDLARAAQT
THIE_METFK       INDDVQLAAALD-----ADGVHLGIDDGDIAAARAALGPD-KIIGASCYNNLALARQAAS
THIE_CHRVO       VNDDVELAERIG-----ADGVHLGRDDGDIAAARRRLGAD-AVIGASCYDRIELARAALA
THIE_BORPA       VNDHWKLALDVG-----ADGAHLGRDDADPATVRAQAGAG-LLLGVSCYNDLRRADALLA
THIE_BORPE       VNDHWKLALDVG-----ADGAHLGRDDADPATVRAQAGAG-LLLGVSCYNDLRRADALLA
THIE_BORBR       VNDHWKLALDVG-----ADGAHLGRDDADPATVRAQAGAG-LLLGVSCYNDLRRADALLA
THIE_BORA1       VNDDWRTALEAG-----ADGAHIGRDDATLAEVRA-AAPG-LLLGVSCYADLNRARELLA
THIE_XANCP       INDDAALAQQVG-----ADGVHLGEDDGEVAAARALLGAS-AIIGVSCYDEIERARAAAA
THIE_XANC8       INDDAALAQQVG-----ADGVHLGEDDGEVAAARALLGAS-AIIGVSCYDEIERARAAAA
THIE_XANAC       INDDAQLAAQVG-----AQGVHLGEDDGDVAAARALLGEQ-AIIGVSCYDDIERGRAAAA
THIE_XYLFT       INDDLELAQTIG-----ADGVHLGMHDSNASIARAQLGPH-AIIGVSCYNQIERAKQAIK
THIE_XYLFA       INDDLELAQTIG-----ADGVHLGMHDSNPSIARAQLGPH-AIIGVSCYNQIERAKQAIK
THIE_HYPNA       INDAAELSRQLG-----ADGVHLGWDDMPVKTARALLGPD-AIIGATAKNSYHRAMQAGE
THIE_ERYLH       VNDSIALAKRLK-----ADGVHLGQDDGSPKEAREQLGRE-AQIGVTCHASRHLAMEAGE
THIE_WOLSU       LNDRLDLALSLG-----VDGVHLGIDDAEASRARILLPHG--IIGISCYGDLDRAHKAKE
THIE_METAC       VNDRIDVALAVD-----ADGVHIGQDDMPIEIAKKLLGPE-KIIGLTVH-NVEEALEAER
THIE_METMA       INDRIDVALVVD-----ADGVHIGQDDMPIETARKILGAN-KIIGLTVH-NADEAIEAEK
THIE_METBF       VNDRIDVALAVD-----ADGVHIGQDDMPVETARKLLGED-KIIGLSVN-DREEAVLAEK
THIE_CLOPE       VNDRIDVALAVK-----ANGVHIGQDDMEVSIAREIMPKD-AVIGVTVH-NKEEALKAIK
THIE_CLOP1       VNDRIDVALAVK-----ANGVHIGQDDMEVFIAREIMPKD-AVIGVTVH-NKEEALKAIK
THIE_CLOPS       VNDRIDVALAVK-----AHGVHIGQDDMDVSIAREIMPKD-AIIGVTVH-NKEEALKAIK
THIE_GEOKA       VNDDVELALAID-----ADGVHVGQDDEDARRVREKIGDK--ILGVSAHNVEEAMAAV--
THIE_GEOTN       VNDDVELAIAID-----ADGVHVGQDDEDARRVREKIGDK--ILGVSAHNVEEARAAI--
THIE_BACAH       VNDDVELALELD-----ADGVHVGQDDEGITSVREKMGDK--IVGVSTHTIEEARWAI--
THIE_BACAN       VNDDVELALELD-----ADGVHVGQDDEGITSVREKMGDK--IVGVSTHTIEEARWVI--
THIE_BACHK       VNDDVELALELD-----ADGVHVGQDDEGITSVREKMGDK--IVGVSTHTIEEARWAI--
THIE_BACCZ       VNDDVELALELD-----ADGVHVGQDDEGITSVREKMGDK--IIGVSTHTIEEARWAI--
THIE_BACC1       VNDDVELALELD-----ADGVHVGQEDEGITSVREKMGDK--IIGVSTHTIEEARWAI--
THIE_BACCR       VNDDVELAIELD-----ADGVHVGQDDEGITSVREKMGDK--IIGVSAHTIEEARFAI--
THIE_BACCN       VNDDVDLALKLD-----ADGVHVGQDDEGIEVVREKMGDK--IVGVSAHTIEEAHFAI--
THIE_BACVZ       INDDVELALRLE-----ADGVHIGQDDADAEETRAAIGDM--ILGVSAHNVSEVKRAE--
THIE_BACSU       VNDDVELALNLK-----ADGIHIGQEDANAKEVRAAIGDM--ILGVSAHTMSEVKQAE--
THIE_BACLD       INDDVELALELD-----ADGVHIGQDDDKAADVRARIGDK--ILGVSAHTLEEVLKAE--
THIE_BACP2       VNDDVQLAIDLD-----ADGVHVGQEDTNAEDVRQKIGDK--ILGVSTHNLDEVKQAM--
THIE_STRA5       IDDDIDLVELID-----ADGLHIGQNDLPVDEARRRLPDK--IIGLSVSTMDEYQKSQ--
THIE_STRA1       IDDDIDLVELID-----ADGLHIGQNDLPVDEARRRLPDK--IIGLSVSTMDEYQKSQ--
THIE_STRA3       IDDDIDLVELID-----ADGLHIGQNDLPVDEARRRLPDK--IIGLSVSTMAEYQKSQ--
THIE1_STRR6      VNDDIDLAMEID-----ADGVHVGQDDIGVDEIRKLMPDK--IIGLSIRNEEEFQQSK--
THIE1_STRPN      VNDDIDLAMEID-----ADGVHVGQDDIGVDEIRKLMPDK--IIGLSIRNEEEFQQSK--
THIE_STRS2       INDDVELARAID-----ADGIHLGQEDLSVVEARQLFPGK--IIGLSVGTKEEYLNSP--
THIE_STAAM       VNDDVSLAKEIN-----ADGIHVGQDDAKVKEIAQYFTDK--IIGLSISDLDEYAKSD--
THIE_STAA9       VNDDVSLAKEIN-----ADGIHVGQDDAKVKEIAQYFTDK--IIGLSISDLDEYAKSD--
THIE_STAAN       VNDDVSLAKEIN-----ADGIHVGQDDAKVKEIAQYFTDK--IIGLSISDLDEYAKSD--
THIE_STAA1       VNDDVSLAKEIN-----ADGIHVGQDDAKVKEIAQYFTDK--IIGLSISDLDEYAKSD--
THIE_STAAC       VNDDVSLAKEIN-----ADGIHVGQDDAKVKEIAQYFTDK--IIGLSISDLDEYAKSD--
THIE_STAAE       VNDDVSLAKEIN-----ADGIHVGQDDAKVKEIAQYFTDK--IIGLSISDLDEYAKSD--
THIE_STAA2       VNDDVSLAKEIN-----ADGIHVGQDDAKVKEIAQYFTDK--IIGLSISDLDEYAKSD--
THIE_STAA3       VNDDVSLAKEIN-----ADGIHVGQDDAKVKEIAQYFTDK--IIGLSISDLDEYAKSD--
THIE_STAA8       VNDDVSLAKEIN-----ADGIHVGQDDAKVKEIAQYFTDK--IIGLSISDLDEYAKSD--
THIE_STAAS       VNDDVSLAKEIN-----ADGIHVGQDDAKVKEIAQYFTDK--IIGLSISDLDEYAKSD--
THIE_STAAW       VNDDVSLAKEIN-----ADGIHVGQDDAKVKEIAQYFTDK--IIGLSISDLDEYAKSD--
THIE_STAAR       VNDDVSLAKEIN-----ADGIHVGQDDAKVKEIAQYFTDK--IIGFSISDLDEYAKSD--
THIE_STAAB       VNDDVSLAKEIN-----ADGIHVGQDDAKVKEIAQYFTDK--IIGLSISDLGEYAKSD--
THIE_STAEQ       VNDDVQLAQEIN-----ADGIHVGQDDMEIQQFASQFKNK--IIGLSVGNLKEYQQSD--
THIE_STAES       VNDDVQLAQEIN-----ADGIHVGQDDMEIQQFASQFKNK--IIGLSVGNLKEYQQSD--
THIE_STAHJ       VNDDVDLAEKIN-----ADGIHVGQDDENVKSFAERFKDK--IIGLSIGNEKEYYHSD--
THIE_STACT       VNDDVALAEEID-----ADGIHVGQDDEAVDDFNNRFEGK--IIGLSIGNLEELNASD--
THIE_STAS1       VNDDVALANKIG-----ADGIHVGQDDMDVKVFAEQFKGK--IIGLSISNIDEYKTSN--
THIE_OCEIH       INDDVDLAKQLD-----ADGIHIGQDDQPVEVVRKQFPNK--IIGLSISTNNELNQSP--
THIE_LISIN       INDDVALALEIG-----ADGIHVGQNDEEIRQVIASCAGK-MKIGLSVHSVSEAEEAER-
THIE_LISMF       INDDVALALEIG-----ADGIHVGQNDEEIRQVIASCAGK-MKIGLSVHSVSEAEEAER-
THIE_LISMO       INDDVALALEIG-----ADGIHVGQTDEAIRQVIASCSGK-MKIGLSVHSVSEAKEAER-
THIE_LISW6       INDDVVLALEIG-----ADGIHVGQNDEEIHQVITSCAGK-MKIGLSVHSVSEAEEAER-
THIE_HAEIN       VDDNVDLALEIE-----ADGIHVGQSDMPVQEIRAKTDKP-LIIGWSVNRLDEAKIGEN-
THIE_HAEIG       VDDNVDLALAIE-----ADGIHVGQSDMPVQEIRAKTDKP-LIIGWSVNRLDEAKIGEN-
THIE_HAEI8       VDDNVDLALEIE-----ADGIHVGQSDMPVQEIRAKTDKP-LIIGWSVNRLDEAKIGEN-
THIE_HAEIE       VDDNVDLALEIE-----ADGIHVGQSDMPVQEIRAKTDKP-LIIGWSVNRLDEAKIGEN-
THIE_PASMU       VNDDVQLAIDIG-----ADGIHVGQTDMAVADVAALCHSH-CFIGTSVNTLEQGIAAQA-
THIE_HAES1       VNDDVALAVEIG-----ADGIHVGQTDMPPHQVKRLCTGK-CFVGTSVNTIEQGLIAQN-
THIE_ACTSZ       INDDIGLALAIR-----ADGIHVGQKDTAVERILSRADYR-PIIGLSINTLEQAQANKE-
THIE_MANSM       VNDDVELALSIQ-----ADGIHVGQKDTAVETILRNTRNK-PIIGLSINTLAQALANKD-
THIE_HELPH       INDEVRLALELK-----ADGVHVGQEDMAIEEVIALCKKH-QFIGLSVNTLEQALKARH-
THIE_HELPY       VNDEVQLALELK-----ADGVHVGQEDMAIEEVITLCKKR-QFIGLSVNTLEQALKARH-
THIE_HELPJ       INDEVRLALELK-----ADGVHVGQEDMAIEEVVTLCQKR-LFIGLSVNTLEQALKARH-
THIE_LIMRD       VDDDYELAQQIN-----ADGVHVGQNDTKIEQVSVAVGHQ-MFIGYSCNTPEQVERANT-
THIE_PEDPA       IDDDVDLALAIH-----AEGIHVGQKDEKIESVLKRVQGS-MIVGLSCNTEAQVKQANQ-
THIE_LACPL       VDDDVELALALQ-----ADGIHVGQKDDWVTQVIQRVANQ-MFVGLSCSTLAEVQIANQ-
THIE_LEVBA       VDDDVELALALD-----ADGIHVGQSDQRVQQVIQAVAGRNIFVGLSCSTMAEVTAANA-
THIE_LATSS       IDDRLELALDLQ-----ADGLHVGQSDQPWPKIEVAKQHG-LITGLSCHTAQEILSSHQ-
THIE_LACLM       VNDDVELARELN-----ADGIHIGQTDESVSKVREKVGQE-MWLGLSVTNADELKTAQ--
THIE_LACLS       VNDDVELARELN-----ADGIHIGQTDESVSKVREKVGQE-MWLGLSVTKADELKTAQ--
THIE_LACLA       VNDDVELARELS-----ADGIHVGQDDDSVSKIRELIGQE-MWVGLSVSNDMELESAQ--
                 :.*                  ::*  :                 * .             

THIE_ROSS1       -----GATYVSVGDLFGTPSKP---DAGPPIGLEPLAEIARTVN----------------
THIE_ROSCS       -----GATYVSVGDLFGTPSKP---DAGPPIGLTPLTEIARAVD----------------
THIE_MOOTA       -----GADYLGVGSIFATGSKG---DAGSPIGLEGLRAIRAAVK----------------
THIE_CHLAA       -----GADYLGVGPIFATTTKP---DAAAPIGLDGLRAIRQHVS----------------
THIE_METMJ       -----GADYVALSPTFATGSKD---DAGPGCGLAALKEIRAAVS----------------
THIE_METB6       -----GADYVAASPIFATSSKD---DAGPGCGISGLREIRAAVA----------------
THIE_METAR       -----GADYIGFGPVFPTGSKA---DAGPVCGLDLLREVRRRVS----------------
THIE_METHJ       -----GADYLGVGPVYPTGTKA---DAGPAVGPGLIRSIRERVA----------------
THIE_CHLTE       -----GASYIGVGHIFPTFSKD---KPSEPLGTASIRPIGRAAQ----------------
THIE_CHLPD       -----GADYIGFGHIFQTGSKN---KLSAPLGSAAISAVVQRIS----------------
THIE_CHLL3       -----GADYAGFGHIFPTGSKA---KGYKPLGPEAISLAAAALR----------------
THIE_CHLPM       -----GADYVGFGHIFPTGSKD---KPLPPVGTLALQDTASLLS----------------
THIE_ALKCK       -----GADYIGVGPIFPTNSKA---DVVDPVTTAYIREVKEHVT----------------
THIE_ALKHC       -----GADYIGVGPIFETKSKE---DVVDPVTTAYIQQVAHEIS----------------
THIE_PELTS       -----GVDYIGVGPIFATKTKK---DVCDPVGLEYLEFVVKNIS----------------
THIE_LAWIP       -----GADYIGVGPLYPTKTKK---DVCEPVTISYLDWVVSHIA----------------
THIE_CALS8       -----GADYIGLGPVFQSFTKD---KPHPPIGLEMVRWAATYCK----------------
THIE_CLOTE       -----GADYLGVGAIFPTNSKK---DAE-STSIETLKEIKNAVN----------------
THIE_ALKOO       -----GADYIGVGALFPTGTKT---DAN-PVTLDQLRYIKENMD----------------
THIE_CLOB8       -----GADYLGVGAMYSTGTKK---DAD-STSMNELRKIRENVS----------------
THIE_CLOD6       -----GADYLGVGSIFTTSTKL---DAK-SASFETVKEIKEKVD----------------
THIE_CLOAB       -----GATYLGVGAIYNTSTKG---DAQ-AVSLEELKNIKNSVK----------------
THIE_ALKMQ       -----GANYLGVGALFPTKTKK---DTE-SVSLQLLQKIKSSVS----------------
THIE_METS3       -----SADYIGVGAVYPTNTKD---DAT-SVPKKELKEIVKSVD----------------
THIE_FUSNN       -----GADYIGSGAIFGTSTKD---NAK-RLEMEDLKKIVNSVK----------------
THIE_CLOB1       -----GADYLGIGTIFPTGSKK---DVDAIIGIDGLSKIKDSIS----------------
THIE_CLOBH       -----GADYLGIGTIFPTGSKK---DVDAIIGIDGLSKIKDSIS----------------
THIE_CLOBL       -----GADYLGIGTIFPTGSKK---DVDAIIGIDGLSKIKDSIS----------------
THIE_CLOBK       -----GADYLGIGTIFPTGSKK---DVDAIIGIDGLSKIKDSIS----------------
THIE_CLOBM       -----GADYLGIGTIFPTGSKK---DVDAIIGIDGLSKIKDSIS----------------
THIE_CALS4       -----GADYIGAGSVFAQPVKP---EAE-VIGIEGVRKIKEAVN----------------
THIE2_STRPN      -----GADYLGTGAIFPTTTKE---NAP-ITLISTLKTICQTVA----------------
THIE2_STRR6      -----GADYLGTGAIFPTTTKE---NAP-ITLISTLKTICQTVA----------------
THIE_LACP3       -----GADYLGVGAIFPTQTKA---NAA-VTPIATLKAITAQVA----------------
THIE_ENTFA       -----GADYLGVGAIFPTTTK----DSP-LTSLQTLSEIAAAVT----------------
THIE_CAMJ8       -----GANYLGCGAIKATPTK----ESS-LLSLELLSQICDKSP----------------
THIE_CAMJJ       -----GANYLGCGAIKATPTK----ESS-LLSLELLSQICDKSP----------------
THIE_CAMJR       -----GVNYLGCGAIKATPTK----ESS-LLSLELLSQICDKSP----------------
THIE_CAMJE       -----GVNYLGCGAIKATPTK----ESS-LLSLELLSQICDKSP----------------
THIE_DESHY       -----GADYLGAGPVFPTGSKK---DAAEAIGLAKLKEIKAGVS----------------
THIE_SYNWW       -----GADYLGVSPVFSTPTKA---DAPPATGLEFLASLRQEIK----------------
THIE_NATPD       -----GADYLGVGAIYGTDSKD-TDPEQSNIGLDRIRAVRDATS----------------
THIE_HALWD       -----GADYLGVGAVYPTGTKD-VTAESAEIGPKTVTAITDAVS----------------
THIE_HALMA       -----GADYLGVGAVFATGSKDDIDDEEYAVGTDRVAAIAEAVD----------------
THIE_STRAW       ----EGVDYFCTGPCWPTPTKPG----RHAPGLDLVRHTAALGTD---------------
THIE_STRCO       ----EGVDYFCTGPCWPTPTKPG----RHAPGLDLVRRTAALGTD---------------
THIE_ACIC1       ----PAVDYFCVGPCWPTPTKPG----RPAAGLDVVRYAAQAAGD---------------
THIE_THEFY       ----EGVDYFCIGPVWATPTKPG----RPAAGLDEVARVAALHPQ---------------
THIE_SACEN       ----QGVDYFCTGPVWTTPTKPG----REAAGLELVRHTAEHRGHG--------------
THIE_MYCTA       ----GDADYFCVGPCWPTPTKPG----RAAPGLGLVRVAAELGGDD--------------
THIE_MYCBO       ----GDADYFCVGPCWPTPTKPG----RAAPGLGLVRVAAELGGDD--------------
THIE_MYCTU       ----GDADYFCVGPCWPTPTKPG----RAAPGLGLVRVAAELGGDD--------------
THIE_MYCBP       ----GDADYFCVGPCWPTPTKPG----RAAPGLGLVRVAAELGGDD--------------
THIE_MYCPA       ----GPADYFCVGPCWPTPTKPG----RAAPGLALVRAAAELHTG---------------
THIE_MYCA1       ----GPADYFCVGPCWPTPTKPG----RAAPGLALVRAAAELRTG---------------
THIE_MYCUA       ----GAVDYFCVGPCWPTPTKPG----RTAPGLDLVRFAADVAGA---------------
THIE_MYCLE       L-DAGLVDYFCVGPCWPTPTKPD----RPAPGLELVRAAAELAGD---------------
THIE_MYCSS       ----EEVDYFCVGPCWPTPTKPG----REAPGLGLVREVASRATE---------------
THIE_MYCSK       ----EEVDYFCVGPCWPTPTKPG----REAPGLGLVREVASRATE---------------
THIE_MYCSJ       ----EEVDYFCVGPCWPTPTKPG----REAPGLGLVREVASRATE---------------
THIE_MYCS2       ----ERVDYFCVGPCWPTPTKPG----RPAPGLDLVRATAAHSPG---------------
THIE_MYCVP       ----EDVNYFCVGPCWPTPTKPG----RPAPGLDLIRATAALGTD---------------
THIE_MYCGI       ----EDVDYFCVGPCWPTPTKPG----RAAPGLDLVREVAALNTT---------------
THIE_NOCFA       ----EHIDYFCTGPVWSTPTKPG----RQAAGLDLVRSTADSHPT---------------
THIE_ARTS2       SRGAGGLDYFCVGPVWATPTKPG----RAAVGLELVRYAAEAAGKTTAKTTGGAAGPTVD
THIE_THET8       ----EGVDYLSVGPVWETPTKPG----RPAAGLAYVRWAAENLGE---------------
THIE_THET2       ----EGVDYLSVGPVWETPTKPG----RPAAGLAYVRWAAENLGE---------------
THIE_DEIGD       ----EHPTYFAVGPVYATPTKPG----RAAAGLAYVRHVAALCPA---------------
THIE_NEIMA       -----HPSYIASGAIFPTTTKQMP---TAPQGLDKLREYVKQAGG---------------
THIE_NEIMB       -----HPSYIASGAIFPTTTKQMP---TAPQGLDKLREYVKQAGG---------------
THIE_NEIG1       -----HPGYIASGAIFQTTTKQMP---TAPQGLDKLREYVEQARG---------------
THIE_SALTY       -----KPSYIALGHVFPTQTKQMP---SAPQGLAQLASHIERLAD---------------
THIE_SALPB       -----KPSYIALGHVFPTQTKQMP---SAPQGLAQLASHIERLAD---------------
THIE_SALCH       -----KPSYIALGHVFPTQTKQMP---SAPQGLAQLASHIERLAD---------------
THIE_SALPA       -----KPSYIALGHVFPTQTKQMP---SAPQGLAQLVRHIERLAD---------------
THIE_SALTI       -----KPSYIALGHVFPTQTKQMP---SAPQGLAQLARHIERLAD---------------
THIE_CITK8       -----RPSYIALGHVFPTQTKQMP---SAPQGLEQLARHIERLGD---------------
THIE_SHIF8       -----RPSYIALGHVFPTQTKQMP---SAPQGLEQLARHVERLAD---------------
THIE_SHIFL       -----RPSYIALGHVFPTQTKQMP---SAPQGLEQLARHVERLAD---------------
THIE_ECOHS       -----RPSYIALGHVFPTQTKQMP---SAPQGLEQLARHVERLAD---------------
THIE_SHISS       -----RPSYIALGHVFPTQTKQMP---SAPQGLEQLARHVERLAD---------------
THIE_ECOLI       -----RPSYIALGHVFPTQTKQMP---SAPQGLEQLARHVERLAD---------------
THIE_ECO24       -----RPSYIALGHVFPTQTKQMP---SAPQGLEQLARHVERLAD---------------
THIE_ECOLC       -----RPSYIALGHVFPTQTKQMP---SAPQGLEQLARHVERLAD---------------
THIE_SHIBS       -----RPSYIALGHVFPTQTKQMP---SAPQGLEQLARHVERLAD---------------
THIE_ECO57       -----RPSYIALGHVFPTQTKQMP---SAPQGLEQLARHVERLSD---------------
THIE_SHIDS       -----RPSYIALGHVFPTQTKQMP---SAAQGLEQLARHVERLAD---------------
THIE_ECOUT       -----RPSYIALGHVFPTQTKQMP---SAPQGLEQLARHVERLAD---------------
THIE_ECOK1       -----RPSYIALGHVFPTQTKQMP---SAPQGLEQLARHVERLAD---------------
THIE_ECOL5       -----RPSYIALGHVFPTQTKQMP---SAPQGLEQLARHVERLAD---------------
THIE_ECOL6       -----RPSYIALGHVFPTQTKQMP---SAPQGLEQLARHVERLAD---------------
THIE_SALAR       -----RPSYIALGHVFPTQTKQMP---SAPQGLEQLARHIERLAD---------------
THIE_KLEP7       -----RPSYIALGHVFPTQTKQMP---SAPQGLEQLARHIQRLAD---------------
THIE_ENT38       -----RPSYIALGHVFPTQTKQMP---SAPQGLEQLTRHIERLAD---------------
THIE_CROS8       -----RPSYIALGHVFPTQTKQMP---SAPQGLAQLAAHVKRLGD---------------
THIE_SERP5       -----KPSYIALGHIFPTQTKDMP---SAPQGLVELKRHIAGLSD---------------
THIE_PECAS       -----NPSYIALGHIFPTQTKDMP---SAPQGLAELTRHIADLQGR--------------
THIE_YERPA       -----RPSYIALGHIFPTQTKQMP---SSPQGLASLSRQVKNTPD---------------
THIE_YERPE       -----RPSYIALGHIFPTQTKQMP---SSPQGLASLSRQVKNTPD---------------
THIE_YERPN       -----RPSYIALGHIFPTQTKQMP---SSPQGLASLSRQVKNTPD---------------
THIE_YERPP       -----RPSYIALGHIFPTQTKQMP---SSPQGLASLSRQVKNTPD---------------
THIE_YERPS       -----RPSYIALGHIFPTQTKQMP---SSPQGLASLSRQVKNTPD---------------
THIE_YERP3       -----RPSYIALGHIFPTQTKQMP---SSPQGLASLSRQVKNTPD---------------
THIE_PHOLL       -----RPSYIALGHIFPTTTKAMP---SSPQGVEALKRQVENTPD---------------
THIE_RHIEC       -----APDYVALGPVWPTILKEMK---WAPQGVERLADWRRRVGP---------------
THIE_KORVE       -----TVDYLAIGPIFATKSKINP---DPVVGLDRLRAVRKLTSK---------------
THIE_AGRFC       -----PADYACIGGVFETVSKVNP---DKPVGIEGFTTLRALLKEWQ-------------
THIE_SALAI       AA---GASYLGVGSVHPTTSKDGL---PPPIGAAGLRAVAAAVS----------------
THIE_SALTO       AA---GASYLGVGPVHPTTSKEGL---PPAIGVAGVGVVAAAVS----------------
THIE_SALRD       EQ---GADYIGFGPVFPTTSKRNP---KSVKGPDGLADACEAVP----------------
THIE_MYXXD       AA---GADYVGLGPVFPTSTKQVP---APVLGLEAFASVVRDSP----------------
THIE_ANADE       AE---GADHVGYGPIFASRSKALP---VPPRGLAALAEVARALP----------------
THIE_BACFN       AA---GADYLGIGPFRFTTTKKNL---SPVLGLEGYTSILAQMNEAGIR-----------
THIE_BACFR       AA---GADYLGIGPFRFTTTKINL---SPVLGLEGYTSILAQMNEADIR-----------
THIE_BACTN       RA---GADYLGIGPFRFTTTKKNL---SPVLGLEGYTAILSQMKEANIE-----------
THIE_PHOV8       KA---GADYIGCGPFRFTTTKKDL---SPVLGLEGYRSIILQMKEANIH-----------
THIE_FLAJ1       KN---GCNYIGLGPFRFTNTKEKL---SPILGLSGYFEILQKMKKNKIE-----------
THIE_FLAPJ       AE---NCNYIGLGPFQFTATKEKL---SPVLGLEGYHLIIQQMKTKKNK-----------
THIE_COREF       AE---VLDYIGAGPFRPTPTKDSG---RPPLGVEGYRELVELSR----------------
THIE_CORJK       AD---VIDYIGAGPFRPTPTKDSG---REPLGLEGYPALVEASR----------------
THIE_VIBCB       ---SLPIDYIGLSAIFATPTKTNT---KKHWGIDGLKMALETTSL---------------
THIE_VIBPA       ---SLPIDYIGLSAIFATPTKTNT---KKHWGIGGLKMALNTTSL---------------
THIE_RHOFT       ---ELPVDYLGVSPIFATPTKTDT---LPPWGLEGLRQVRRATTV---------------
THIE_CHLCV       ---TLPIDYLGLSALFATENKPEA---TDLWGFSGLEQAVSLCEH---------------
THIE_CHLAB       ---TLPIDYLGLSAMFATQNKPDA---TNLWGFSGLEQAVSLCEH---------------
THIE_AZOC5       ---LGPVDYVGCGPINATGTKGDA---GGAIGIEGFAFLRSHIAL---------------
THIE_PSYWF       H--LDLLDYVGLGPVFATATKQDH---AEPIGLEGLSTLSKASVL---------------
THIE_KINRD       ---PAVVDYLGVGPVRATATKPDA---AAPLGPEGLRAVVAAAPV---------------
THIE_PYRHO       ----KGADYLGAGSVFPTQTKKDV-KVIGIEGLREIVNAVKIPVV---------------
THIE_PYRAB       ----KGADYLGAGSVFPTKTKRDV-RVIRIEGLREIVEAVSIPVV---------------
THIE_PYRFU       ----KGADYLGAGSVFPTKTKEDA-RVIGLEGLRKIVESVKIPVV---------------
THIE_METMP       ----EGADYLGVGAVYSTNTKLDA-RDLGINGLKNISKIANLPIV---------------
THIE_METM5       ----EGADYLGVGAVYSTNTKLDA-RNLGLDGLKDISKIANLPIV---------------
THIE_METM7       ----EGADYLGVGAVYSTNTKLDA-RNLGIDGLKSISKLSKLPIV---------------
THIE_METVS       ----EGADYLGVGSVYPTNTKLDA-RYLGLNGLKELSNCSNLPVV---------------
THIE_ARCFU       ----RFADYLGVGPVFPTKTKEDAGEAIGIEGLRRIVESVSVPVV---------------
THIE_CALMQ       ----AGADYLGAGSIFPSPTKPDY-RILGLEGLRRVVQSVSIPVY---------------
THIE1_AQUAE      ----LPVDYIGFGSIYHTSTKENY-KLVGVEALKEAVKISQKPIV---------------
THIE_THEAC       ----NGADYVAFGPFFHTDTKK----DADVYDIHVLEGIHKYIRIPVF------------
THIE_THEVO       ----KGASYVAFGSFFHTDTKK----DAGIYDIKILEKARHFVKIPIF------------
THIE_PICTO       ----LGADYIAFGSFFKTSTKD----DAEMCDINILNNASKF-NIPVF------------
THIE_PSEP1       ----EGASYVAFGRFFNSVTKP----GAPAANVGLLEQARAQVKLPI-------------
THIE_PSEPK       ----EGASYVAFGRFFNSVTKP----GAPAANVGLLEQARAQVKLPI-------------
THIE_PSEPG       ----EGASYVAFGRFFNSVTKP----GAPAANVDLLEQARAQVKLPI-------------
THIE_PSEE4       ----EGASYVAFGRFFNSVTKP----GAPAASLELLEQARARVKLPI-------------
THIE_PSEF5       ----EGASYVAFGRFFNSTTKP----GAPAASLELLDQARASLHLPI-------------
THIE_PSEPF       ----EGASYVAFGRFFNSNTKP----GAPSCSLDLLDEAKRTLHLPI-------------
THIE_PSE14       ----DGATYVAFGRFFNSLTKP----GAPAVPLDLIAQVRARVHLPI-------------
THIE_PSEU2       ----DGATYVAFGRFFNSLTKP----GAPAVPLDLIAQVRARVHLPI-------------
THIE_PSESM       ----DGATYVAFGRFFNSQTKP----GAPAVPLDLIAQVRARVHLPI-------------
THIE_PSEAB       ----EGASYVAFGRFFNSSTKP----GAPAASVELLDQARPRLHLPI-------------
THIE_PSEAE       ----EGASYVAFGRFFNSSTKP----GAPAASVELLDQARPRLHLPI-------------
THIE_PSEA7       ----DGASYVAFGRFFNSSTKP----GAPAASVELLDQARPRLHLPI-------------
THIE_PSEU5       ----DGASYVAFGRFFQSHTKP----GAPAANHELLREARARIGLPI-------------
THIE_PSEMY       ----EGASYIAFGRFFNSNTKP----GAPAATVELLDQARTRFAQPI-------------
THIE_MARN8       ----GGADYLAFGRFYDSATKP----GAPPASPDVLTEAKA-LGLPI-------------
THIE_SACD2       ----QGSSYVAFGRFFASNTKP----NAAPAQLSLLAHAQQKFTCPI-------------
THIE_ALCBS       ----AGADYLAMGRFFTSHTKP----LAPPASLALLRQACQQFHQPV-------------
THIE_NITOC       ----AGADYVAFGRLFPSITKP----EPIWASLALLREARKNLNLPI-------------
THIE_HALHL       ----EGADYVAFGSIFPSPTKP----ESGLAPMELLRSGREATGCPT-------------
THIE_NITEU       ----AGADYVAFGAFYPSMTKT----GTYQAPIELLTAAKKKLGIP--------------
THIE_NITEC       ----AGADYVAFGAFYPSMTKV----DAYQAPIHLLDAAKKTLNIP--------------
THIE_NITMU       ----NGADYVAFGAFFNSVTKT----DTVPASIDLLRQGNLEIRIP--------------
THIE_METCA       ----EGANYVAFGALFPSATKP----CASRARLETLREAGTRLQIP--------------
THIE_AROAE       ----AGADYVAFGAVFPSATKP----AAVRAPLELFVRGRRELDVP--------------
THIE_AZOSB       ----AGADYVAFGAMFPSSTKP----GAVRAPLTLLTRARAALDCP--------------
THIE_DECAR       ----AGADYVAFGAVYPSPTKP----QAANATTELFVRAKAELPAA--------------
THIE_THIDA       ----AGADYVAFGSFYPSPTKP----AAARADVALLARASRHIALP--------------
THIE_METFK       ----LGADYVAFGACFPSSTKP----DAPRADIALFAKA-RELGLP--------------
THIE_CHRVO       ----AGASYVAFGAVFPSRTKP----HAAAAPLSLFADA-AALGAN--------------
THIE_BORPA       ----AGADYVAFGTVFASPTKP----EAVHAPLQTLTEARARVLACPAPRP---------
THIE_BORPE       ----AGADYVAFGTVFASPTKP----EAVHAPLQTLTEARARVLACPAPRP---------
THIE_BORBR       ----AGADYVAFGTVFASPTKP----EAVHAPLQTLTEARARLLACPAPRP---------
THIE_BORA1       ----QGADYIAFGAVFPSPTKP----QAAHAPLALLGEAAAQVRACGEPRP---------
THIE_XANCP       ----AGANYVAFGAFFPTATKV----TTRRATPALLHEA-AALGLP--------------
THIE_XANC8       ----AGANYVAFGAFFPTATKV----TTRRATPALLHEA-AALGLP--------------
THIE_XANAC       ----SGASYVAFGAFFPTTTKQ----TTRRATPALLQQA-AELDVP--------------
THIE_XYLFT       ----AGASYVGFGAFYPSHTKT----TPYRATPELLRQT-THLGVP--------------
THIE_XYLFA       ----AGASYVGFGTFYPSHTKT----TPYRATPELLRQT-THLGVP--------------
THIE_HYPNA       ----DGADYVAFGAFYPTTTKE----GTIPAELELLEVWQSAMILPC-------------
THIE_ERYLH       ----AGADYVAFGAFFDSATKDKG--DAEQPTLELLEWWSQVFEIPC-------------
THIE_WOLSU       ----EGASYVAFGSCFPSPTKP----ASSVIDLTLFKKAQEELAIPL-------------
THIE_METAC       ----NGADYVGLGSIFDTSTKKD---AGKGIGPASIKEVKNAIKIPV-------------
THIE_METMA       ----SGADYVGLGSIFDTFTKKD---AGKGIGPASIREVRNAIKISV-------------
THIE_METBF       ----LGADYVGLGPIFDTATKKD---AGEGIGPLKIREVKDAIKLPV-------------
THIE_CLOPE       ----EGADNLGVGALFSTNSKDD---ATL-MTLETLREIKSVSNIPL-------------
THIE_CLOP1       ----EGADNLGVGALFSTNSKDD---ATL-MTLETLREIKSVSNIPL-------------
THIE_CLOPS       ----DGADNLGVGALFSTNSKDD---ATL-MTLETLREIKSVSNIPL-------------
THIE_GEOKA       ---EAGADYLGVGPIYPTSSKEDA---KEAQGPDVLRRLREAGI----------------
THIE_GEOTN       ---EAGADYIGVGPIYPTRSKDDA---NEAQGPGILRHLREQGI----------------
THIE_BACAH       ---ENGADYLGVGPIFPTSTKKDT---KAVQGTKGLAHFREQGI----------------
THIE_BACAN       ---ENGADYLGVGPIFPTSTKKDT---KAVQGTKGLAHFREQGI----------------
THIE_BACHK       ---ENGADYLGVGPIFPTSTKKDT---KAVQGTKGLAHFREQGI----------------
THIE_BACCZ       ---ENGADYLGVGPIFPTSTKKDT---KAVQGTKGLAHFREQGI----------------
THIE_BACC1       ---ENGADYLGVGPIFPTSTKKDT---KAVQGTKGLAHFREQGI----------------
THIE_BACCR       ---ENGADYLGVGPIFPTSTKKDT---KAVQGTKGLAYFREQGI----------------
THIE_BACCN       ---ANGADYLGIGPIFPTNTKKDT---KAVQGLNGLRYFREKGI----------------
THIE_BACVZ       ---AAGADYVGMGPVYPTETKKDA---EAVQGVTLIEEVRRQGI----------------
THIE_BACSU       ---EDGADYVGLGPIYPTETKKDT---RAVQGVSLIEAVRRQGI----------------
THIE_BACLD       ---KDGADYIGAGPVYPTETKRDT---KAVQGVSLIQEIRRQGI----------------
THIE_BACP2       ---KDGADYVGMGPVYPTETKKDT---RSVQGVSLITEVRHHGL----------------
THIE_STRA5       ---LSVVDYIGIGPFNPTQSKADA---KPAVGNRTTKAVREINQ----------------
THIE_STRA1       ---LSVVDYIGIGPFNPTQSKADA---KPAVGNRTTKAVREINQ----------------
THIE_STRA3       ---LSVVDYIGIGPFNPTQSKADA---KPAVGNRTTKAVREINQ----------------
THIE1_STRR6      ---VEYVDYVGVGPVFDTQSKDDA---GGAIGYEGLELMRKLLP----------------
THIE1_STRPN      ---VEYVDYVGVGPVFGTQSKDDA---GGTIGYEGLELMRKLLP----------------
THIE_STRS2       ---IDLVDYIGSGPVFPTLSKDDA---SPAIGMDGLKQLRKLNS----------------
THIE_STAAM       ---LTHVDYIGVGPIYPTPSKHDA---HIPVGPEMIATFKEMNP----------------
THIE_STAA9       ---LTHVDYIGVGPIYPTPSKHDA---HIPVGPEMIATFKEMNP----------------
THIE_STAAN       ---LTHVDYIGVGPIYPTPSKHDA---HIPVGPEMIATFKEMNP----------------
THIE_STAA1       ---LTHVDYIGVGPIYPTPSKHDA---HIPVGPEMIATFKEMNP----------------
THIE_STAAC       ---LTHVDYIGVGPIYPTPSKHDA---HIPVGPEMIATFKEMNP----------------
THIE_STAAE       ---LTHVDYIGVGPIYPTPSKHDA---HIPVGPEMIATFKEMNP----------------
THIE_STAA2       ---LTHVDYIGVGPIYPTPSKHDA---HIPVGPEMIATFKEMNP----------------
THIE_STAA3       ---LTHVDYIGVGPIYPTPSKHDA---HIPVGPEMIATFKEMNP----------------
THIE_STAA8       ---LTHVDYIGVGPIYPTPSKHDA---HIPVGPEMIATFKEMNP----------------
THIE_STAAS       ---LTHVDYIGVGPIYPTPSKHDA---HIPVGPEMIATFKEMNP----------------
THIE_STAAW       ---LTHVDYIGVGPIYPTPSKHDA---HIPVGPEMIATFKEMNP----------------
THIE_STAAR       ---LTHVDYIGVGPIYPTPSKHDA---HTPVGPEMIATFKEMNP----------------
THIE_STAAB       ---LTHVDYIGVGPIYPTPSKHDA---HTPVGPEMIATFKEMNP----------------
THIE_STAEQ       ---LSKVDYIGVGPMYTTSSKDDA---SKPVGPSMISQLRLYIH----------------
THIE_STAES       ---LSKVDYIGVGPMYTTSSKDDA---SKPVGPSMISQLRLYIH----------------
THIE_STAHJ       ---LEHVDYIGVGPMFATISKNDA---NAPVGPSMIATLKNINP----------------
THIE_STACT       ---LTYVDYIGVGPIFATPSKDDA---SEPVGPKMIETLRKEVG----------------
THIE_STAS1       ---LAHVDYIGVGPMYATTSKDDA---NLPVGPEMITKLRAHVN----------------
THIE_OCEIH       ---LDLVDYIGVGPIFDTNTKEDA---KTAVGLEWIQSLKKQHP----------------
THIE_LISIN       ---LGSVDYIGVGPIFPTISKADA---EPVSGTAILEEIRRAGI----------------
THIE_LISMF       ---LGAVDYIGVGPIFPTISKADA---ESVSGTAILEEIRRAGI----------------
THIE_LISMO       ---LGAVDYIGVGPIFPTISKADA---EPVSGTAILEEIRRAGI----------------
THIE_LISW6       ---LGAVDYIGVGPIFPTISKADA---EPESGTEILKEIRRAGI----------------
THIE_HAEIN       ---LAEIDYFGIGPIFPTQSKENP---KPTLGMAFIQTLRNAGI----------------
THIE_HAEIG       ---LAEIDYFGIGPIFPTQSKENP---KPTLGMAFIQTLRNAGI----------------
THIE_HAEI8       ---LAEIDYFGIGPIFPTQSKENP---KPTLGMAFIQTLRNVGI----------------
THIE_HAEIE       ---LAEIDYFGIGPIFPTQSKENP---KPTLGMAFIQTLRNVGI----------------
THIE_PASMU       ---NPLIDYFGTGPIFPTQSKEDP---KPVVGVDFVSTIRAHGI----------------
THIE_HAES1       ---DPNVDYFGVGPIFPTQSKEDA---EPVLSPAFITQIRANHI----------------
THIE_ACTSZ       ---RLGIDYFGIGPIFATQSKADH---APAVGMEFIRQIHELGI----------------
THIE_MANSM       ---RQDIDYFGVGPIFPTNSKADH---SPLVGMNFIRQIRQLGI----------------
THIE_HELPH       ---LDAVAYFGVGPIFPTPSKKD----KQVVGVELLKKIRDSGV----------------
THIE_HELPY       ---LDAVAYLGVGPIFPTPSKKD----KQVVGVELLKKIKDSGI----------------
THIE_HELPJ       ---LDHIAYLGVGPIFPTPSKKDA---KEVVGVNLLKKIHDSGV----------------
THIE_LIMRD       ---MDFIDYIGCGPVFPTKSKSDA---DTAIGINRLERLNMIS-----------------
THIE_PEDPA       ---LDGIDYLGTGTVFETTSKADA---GAALGVAKLQELVELS-----------------
THIE_LACPL       ---LEGIAYLGSGPIFPTTSKADA---DPVVGLTGLRQLVMTA-----------------
THIE_LEVBA       ---IAGIDYIGSGPIFPTISKADA---DPVVGTAGLQKLVAQS-----------------
THIE_LATSS       ---QPALDYIGVGPIFPTNSKEDA---KTPLGLAQLKAFTQLS-----------------
THIE_LACLM       ---SSGADYLGIGPIYPTNSKNDA---AKPIGIKDLRLM-LLEN----------------
THIE_LACLS       ---SSGADYLGIGPIYPTNSKNDA---AKPIGIKDLRLM-LLEN----------------
THIE_LACLA       ---KSGADYLGIGPIYPTNSKSDA---AEPIGVDHLRKM-LEHN----------------
                             .       *                                       

THIE_ROSS1       ---LPVLGIGGINLAN-AASVIRAGAVGVAVISAVIGAP---DPEAATRALHAVIASALD
THIE_ROSCS       ---LPVLGIGGITVAN-AASVVRAGAVGVAVISAVIGAP---DPEAATRALCDVAAQR--
THIE_MOOTA       ---IPIVGIGGINPDN-AAGVIAAGADGVSVISAVIGAA---DVAAAARRLREVVTRARG
THIE_CHLAA       ---IPIVAIGGINQAN-AADVMRAGADGIAVVSAVVAAD---DVTAAARQLRALVSVTQE
THIE_METMJ       ---LPLVAIGGITAAN-VADVIAAGADGVAVISAVVGEG---DVTAAARSLRDRIAAAKA
THIE_METB6       ---VPVVAIGGITRDN-VAEVIAGGADSIAVISAVVGQP---DIVAAARDLRERITTAKE
THIE_METAR       ---IPVVAIGGINAAN-APEVLAAGADGLAVISAVVSQE---DVTAAARNLKAIISQYRL
THIE_METHJ       ---IPIIAIGGINLTN-AGDVLAAGADGIAVISAVICSP---DIAAASRKFADLMIHS--
THIE_CHLTE       ---LPVIAIGGIGHDN-AAEVIRAGASGIAVISAVSDSD---DPETATRELVRRIRQ---
THIE_CHLPD       ---IPLVAIGGINKMN-MMETIAAGASGIAMIAAISRTA---DPEGATRAITELLKGH--
THIE_CHLL3       ---IPLIAIGGITREN-AGPLISRGAAGIAVISAVTKAE---SPEEAARSLMAIMNTTRA
THIE_CHLPM       ---IPLIAIGGIQLEN-ARRVISCGASGIAVISAVSRHP---DPRIAAEALVREMEEGML
THIE_ALKCK       ---IPFVAIGGIKRHN-VREVIEAGAEAICVITEIVAAR---DVKAASQALLAAMEEASQ
THIE_ALKHC       ---IPFVAIGGIKLHN-VEQVLDAGATRICMISEIVGAE---DVKGTCEVFSTILEQRGI
THIE_PELTS       ---LPFVAIGGIKEHN-IAEVSSRGAKCIALVTEIVGAE---DIKAKVRALRAIISRKED
THIE_LAWIP       ---IPFVAIGGIKQHN-IQEVIQHGAKCCALVSEILSAP---NIPLRIQELRQAILLAHT
THIE_CALS8       ---IPFVAIGGIKEHN-LKDVLKAGAKCVSLVTEIVGSD---DISQKIKKLWDIIKEFER
THIE_CLOTE       ---IPIVAIGGINENN-VQKLKETNIDGIAVISTILGKE---DVKKACEELTGFFNE---
THIE_ALKOO       ---IPVVGIGGICEDN-IKTIMEVGIDGVAIVSAILGKE---NIKEAAESLKASIK----
THIE_CLOB8       ---IPIVVIGGINKDR-VKDFKGIGIDGLAIVSAIIAKE---DITTAAKELKNEFIKI--
THIE_CLOD6       ---MPFVLIGGINLDN-IDKLKCLESDGYAIISAILKAE---DISKEVEKWTLKI-----
THIE_CLOAB       ---IPVVGIGGINEEN-ANKVIETGVDGISVISGILSAQ---KIKDKARVMFDIVKKNST
THIE_ALKMQ       ---IPIVGIGGISQGN-ASQVIQSGADGIAVVSAILSKQ---YPEIAAKNLYLKTQNK--
THIE_METS3       ---IPVVAIGGITQEN-AHELNDCGIDGLSVVSAIMEAK---NPKIASENLLKEFKAKNS
THIE_FUSNN       ---IPVFAIGGININN-VWMLKNIGLQGVCSVSGILSEK---DCKKAVENILKNFN----
THIE_CLOB1       ---IPSVAIGGINKTN-FKDVLKTGIEGISVISAILDED---DIKLAANNLLINK-----
THIE_CLOBH       ---IPSVAIGGINKTN-FKDVLKTGIEGISVISAILDED---DIKLAANNLLINK-----
THIE_CLOBL       ---IPSVAIGGINKTN-FKDVLKTGIEGISVISAILDED---DIKLAANNLLINK-----
THIE_CLOBK       ---IPSVAIGGINKTN-FKDVLKTGIEGISVISAILDED---DIKLAANNLLINK-----
THIE_CLOBM       ---IPSVAIGGINKTN-FKDVLKTGIEGISVISAILDED---DIKLAANNLLINK-----
THIE_CALS4       ---IPVVAIGGVNKTNAYEVILHSGVDGISAIAGIFD-G---DIEANTKDMLREIRRAFK
THIE2_STRPN      ---IPVVAIGGLTSEN-IDQLMGTGIAGVAVVRDLMQAE---DIEAKTQAFLKKLHNILS
THIE2_STRR6      ---IPVVAIGGLTSEN-IDQLMGTGIAGVAVVRDLMQAE---DIEAKTQAFLKKLHNILS
THIE_LACP3       ---VPVVAIGGVKEAN-LATFKDTGIAGVAIVSEIMQAP---DIAHKVQALRTKLKAVLP
THIE_ENTFA       ---IPVVAIGGIKEEN-IEQLMGTGVAGVSLVSEIMLAE---QITEKVQGLMRVTERMLE
THIE_CAMJ8       ---IGVVAIGGVDKAV-LDELKGINLSGVAVVRAIMDAK---DAFLAAKELKRKIYENLP
THIE_CAMJJ       ---IGVVAIGGVDKAV-LDELKGINLSGVAVVRAIMDAK---DAFLAAKELKRKIYENLP
THIE_CAMJR       ---IGVVAIGGIDKEA-LVELKGINLSGVAVVRAIMDAK---DAFLAAKELKRKIYENLS
THIE_CAMJE       ---IGVVAIGGIDKEA-LVELKGINLSGVAVVRAIMDAK---DAFLAAKELKRKIYENLS
THIE_DESHY       ---LPVVGIGGIGAAN-LRAVKETGIDGVSVISAILSQE---DPCAAAKGLMDLWRN---
THIE_SYNWW       ---IPLVAIGGINKEN-LKMIKETGADGAAVISALMGAS---DIEGEARKLRQIWERN--
THIE_NATPD       ---LPFVGIGGVTPDN-AAPVVEAGADGVAVISAITAAD---DPEHATRRLADAVEGVAP
THIE_HALWD       ---IPVIGIGGITPSN-TTEVIRAGADGVAVVSAITTAD---DPAAATRKLQGSVDTASV
THIE_HALMA       ---IPFVGIGGITAGN-ATAVVDAGADGVAVITEITKAD---DPAAAAEALHSAVEQGR-
THIE_STRAW       ---RPWFAIGGIDLGN-LDEVLEAGARRVVVVRAITEAD---DPKAAAEEFAKRLRHA--
THIE_STRCO       ---RPWFAIGGIDLGN-LDEVLEAGARRVVVVRAITAAE---DPGAAAAEFARRLRQAPA
THIE_ACIC1       ---RPWFAIGGINLQN-LDEVLEAGARRVVVVRAIADAP---DPAEAAAEFAARLAAAA-
THIE_THEFY       ---RPWFAIGGINEDN-LDQVLAAGARRAVVVRAITEAE---DPRAAAAELKRRLVAAAA
THIE_SACEN       ---RPWFAIGGIGMDN-IDEVVQAGARRVVVVRAITEAE---DPRAAAAALRTKLG----
THIE_MYCTA       ---KPWFAIGGINAQR-LPAVLDAGARRIVVVRAITSAD---DPRAAAEQLRSALTAAN-
THIE_MYCBO       ---KPWFAIGGINAQR-LPAVLDAGARRIVVVRAITSAD---DPRAAAEQLRSALTAAN-
THIE_MYCTU       ---KPWFAIGGINAQR-LPAVLDAGARRIVVVRAITSAD---DPRAAAEQLRSALTAAN-
THIE_MYCBP       ---KPWFAIGGINAQR-LPAVLDAGARRIVVVRAITSAD---DPRAAAEQLRSALTAAN-
THIE_MYCPA       ---KPWFAIGGIDAQR-LPEVLDAGARRVVVVRAITAAD---DPAAAARRLSSALAAAR-
THIE_MYCA1       ---KPWFAIGGIDAQR-LPEVLDAGARRVVVVRAITAAD---DPAAAARRLSSALAAAR-
THIE_MYCUA       ---KPWFAIGGIDGLR-LPEVLAAGARRIVVVRAITAAD---DPREAAAKLKSELLAAI-
THIE_MYCLE       ---KPWFAIGGIDAQR-LPDVLHAGARRIVVVRAITAAA---DPRAAAEQLISTLTATS-
THIE_MYCSS       ---KPWFAIGGIDEAR-LPEVLDAGARRIVVVRAITAAD---DPKAAARRLKDALVSR--
THIE_MYCSK       ---KPWFAIGGIDEAR-LPEVLDAGARRIVVVRAITAAD---DPKAAARRLKDALVSR--
THIE_MYCSJ       ---KPWFAIGGIDEAR-LPEVLDAGARRIVVVRAITAAD---DPKAAARRLKDALVSR--
THIE_MYCS2       ---KPWFAIGGIDQER-LPEVLAAGARRVVVVRAITAAD---DPKAAAEDLKAAISAAG-
THIE_MYCVP       ---KPWFAIGGIDAER-LPEVLDAGARRVVVVRAITAAD---DPGAAAQRLAGMLSAAG-
THIE_MYCGI       ---KPWFAIGGIDAQR-LPDVLDAGARRVVVVRAITAAE---DPRAAAEQLAGMLDSAV-
THIE_NOCFA       ---RPWFAIGGIDLER-LPELLAAGADRIVVVRAITEAR---DPEAAARALKSALLAAS-
THIE_ARTS2       GPRLPWFAIGGIDLGN-VEQVAAAGAERIVVVRAITEAD---DPAAAARSLLAALDAGAS
THIE_THET8       ---KPWYAIGGIDLGN-LDQVLEAGARRIVVVRAILDAP---DPERAARALRERLYGVA-
THIE_THET2       ---KPWYAIGGIDLGN-LDQVLEAGARRIVVVRAILDAP---DPERAARALRERLYGVA-
THIE_DEIGD       ---VPWYAIGGVDLST-VDDVVAAGATRVAVVRAVLDAP---DPARAAADLLARLPDAWE
THIE_NEIMA       ---TPVVAIGGIDLNN-ARAVLATGVSSLAAVRAVTKAA---NPEAVVKAFQALWDG---
THIE_NEIMB       ---TPVVAIGGIDLNN-ARAVLATGVSSLAAVRAVTEAA---NPEAVVKAFQALWDG---
THIE_NEIG1       ---TPVVAIGGIDLNN-ARAVLATGVSSLAAVRAVTEAA---NPEAVVKAFQALWDG---
THIE_SALTY       ---YPTVAIGGISLER-APAVLATGVGSIAVVSAITQAA---DWREATAELLAIAGVGDE
THIE_SALPB       ---YPTVAIGGISLER-APAVLATGVGSIAVVSAITQAA---DWREATAELLAIAGVGDE
THIE_SALCH       ---YPTVAIGGISLER-APAVLATGVGSVAVVSAITQAA---DWREATAQLLAIVGVGDE
THIE_SALPA       ---YPTVAIGGISLEH-APAVLATGVGSIAVVSAITQAA---DWRDATAQLLAIAGVGDE
THIE_SALTI       ---YPTVAIGGISLER-APAVLATGVGSIAVVSAITQAA---DWRAATAQLLAIAGVGDE
THIE_CITK8       ---YPTVAIGGISLER-ASPVLKTGVGSIAVVSAITRAE---DWREATAQLLAIAGAGDE
THIE_SHIF8       ---YPTVAIGGISLAR-APAVIATGVGSIAVVSAITQAA---DWRLATAQLLEIAGVGDE
THIE_SHIFL       ---YPTVAIGGISLAR-APAVIATGVGSIAVVSAITQAA---DWRLATAQLLEIAGVGDE
THIE_ECOHS       ---YPTVAIGGVSLAR-APAVIATGVGSIAVVSAITQAA---DWRLATAQLLEIAGVGDE
THIE_SHISS       ---YPTVAIGGISLAR-APAVIATGVGSIAVVSAITQAA---DWRLATAQLLEIAGVGDE
THIE_ECOLI       ---YPTVAIGGISLAR-APAVIATGVGSIAVVSAITQAA---DWRLATAQLLEIAGVGDE
THIE_ECO24       ---YPTVAIGGISLAR-APAVIATGVGSIAVVSAITQAA---DWRLATAQLLEIAGVGDE
THIE_ECOLC       ---YPTVAIGGISLAR-APAVIATGVGSIAVVSAITQAA---DWRLATAQLLEIAGVGDE
THIE_SHIBS       ---YPTVAIGGISLAR-APAVIATGVGSIAVISAITQAA---DWRLATAQLLEIAGVGDE
THIE_ECO57       ---YPTVAIGGISLAR-APAVIATGVGSIAVVSAITQAA---DWRLATAQLLEIAGVGDE
THIE_SHIDS       ---YPTVAIGGISLPR-APAVIATGVGSIAVVSAITQAA---DWRLATAQLLEIAGVGDE
THIE_ECOUT       ---YPTVAIGGISLAR-APAVIATGVGSIAVVSAITQAA---DWRLATAQLLEIAGVGDE
THIE_ECOK1       ---YPTVAIGGISLAR-APAVIATGVGSIAVVSAITQAA---DWRLATAQLLEIAGVGDE
THIE_ECOL5       ---YPTVAIGGISLAR-APAVIATGVGSIAVVSAITQAA---DWRLATAQLLEIAGVGDE
THIE_ECOL6       ---YPTVAIGGISLAR-APAVIATGVGSIAVVSAITQAA---DWRLATAQLLEIAGVGDE
THIE_SALAR       ---YPTVAIGGISLKR-APAVLATGVGSIAVVSAITQAA---DWRAATAQLLAIAGVGDE
THIE_KLEP7       ---YPTVAIGGISLEK-APGVLATGVGSIAVVSAITQAA---DWRAATDQLLALAGAGDE
THIE_ENT38       ---YPTVAIGGISLER-VPAVLKTGVGSVAVVSAITQAA---DWQVATAQLLQLAGAGDE
THIE_CROS8       ---YPTVAIGGISLER-APAVLETGVGSIAVVSAITQAP---DWRGATQRLLELAGVGDE
THIE_SERP5       ---YPTVAIGGISIDR-VAAVLDCGVGSVAVVSAITQAP---DWRAATAQLLQLIEGKE-
THIE_PECAS       ---FPTVAIGGISIDR-VPAVLATGVGSIAVVSAITQAP---DWRQATATLLKMIEGREA
THIE_YERPA       ---YPTVAIGGISIER-VPHVLATGVGSVAVVSAITLAS---DWQRATAQLLHLIEGKEL
THIE_YERPE       ---YPTVAIGGISIER-VPHVLATGVGSVAVVSAITLAS---DWQRATAQLLHLIEGKEL
THIE_YERPN       ---YPTVAIGGISIER-VPHVLATGVGSVAVVSAITLAS---DWQRATAQLLHLIEGKEL
THIE_YERPP       ---YPTVAIGGISIER-VPHVLATGVGSVAVVSAITLAS---DWQRATAQLLHLIEGKEL
THIE_YERPS       ---YPTVAIGGISIER-VPHVLATGVGSVAVVSAITLAS---DWQRATAQLLHLIEGKEL
THIE_YERP3       ---YPTVAIGGISIER-VPHVLATGVGSVAVVSAITLAS---DWQRATAQLLHLIEGKEL
THIE_PHOLL       ---YSTVAIGGISLER-VPDVIATGVGSVALVSAITKAK---DWRQATAQLLYLVEGIEL
THIE_RHIEC       ---MPLVAIGGITAER-APLVLENGADSAAVVTDITRNP---DPEARTRQWLAATAPWRS
THIE_KORVE       ----PLVAIGGITREN-CRSVIDAGADSVAVIADLLVD-----PRQRASEFLQILHS---
THIE_AGRFC       -PDMPVGAIAGIDLDR-VPAVIAAGADGVAVISAIFRAA---NIASATSDFRSAIDAALK
THIE_SALAI       ---VPVIAIGGVTAAD-VPDLRAAGAYGVAVIAALSHAA---DPARATAAFVEALTC---
THIE_SALTO       ---VPVIAIGAVTAAD-VPVLRAAGAYGVAVIGALSHAA---DPAGATAALLEALTW---
THIE_SALRD       ---IPVIAIGGITHDR-VRSVLEAGAHGVAVLSAVDTAR---NPEQATARFRAAIDGVLR
THIE_MYXXD       ---LPVVGIGGVGLVN-IASVAAAGAHCAAVVSDALLAA---DITERVRRLVEAFEQGRF
THIE_ANADE       ---APVVAIGGIGLDD-VAAVARAGAACAAVIEAVLGAA---DPEAAAARMQAAFEAGRA
THIE_BACFN       ---IPVVAIGGIVAED-IPAIMETGVNGIALSGAILQAP---DPVEETKRILNI------
THIE_BACFR       ---IPVVAIGGIVAED-IPAIMETGVNGIALSGAILQAP---DPVEETKRILNI------
THIE_BACTN       ---LPVVAIGGITRED-IPAILETGVNGIALSGTILRAE---DPAAETRKILNMKRIIK-
THIE_PHOV8       ---LPIVAIGGITLED-IPSIMETGITGIALSGTILRAK---DPVAETKRIMNL------
THIE_FLAJ1       ---VPVYAIGGITLKD-INPLMETGIHGIAVSGIITESD---EKKILIQQLNEKLYANVI
THIE_FLAPJ       ---IPIYAIGGIQLEN-VDDIMKTGIYGIAVSGLITQSE---NPFQLITQLNKKL-----
THIE_COREF       ---LPVVAIGDVTADD-APALADTGVAGLAVVRGLMESA---DPTGYARRLITGFGEGRQ
THIE_CORJK       ---VPVVAIGDVHAED-AADLAATGVAGLAIVRGIMQAE---NPKAYAESVVSQFSEANE
THIE_VIBCB       ----PIVAIGGINESN-IPQLSATGVHGLALVSAICHAE---DPKAASEYLLGLMR----
THIE_VIBPA       ----PIVAIGGINETN-IPALSATGVHGLALVSAICHAE---NPTKAAEYLLSLMD----
THIE_RHOFT       ----PLVAIGGIHVGN-AREVLLAGADGLAVVSALCAAQ---DPCVAALRLRQLIDAV--
THIE_CHLCV       ----PIVAVGGIDESN-AGNVVEAGAAGIAAIGAFHSAH---NPGLATKALREIVDRGLR
THIE_CHLAB       ----PIVAIGGIDESN-ASKVIDAGAAGIAAIGVFHSAQ---NPSSVTKALREIVDRGLR
THIE_AZOC5       ----PMVGIGGLKAED-AEAVMQAGANGIAVVSALCAAP---DVTEAARTLKTIIETSRR
THIE_PSYWF       ----PTVAIGGINHAN-ARQVYQTGCHGIAVVSAICAAD---DPKQAAELLIAQR-----
THIE_KINRD       ----PCVAIGGIHPDN-LDALRGSGIAGFCVVSEVCAAA---DPEAAARALRTQWHGRAS
THIE_PYRHO       -------AIGGINLEN-VREVLLTGVDGIAVVSAVMGTE---DVKRATEGLRRIIEEVLG
THIE_PYRAB       -------AIGGINVEN-VKQVLSAGVDGIAVVSAVMGAS---DVKKATEELRKIIEEVLG
THIE_PYRFU       -------AIGGINKDN-AREVLKTGVDGIAVISAVMGAE---DVRKATEELRKIVEEVLG
THIE_METMP       -------AIGGINHSN-VENVLKCGVSGVAVVSAIVGAE---NILKSAENMNELIKKYIK
THIE_METM5       -------AIGGINHSN-VENVLECGVSGVAVVSAIVGAE---NILKSAENMHELIKKYIK
THIE_METM7       -------AIGGINHSN-VQNVLECGVSGVAVVSAIVGAE---NILKSAENMNELIKKYIK
THIE_METVS       -------AIGGINHEN-VKEVLMCGVSGVAVVSAIVGAN---DIIFSAKKMNEIIKKYI-
THIE_ARCFU       -------AIGSINKQN-AIEVLKTGVAGIAVISAIAAAD---DPERAARELVELVRRFKS
THIE_CALMQ       -------AIGGVTLES-IPAIKATGAWGAAVISGILAAK---DPLEMAKRFVKAWDEA--
THIE1_AQUAE      -------CIGGIMPYR-VPEVVRAGCRNIAVSSGILGFA---DVKKAAESIKRAYQETLR
THIE_THEAC       -------VIGGINISN-IRTFSGYGIDGVAVVSAIFSDP---DPERAARELKAALYNYVL
THIE_THEVO       -------VIGGINLET-ITKFCGYSIDGIAVVSAILAAE---NVKKAAKELKEKVEDIIN
THIE_PICTO       -------AIGGINTRN-VDELLKYKISGIAVVSAIFDAA---NPGEATRTFLEKLRKIL-
THIE_PSEP1       ------AVIGGITLDN-AAPLVAHGADLLAVIHGLFGADSAQEVTRRARAFNALFAS---
THIE_PSEPK       ------AVIGGITLDN-AAPLVAHGADLLAVIHGLFGADSAQEVTRRARAFNALFAS---
THIE_PSEPG       ------AVIGGITLDN-AAPLVAHGADLLAVIHGLFGADSAQEVTRRARAFNALFAS---
THIE_PSEE4       ------AVIGGITLDN-AAPLVAHGADLLAVIHGLFGADSAQEVTRRARAFNALFAS---
THIE_PSEF5       ------CVIGGITLDN-AAPLVNHGADLLAVVHGLFGAESAEEVTRRARAFNALFNS---
THIE_PSEPF       ------CAIGGITLDN-AAPLVAHGVDLLAVVHGLFGANSTAEVTRRARAFNELLKV---
THIE_PSE14       ------AVIGGITLEN-APQLVEHGADLLAVVHGLFGAENAQEVTRRAKAFMALL-----
THIE_PSEU2       ------AVIGGITLEN-APQLVEHGADLLAVVHGLFGAENTQEVTRRAKAFTALL-----
THIE_PSESM       ------AVIGGITLEN-APQLVEHGADLLAVVHGLFGAETPQEVTRRAKAFMALL-----
THIE_PSEAB       ------TAIGGISLDT-APGLIARGVDLVAVIHALFAAASAAEVERRARAFSALFEPA--
THIE_PSEAE       ------TAIGGISLDT-APGLIARGVDLVAVIHALFAAASAAEVERRARAFSALFEPA--
THIE_PSEA7       ------TAIGGISLDT-APGLIARGVDLIAVIHALFAAASAAEVERRARAFSALFETA--
THIE_PSEU5       ------VAIGGITLDT-APSLIAEGVQMIAVIHALFAADSAAEVERRAQAFSQLFNTP--
THIE_PSEMY       ------VAIGGVTLDN-APGLIARGASMVAVIHALFAADSALEVQDRARAFAALFD----
THIE_MARN8       ------TAIGGITGNN-AEPLIRAGADLVAVVGGLFGGQPS-DIEARAKAFNRQFARHHP
THIE_SACD2       ------VAIGGITPSN-GAQLLHAGATTLAVCHSLFA---DDNVEYRAKCLLGLTPNAED
THIE_ALCBS       ------VAIGGVNPDN-APQLINAGAVSVAVIHALFGQTDTDAIEAAARQLSACFQTNRS
THIE_NITOC       ------VAIGGITPEN-ALQVIEAGASAVAVIGGLFKSRDIRAAAAAYRQHFPSWNLPKP
THIE_HALHL       ------VAIGGIDAGN-IHEVAAAGADAAAVVSALFAAE---DPEAAARQLVAQWQRSR-
THIE_NITEU       -----VVAIGGIDLDN-AGMLIASGCDAVAVSQALFGAQ---DIQSAARYFSELFD----
THIE_NITEC       -----IVAIGGINLDN-AEALIARGCDAVAVSQALFSAQ---DIQSAARHFSKLFC----
THIE_NITMU       -----IVAIGGINSDN-ALELISAGADAVAVSNALFGAR---DIRSEAAKFSGLFKRQSF
THIE_METCA       -----IAAIGGIDTTN-AGQVIGAGADLVAAVEAVFGAA---DVARAARELCSLFHAPRK
THIE_AROAE       -----LAAIGGITLDN-AAQVIAAGASLLAVVSDVFDAP---DPGARAAAYRTLFDA---
THIE_AZOSB       -----VAAIGGITLDN-APALIEAGADLLAVISDVFAAA---DPLQRALAYSALFA----
THIE_DECAR       -----TCAIGGITLDN-APPLIVAGADLLAVITDLFSAP---DIMARAAAYQRLFEEAHS
THIE_THIDA       -----VVAIGGITAAN-AAPLIDAGADSLAVLSALFDAP---DVRRAAAELNRLFAAEPE
THIE_METFK       -----IVAIGGITLDN-AAGIISAGADAVAVIGALWTAA---DIEARARQFHQLFN----
THIE_CHRVO       -----AVAIGGIAAGN-AGRAVEAGADAIAVIGGLFDAD---DTAAAARALAGWFGAR--
THIE_BORPA       ----AVVAIGGITPAN-VSQVAQAGADSAAVISGLFEAP---DIQAAARACAAAFSVNP-
THIE_BORPE       ----AVVAIGGITPAN-VSQVAQAGADSAAVISGLFEAP---DIQAAARACAAAFSVNP-
THIE_BORBR       ----AVVAIGGITPAN-VSQVAQAGADSAAVISGLFEAP---DIQAAARACAAAFSVNP-
THIE_BORA1       ----AVVAIGGITPAN-AGLVAAAGADSIAVITGLFEAP---DIRAAAQACAAPFPLTD-
THIE_XANCP       -----RVAIGGITPSQ-VPELVTAGADLIAVVSGVYAAA---DPVAAVQAYRAGFTQ---
THIE_XANC8       -----RVAIGGITPSQ-VPELVTAGADLIAVVSGVYAAA---DPVAAVQAYRAGFTQ---
THIE_XANAC       -----RVAIGGIAPAQ-VPALVTAGADLIAVVSGVYAAP---DPVAAVQGYRAGFAAQRG
THIE_XYLFT       -----RVAIGGLTPKN-IAPIIEAGAELLAVISGIYSAK---NPITALKAYQSQFNI---
THIE_XYLFA       -----RVAIGGLTPKN-IAPIIEAGAELLAVISGIYSAK---NPVTALKAYQSQFNI---
THIE_HYPNA       ------VAIGGITVSN-AAPLVTAGADFLAVSSGVWNHEDG--PAAAVRAFNALFESLA-
THIE_ERYLH       ------VAIGGITPDN-CQPLIEAGADFLAVSGAVWSGDE----RAAVQAFAEQIAAA--
THIE_WOLSU       ------CAIGGIEAQN-VGELIH--CDMIAVISSLWSGGVA-QVRKNAKGLIQSWRENRE
THIE_METAC       ------VAIGGINREN-CIPVVENGADSFVAISAVVCSD---DVKRETRKFIEIIREIKN
THIE_METMA       ------VAIGGINKEN-CRSVIENGADSLVAISAVVCSD---DVKKETREFIDIIREIKG
THIE_METBF       ------VAIGGINKEN-CESVIQNGADSLVAISAVVCSN---DVKREAKYFIDMIRRTRK
THIE_CLOPE       ------YGIGGITPYN-LNKDILENLDGVAVISALLNSD---NIREKSKEFLNILSK---
THIE_CLOP1       ------YGIGGITPYN-LNKDILENLDGVAVISALLNSD---NIREKSKEFLNILSK---
THIE_CLOPS       ------YGIGGITPYN-LNKDILENLDGVAVISALLNSD---NIREKSKEFLNILSK---
THIE_GEOKA       --TIPIVAIGGITAAN-AKTVVEAGADGVSVISAIASAP---SPKAAAAALAEAVRAART
THIE_GEOTN       --TIPIVAIGGITADN-TRAVIEAGADGVSVISAIASAP---EPKAAAAALATAVREANL
THIE_BACAH       --TIPIVGIGGISIEN-TASVIEAGADGVSVISAISLAE---SSYESTKKLVEEVSRSL-
THIE_BACAN       --TIPIVGIGGISIEN-TASVIEAGADGVSVISAISLAE---SAYESTKKLVEEVSRSL-
THIE_BACHK       --TIPIVGIGGISIEN-TALVIEAGADGVSVISAISLAE---SAYESTKKLVEEVSRSL-
THIE_BACCZ       --TIPIVGIGGISIEN-TASVIEAGADGISVISAISLAE---SAYESTKKLVEEVSKSL-
THIE_BACC1       --TIPIVGIGGISIEN-TASVIEAGADGVSVISAISLAE---SAYESTKQLVEEVSKKGT
THIE_BACCR       --TVPIVGIGGITIEN-TAAVIEAGADGVSVISAISLAE---SAYESTRKLAEEVKRSL-
THIE_BACCN       --NIPIVGIGGITIEN-ASSVIEAGADGVSVISAISLAS---SAFDSAKAFVHQVKK---
THIE_BACVZ       --TIPIVGIGGITADN-AAPVIEAGADGVSMISAISQAE---DPKAAARKFSEEIRRSKA
THIE_BACSU       --SIPIVGIGGITIDN-AAPVIQAGADGVSMISAISQAE---DPESAARKFREEIQTYKT
THIE_BACLD       --GIPVVGIGGITVEN-CVPVIEAGADGISVISAISKAA---DPKQAAEAFSEKVQATKQ
THIE_BACP2       --HIPIVGIGGIAYDN-AAPVIQAGADGISIISAISQSA---DPKKAAEELRALVTSEKA
THIE_STRA5       --DIPIVAIGGITSDF-VHDIIESGADGIAVISAISKAN---HIVDATRQLRYEVEKALV
THIE_STRA1       --DIPIVAIGGITSDF-VHDIIESGADGIAVISAISKAN---HIVDATRQLRYEVEKALV
THIE_STRA3       --DIPIVAIGGITSDF-VHDIIESGADGIAVISAISKAN---HIVDATRQLRYEVEKALV
THIE1_STRR6      --QMPLVAIGGIQTKH-IKDIIKTNMDGVSIISAISYAK---NIEKTVREMSEQ------
THIE1_STRPN      --QMPLVAIGGIQTKH-IKDIIKTNMDGVSIISAISYAK---NIEKTVREMSEQ------
THIE_STRS2       --DIPMVAIGGLSAKD-CKEVLQAGADGIAVISAISHAE---DPYKATKILVDGMQAMIL
THIE_STAAM       --QLPIVAIGGINTNN-VAPIVEAGANGISVISAISKSE---NIEKTVNRFKDFFNN---
THIE_STAA9       --QLPIVAIGGINTNN-VAPIVEAGANGISVISAISKSE---NIEKTVNRFKDFFNN---
THIE_STAAN       --QLPIVAIGGINTNN-VAPIVEAGANGISVISAISKSE---NIEKTVNRFKDFFNN---
THIE_STAA1       --QLPIVAIGGINTNN-VAPIVEAGANGISVISAISKSE---NIEKTVNRFKDFFNN---
THIE_STAAC       --QLPIVAIGGINTNN-VAPIVEAGANGISVISAISKSE---NIEKTVNRFKDFFNN---
THIE_STAAE       --QLPIVAIGGINTNN-VAPIVEAGANGISVISAISKSE---NIEKTVNRFKDFFNN---
THIE_STAA2       --QLPIVAIGGINTNN-VAPIVEAGANGISVISAISKSE---NIEKTVNRFKDFFNN---
THIE_STAA3       --QLPIVAIGGINTNN-VAPIVEAGANGISVISAISKSE---NIEKTVNRFKDFFNN---
THIE_STAA8       --QLPIVAIGGINTNN-VAPIVEAGANGISVISAISKSE---NIEKTVNRFKDFFNN---
THIE_STAAS       --QLPIVAIGGINTNN-VAPIVEAGANGISVISAISKSE---NIENTVNRFKDFFNN---
THIE_STAAW       --QLPIVAIGGINTNN-VAPIVEAGANGISVISAISKSE---NIENTVNRFKDFFNN---
THIE_STAAR       --QLPIVAIGGINTSN-VAPIVEAGANGISVISAISKSE---NIEKTVNRFKDFFNN---
THIE_STAAB       --QLPIVAIGGINTSN-VAPIVEAGANGISVISAISKSE---NIEKTVNRFKDFFNN---
THIE_STAEQ       --DFPIVAIGGINETN-VQPIVDEGADGISVISAITRST---NIDKTVKYFLRYFT----
THIE_STAES       --DFPIVAIGGINETN-VQPIVDEGADGISVISAITRST---NIDKTVKYFLRYFT----
THIE_STAHJ       --SLPMVAIGGITEDN-IEPIAQNGADGVSVISAIARSH---NIDKTVTKMKSYFK----
THIE_STACT       --DLPIVAIGGISLDN-VQEVAKTSADGVSVISAIARSP---HVTETVHKFLQYFK----
THIE_STAS1       --HFPIVAIGGINVEN-TREVMQAGADGISIISAITKSE---NISNTISQFLQNVE----
THIE_OCEIH       --SLPLVAIGGINTTN-AQEIIQAGADGVSFISAITETD---HILQAVQRL---------
THIE_LISIN       --KLPIVGIGGINETN-SAEVLTAGADGVSVISAITRSE---DCQSVIKQLKNPGSPS--
THIE_LISMF       --KLPIVGIGGINETN-SAEVLTAGADGVSVISAITRSD---DCYSVIKQLKNPGYPS--
THIE_LISMO       --TIPIVGIGGINETN-SAEVLTAGADGVSVISAITQSD---DCHSVIKQLKNPGSPS--
THIE_LISW6       --KLPIVGIGGINEAN-IAEVLAAGADGVSVISAITRAD---DYQLVIANLI--------
THIE_HAEIN       --TKPLVAIGGVKLAH-VKTLREFGADGVAVITAITHAD---NVQAATKALREASDEYAK
THIE_HAEIG       --TKPLVAIGGVKLAH-VKTLREFGADGVAVITAITHAD---NVQAATKALREASDEYAK
THIE_HAEI8       --TKPLVAIGGVKLAH-VKTLREFGADGVAVITAITHAD---NVQAATKALREASDEYAK
THIE_HAEIE       --TKPLVAIGGVKLAH-VKTLREFGADGVAVITAITHAD---NVQAATKALREASDEYAK
THIE_PASMU       --DKPIVAIGGVTTQT-AEELRRRGANGVAVISAITQSA---DIAKTVKELLGNAQ----
THIE_HAES1       --DKPMVAIGGIKVKD-VAMLMAKGANGVAVISAITQSN---HIEKTVKELLR-------
THIE_ACTSZ       --DKPCVAIGGIHEDN-TAEIRRLGANGVAVISAITRSN---DIARTVQNLACHS-----
THIE_MANSM       --DKPCVAIGGIKEES-AAILRRLGADGVAVISAISHSV---NIANTVKTLAQK------
THIE_HELPH       --KKPLIAIGGITTHN-ASKLREY--GGIAVISAITQAR---DKALAIEKLLNNA-----
THIE_HELPY       --KKPLIAIGGITMHN-APKLREY--GGIAVISAIAQAK---DKALAVGKLLNNA-----
THIE_HELPJ       --EKPLIAIGGITTDN-ASKLQKF--SGIAVISAITQAK---DKALAVEKLLKNA-----
THIE_LIMRD       --ERPVVAIGGIDEEN-MKVVHDTGVAGLAVISLVFDSK---DLVATVKKMKNLYK----
THIE_PEDPA       --HYPIVAIGGITLDN-LPQTMATGVKGFAAISMFTQMT---AVPTQMQKIKAIVKG---
THIE_LACPL       --SCPVVAIGGITVAQ-LPAIAATGAAGAAVISMLTRSP---DMAATVKAMLTATEGH--
THIE_LEVBA       --RVPVVAIGGVTVDS-LPAIAETGAAGVAVITLLTHSH---DVDADTAAMRQAFSK---
THIE_LATSS       --QLPVVAIGGISLKN-CQQVAETGVAGAAVISAITQAK---NIPQAIQLLNQPWQSSEG
THIE_LACLM       --QLPIVGIGGITQDS-LTELSAIGLDGLAVISLLTEAE---NPKKVAQMIRQKITKNG-
THIE_LACLS       --QLPIVGIGGITQDS-LTELSAIGLDGLAVISLLTEAE---NPKKVAQMIRQKITKNG-
THIE_LACLA       --QLPTVGIGGITENS-LTELSKIGLGGVAVISLLTESE---NYKNMVQKIKQNIR----
                         :. :                                                

THIE_ROSS1       ERARAG---------
THIE_ROSCS       ---------------
THIE_MOOTA       K--------------
THIE_CHLAA       KAL------------
THIE_METMJ       EGR------------
THIE_METB6       QYREKRDA-------
THIE_METAR       SGRQ-----------
THIE_METHJ       ---------------
THIE_CHLTE       ---------------
THIE_CHLPD       ---------------
THIE_CHLL3       GEGT-----------
THIE_CHLPM       L--------------
THIE_ALKCK       ---------------
THIE_ALKHC       GS-------------
THIE_PELTS       ---------------
THIE_LAWIP       ---------------
THIE_CALS8       S--------------
THIE_CLOTE       ---------------
THIE_ALKOO       ---------------
THIE_CLOB8       ---------------
THIE_CLOD6       ---------------
THIE_CLOAB       K--------------
THIE_ALKMQ       ---------------
THIE_METS3       ---------------
THIE_FUSNN       ---------------
THIE_CLOB1       ---------------
THIE_CLOBH       ---------------
THIE_CLOBL       ---------------
THIE_CLOBK       ---------------
THIE_CLOBM       ---------------
THIE_CALS4       ERGK-----------
THIE2_STRPN      ---------------
THIE2_STRR6      ---------------
THIE_LACP3       NDR------------
THIE_ENTFA       ARK------------
THIE_CAMJ8       LK-------------
THIE_CAMJJ       LK-------------
THIE_CAMJR       LK-------------
THIE_CAMJE       LK-------------
THIE_DESHY       ---------------
THIE_SYNWW       ---------------
THIE_NATPD       NV-------------
THIE_HALWD       ESQLPSEEPSA----
THIE_HALMA       ---------------
THIE_STRAW       ---------------
THIE_STRCO       HG-------------
THIE_ACIC1       ---------------
THIE_THEFY       A--------------
THIE_SACEN       ---------------
THIE_MYCTA       ---------------
THIE_MYCBO       ---------------
THIE_MYCTU       ---------------
THIE_MYCBP       ---------------
THIE_MYCPA       ---------------
THIE_MYCA1       ---------------
THIE_MYCUA       ---------------
THIE_MYCLE       ---------------
THIE_MYCSS       ---------------
THIE_MYCSK       ---------------
THIE_MYCSJ       ---------------
THIE_MYCS2       ---------------
THIE_MYCVP       ---------------
THIE_MYCGI       ---------------
THIE_NOCFA       ---------------
THIE_ARTS2       ---------------
THIE_THET8       ---------------
THIE_THET2       ---------------
THIE_DEIGD       ARVCR----------
THIE_NEIMA       ---------------
THIE_NEIMB       ---------------
THIE_NEIG1       ---------------
THIE_SALTY       ---------------
THIE_SALPB       ---------------
THIE_SALCH       ---------------
THIE_SALPA       ---------------
THIE_SALTI       ---------------
THIE_CITK8       ---------------
THIE_SHIF8       ---------------
THIE_SHIFL       ---------------
THIE_ECOHS       ---------------
THIE_SHISS       ---------------
THIE_ECOLI       ---------------
THIE_ECO24       ---------------
THIE_ECOLC       ---------------
THIE_SHIBS       ---------------
THIE_ECO57       ---------------
THIE_SHIDS       ---------------
THIE_ECOUT       ---------------
THIE_ECOK1       ---------------
THIE_ECOL5       ---------------
THIE_ECOL6       ---------------
THIE_SALAR       ---------------
THIE_KLEP7       ---------------
THIE_ENT38       ---------------
THIE_CROS8       ---------------
THIE_SERP5       ---------------
THIE_PECAS       ---------------
THIE_YERPA       ADEK-----------
THIE_YERPE       ADEK-----------
THIE_YERPN       ADEK-----------
THIE_YERPP       ADEK-----------
THIE_YERPS       ADEK-----------
THIE_YERP3       ADEK-----------
THIE_PHOLL       KG-------------
THIE_RHIEC       VG-------------
THIE_KORVE       ---------------
THIE_AGRFC       ARQP-----------
THIE_SALAI       ---------------
THIE_SALTO       ---------------
THIE_SALRD       EADS-----------
THIE_MYXXD       GA-------------
THIE_ANADE       ARGATP---------
THIE_BACFN       ---------------
THIE_BACFR       ---------------
THIE_BACTN       ---------------
THIE_PHOV8       ---------------
THIE_FLAJ1       V--------------
THIE_FLAPJ       ---------------
THIE_COREF       ---------------
THIE_CORJK       R--------------
THIE_VIBCB       ---------------
THIE_VIBPA       ---------------
THIE_RHOFT       ---------------
THIE_CHLCV       C--------------
THIE_CHLAB       C--------------
THIE_AZOC5       ---------------
THIE_PSYWF       ---------------
THIE_KINRD       ---------------
THIE_PYRHO       ---------------
THIE_PYRAB       ---------------
THIE_PYRFU       ---------------
THIE_METMP       ---------------
THIE_METM5       ---------------
THIE_METM7       ---------------
THIE_METVS       ---------------
THIE_ARCFU       GL-------------
THIE_CALMQ       ---------------
THIE1_AQUAE      MLMLMGKV-------
THIE_THEAC       SSA------------
THIE_THEVO       GRC------------
THIE_PICTO       ---------------
THIE_PSEP1       ---------------
THIE_PSEPK       ---------------
THIE_PSEPG       ---------------
THIE_PSEE4       ---------------
THIE_PSEF5       ---------------
THIE_PSEPF       ---------------
THIE_PSE14       ---------------
THIE_PSEU2       ---------------
THIE_PSESM       ---------------
THIE_PSEAB       ---------------
THIE_PSEAE       ---------------
THIE_PSEA7       ---------------
THIE_PSEU5       ---------------
THIE_PSEMY       ---------------
THIE_MARN8       LFSLSE---------
THIE_SACD2       ALVTS----------
THIE_ALCBS       AP-------------
THIE_NITOC       RLF------------
THIE_HALHL       ---------------
THIE_NITEU       ---------------
THIE_NITEC       ---------------
THIE_NITMU       HPSLSRTSQ------
THIE_METCA       RRPRCDDA-------
THIE_AROAE       ---------------
THIE_AZOSB       ---------------
THIE_DECAR       ---------------
THIE_THIDA       E--------------
THIE_METFK       ---------------
THIE_CHRVO       ---------------
THIE_BORPA       ---------------
THIE_BORPE       ---------------
THIE_BORBR       ---------------
THIE_BORA1       ---------------
THIE_XANCP       ---------------
THIE_XANC8       ---------------
THIE_XANAC       KL-------------
THIE_XYLFT       ---------------
THIE_XYLFA       ---------------
THIE_HYPNA       ---------------
THIE_ERYLH       ---------------
THIE_WOLSU       RV-------------
THIE_METAC       SGRQ-----------
THIE_METMA       TGSSK----------
THIE_METBF       A--------------
THIE_CLOPE       ---------------
THIE_CLOP1       ---------------
THIE_CLOPS       ---------------
THIE_GEOKA       R--------------
THIE_GEOTN       R--------------
THIE_BACAH       ---------------
THIE_BACAN       ---------------
THIE_BACHK       ---------------
THIE_BACCZ       ---------------
THIE_BACC1       SHKY-----------
THIE_BACCR       ---------------
THIE_BACCN       ---------------
THIE_BACVZ       GLSR-----------
THIE_BACSU       GR-------------
THIE_BACLD       SAHS-----------
THIE_BACP2       LL-------------
THIE_STRA5       NRQKHSDVIK-----
THIE_STRA1       NRQKHSDVIK-----
THIE_STRA3       NRQKRSDVIK-----
THIE1_STRR6      ---------------
THIE1_STRPN      ---------------
THIE_STRS2       KFNQVESNKQILKNP
THIE_STAAM       ---------------
THIE_STAA9       ---------------
THIE_STAAN       ---------------
THIE_STAA1       ---------------
THIE_STAAC       ---------------
THIE_STAAE       ---------------
THIE_STAA2       ---------------
THIE_STAA3       ---------------
THIE_STAA8       ---------------
THIE_STAAS       ---------------
THIE_STAAW       ---------------
THIE_STAAR       ---------------
THIE_STAAB       ---------------
THIE_STAEQ       ---------------
THIE_STAES       ---------------
THIE_STAHJ       ---------------
THIE_STACT       ---------------
THIE_STAS1       ---------------
THIE_OCEIH       ---------------
THIE_LISIN       ---------------
THIE_LISMF       ---------------
THIE_LISMO       ---------------
THIE_LISW6       ---------------
THIE_HAEIN       ---------------
THIE_HAEIG       ---------------
THIE_HAEI8       ---------------
THIE_HAEIE       ---------------
THIE_PASMU       ---------------
THIE_HAES1       ---------------
THIE_ACTSZ       ---------------
THIE_MANSM       ---------------
THIE_HELPH       ---------------
THIE_HELPY       ---------------
THIE_HELPJ       ---------------
THIE_LIMRD       ---------------
THIE_PEDPA       ---------------
THIE_LACPL       ---------------
THIE_LEVBA       ---------------
THIE_LATSS       NNHES----------
THIE_LACLM       ---------------
THIE_LACLS       ---------------
THIE_LACLA       ---------------