CLUSTAL format seed alignment for MF_00099

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

CHEB3_RHOPA      -------------MAKQKIRVLIVDDSASVRQVLGTILAEDPEIEVIGTASDPFVAAKRL
CHEB2_GEOSL      ---------------MKKIKVLIVDDSAVVRQTMADILASDPQIEVMATAADPFIAAERM
CHEB1_CHRVO      ----------------MSVSVLIVDDSAVVREVLSQMLSSAPDIEVLGAAPDPIFAMTRM
CHEB3_SHEON      -----------------MIKVAIVDDSAVVRQVLSSMLENQPDITLLGCARDPLFALKLF
CHEB3_LEPIN      -----------------MIQVFIVDDSAVVRQVLTQILNKDPEIEIIGFASDPIFASEKL
CHEB_BDEBA       --------------MAQKIRVLIVDDSAVIRKLLEKIFSSCADIEVVGTASDPYIARDKL
CHEB3_PSEAE      ------------------MRIGIVNDMPLAVEALRRALAFEPQHQIVWVASNGAEAVTQC
CHEB_RHILO       ------------------MRIGVVNDMPMAVELLRRLVLSTGEHQVAWIATNGREAVEVC
CHEB3_RHIME      -----------------MVRILLATSTVELEDLVKRAIEGDASAELVLIARSGREAVRMT
CHEB1_PSEAE      ----------------MAVKVLVVDDSGFFRRRVSEILSADGQIQVVGTGTNGREAIEQA
CHEB1_SHEON      ----------------MAIKVLVVDDSSFFRRRVSEIVNQDPELEVIATASNGAEAVKMT
CHEB1_GEOSL      ----------MLQNQTRKLRVLVVDDSSFMRMVIRSVLEKDPAIEVVGIAVDGMEGVEKA
CHEB2_RHOPA      MSVALAGSPATNSAQYEPLRVMIVDDSVVIRGLISRWVEAEPDMVVAASLRTGLDAVNQL
CHEB2_CAUVC      ------------------MRVMIVDDSAVVRGMVTRWLE-EAGFIIAAIAVDGGQALRKL
CHEB1_LEPIN      -------------MIPNPVRAVIIDDSLLVRNIISDQIQKDSKIHVVATGKTGMDCIDLA
CHEB1_METMA      ----------MNEFGDSMIRTLIVDDSAFMRMAIRSMLASSPDIKIAGDACNGKEAVDKS
CHEB_ARCFU       ------------------MRVLVVDDSALVRMAVTDILTKA-GIEVVDTAKNGREAVEKA
CHEB_CLOAB       ---------------MEKIKVIVVDDSVLMRRLICDMLESNDNIEVIGTAINGQDLLNKL
CHEB_PYRHO       -----------MPLMGRKIKVLVVDDSAFMRKVLKDIINSDPELEVCGEARDGIEAIEMV
CHEB_THEMA       -------------MTDRVIRVLVVDDSAFMRMVLKDIIDSQPDMKVVGFAKDGLEAVEKA
CHEB_METMP       ---------------MSKIKVLIVDDSAFMRKVLEDILKSDDEIEVVATAKDGKEAFELV
CHEB_CALS4       --------------MKKKIRVLVVDDSAFMRRCLKDILENEEDMEVIDTARDGNEAVKKA
CHEB3_VIBCH      ------------------MKILVVDDSALMRTTISDILQNIPNAE-IKTARDGMDAIDKV
CHEB_HALSA       -----------------MTEALVVDDSHFMRTVISDILED-GGVDVVGTAENGARALDAV
CHEB2_METMA      -----MSNQHPKKVLEMVIRALIVDDSALIRKVLSDILNQDPKIAVIGTAINGEDGLEKV
CHEB_BACHD       --------------MESRIKVLVVDDSAFMRKVITSMLESDPRLEVVGTARNGEDALKKR
CHEB_BACSU       -----------------MIRVLVVDDSAFMRKMISDFLTEEKQIEVIGTARNGEEALKKI
CHEB_OCEIH       ---------------MRKVRAIVIDDSAFMRKIISDILDNDPRIEVVAVARNGEDGLNKV
CHEB2_DESVH      -----------------MISVVVVDDSAFMRKALSTMLEKDPEIRVVATARDGEEGLQVI
CHEB_TREPA       ------------MKNTNDIAVLIVDDSALMRKVIGKVIEGAPGLSIAGKAMNGRFALDML
CHEB3_GEOSL      ---------------MRKIRVVVIDDSAYSRRAITKMLESMPEVEVIGYATDGEEGIRKI
CHEB_ECOLI       ---------------MSKIRVLSVDDSALMRQIMTEIINSHSDMEMVATAPDPLVARDLI
CHEB2_PSEAE      ----------------MPISVLVVDDSALIRSLLKEIIQADPELRLVGCAPDAFVARDLI
CHEB1_XANCP      ------------MTLETPVRVLIVDDSAVVRQMLTEILSRDPGIEVVGSAADPLLAREKI
CHEB3_CHRVO      ----------MSAGTGRRIRVVVVDDSALVRSLLTAIVNEAPDMEVVATASDPIIAREKI
CHEB2_VIBVY      -------------MMSKKMKVLVVDDSPVFRALLSEIINSDPQLEVIGAAEDPYQAREMI
CHEB2_SHEON      ----------------MAIKVLVVDDSTLIRSLLGKMIESDPELSLVGMAADAYMAKDMV
CHEB1_AGRFC      --------------MSALARVLVVDDSPTMRGLISAVLKADPEVEVVGQAGNAMEARAAI
CHEB1_CAUVC      ---------------MAKIRVLVVDDSATMRSLISAALNRDPDIEVVGGAGDPFEARGMI
CHEB_BORBU       ------------------MKILVIDIQGLIKQVFVRAFSKDNDVEILNAGFNSLNLINVF
                                                  .   .                      

CHEB3_RHOPA      QNELPDVILLDIEMPRMDGITFLRKIMA-QHPIPVVICSSLTPEGSDLMFEALEAGAVDI
CHEB2_GEOSL      KSDVPDVITLDVEMPRMDGITFLQKIMS-QHPIPVVMCSTLTENGSETAMKALEYGAVEI
CHEB1_CHRVO      KQRWPDVIVLDIEMPRMDGLTFLRKIMD-ERPTPVIICSSLTEKGARITLDALAAGAVAI
CHEB3_SHEON      EQQWPDVIILDIEMPRMDGITFLKKVMA-EKPTPVVICSTLTEQGASVTIAALAAGAVDI
CHEB3_LEPIN      SSVWPDVFILDIEMPRMDGISFLKKIMS-EKPTPVIICSSLAEKESETAVLAMKLGAVDI
CHEB_BDEBA       VALKPDVMTLDVEMPRMDGISFLEKVMQ-HFPTRTIIFSSLAKTGSETYLRALEAGAIEI
CHEB3_PSEAE      AADTPDVVLMDLLMPVMDGVEATRRIMAESP-CAIVIVTVDIEQNVHRVFEAMGYGALDA
CHEB_RHILO       RRDLPDLILMDLAMPVMDGVEATRRIMAETP-CSILLVTASIESNLADVYEAMGHGALDA
CHEB3_RHIME      GELLPDIVAVELCPSGDDSAETVREIMIAAP-TPVVMLSHRDGSQLGTISARALEAGALA
CHEB1_PSEAE      LALRPDVITMDYEMPLMDGITAVRNIMQRCP-TPVLMFSSLTHEGARVTLDALDAGAVDY
CHEB1_SHEON      ADLNPQVITMDIEMPVMDGITAVREIMAKCP-TPILMFSSLTHDGAKATLDALDAGALDF
CHEB1_GEOSL      LALKPDLITMDIEMPRLDGISALKQVMAKCP-TRVLMVSTLTCEGAKATFDALDAGAIDY
CHEB2_RHOPA      ERVKPDVAVLDIEMPELDGISALPQLLAKKRDLVVIMASTLTRRNAEISFKALSLGAADY
CHEB2_CAUVC      ADTSVDVCLLDIEMPVMSGLEALPKLLAAKPDLRVIMASTLTERGAEVTLRALDLGAADY
CHEB1_LEPIN      QKMNPDVIILDVEMPVMDGLTALHELQKKKLGIPVIMLSVLTQNGAEATFKALEYGAIDF
CHEB1_METMA      KSLHPDIIIMDVNMPVMDGLTAVKTIMS-TDPVPIIMFSTLTVEGSKEALEALQLGAIDF
CHEB_ARCFU       LKLKPDVITLDINMPEMDGLTALKLIME-KQPTPVVMLSSLTKEGARETLEALKIGAVDF
CHEB_CLOAB       KVMKPDVITLDIEMPVMNGIETLKAVKSLKIDIPIIVFSSISQKGMKYTMECLYLGAFDF
CHEB_PYRHO       QKCRPDVVTLDVEMPRMNGLDALRVIMK-RYPVPVIMISALTQEGADATIKALEYGAIDF
CHEB_THEMA       IELKPDVITMDIEMPNLNGIEALKLIMK-KAPTRVIMVSSLTEEGAAITIEALRNGAVDF
CHEB_METMP       KKLEPNVITMDVEMPIMNGIDATKQIMA-YKPTPILMLSAVTKQGSEATLKALDNGAVDF
CHEB_CALS4       VELRPDVITLDINMPVMDGLTALQYIMS-LAPCPVVIISSLSTEGALTTFEALELGAVDF
CHEB3_VIBCH      MKWQPDVMTLDINMPNMDGLTCLTQIMV-ERPLPIVMLSSLTHEGAITTLEALYLGAVDF
CHEB_HALSA       TDVQPDVITMDVEMPEMDGIEATAEIMR-EQPTPILMVSALTTEDADATLEAMEKGAIDT
CHEB2_METMA      RKLKPDVVLLDNIMPVLDGLKTLSHIME-EFPTPVVIVSALGEKAEEITLTALEYGAVDV
CHEB_BACHD       KTLAPDVMTLDVEMPVMDGIETLKRLMS-ENPLPIIIVSSTTKEGAENALTAMELGAVDF
CHEB_BACSU       ELLKPDVITLDVEMPVMNGTDTLRKIIE-IYNLPVIMVSSQTEKGKECTINCLEIGAFDF
CHEB_OCEIH       IQLSPDVVTLDVHMPKMDGMQALQRIMN-EHPVPVVMLSSVTKAGAEKTIQAISNGAVDF
CHEB2_DESVH      RQHNPDVVTLDIEMPRMDGLTTLRHIMM-EMPRPVLMVSSLTTEGAEATLKALELGAVDF
CHEB_TREPA       ERVQPDVILLDLEMPHMNGLQFLEQRKRLRIDIPVIILSSIAKEGARVTMQCLELGASDF
CHEB3_GEOSL      IDLKPDLVTLDLEMPRMDGFTLLRIVMEYSPTAVIVISSRSEDEK---VFRALELGAVDF
CHEB_ECOLI       KKFNPDVLTLDVEMPRMDGLDFLEKLMR-LRPMPVVMVSSLTGKGSEVTLRALELGAIDF
CHEB2_PSEAE      KQHAPDVISLDVEMPRMDGLTFLDKLMK-ARPTPVLMISSLTERGSEATLRALELGAVDF
CHEB1_XANCP      KRLNPDVITLDVEMPRMDGLVFLENLMR-LRPTPVVMISSLTERGADTTLQALSLGAVDF
CHEB3_CHRVO      RETSPDVVTLDVEMPRMDGLEFLRRLMR-LRPTPVLMISSLTDAGSETTLAALELGAVDF
CHEB2_VIBVY      KALKPDVLTLDIEMPKMNGVQFLKNLMR-LHPLPVVMISTLTQHGADATLMALELGAVDY
CHEB2_SHEON      NQFRPDVITLDIEMPKVDGLTFLDRLMK-ARPTAVVMISALTEEGADATFNALALGAVDF
CHEB1_AGRFC      KQLNPDVVTLDIEMPEMNGLEFLEKIMR-LRPMPVIMVSSLTHRGADASLAALEIGAFDC
CHEB1_CAUVC      KALNPDVVTLDIEMPNMNGIDFLEKIMR-LRPMPVVMVSTLTQAGAEMTLRALELGAVDC
CHEB_BORBU       LQKFPDLVIIDENTARSNFGNSLNNVLN-NISLPVVFIAQNEMLPNFGCLEQSKEKVKLI
                      ::  ::   .  .                 :. :                     

CHEB3_RHOPA      VPKPRVDTRQALMES-------------SGRLREAIKSAARA------RVRPRAAR----
CHEB2_GEOSL      IQKPKLGTKQFLEES-------------RVRICDAIKAASQA------RLRKIPARP---
CHEB1_CHRVO      ITKPALNQRAFLLEA-------------AKELVQEVRDAARAKMGVVKRISQGAAEH---
CHEB3_SHEON      ITKPKLGLKGFLEES-------------QARLLQAIRAAAKA--SVAKLRVNGLAKP---
CHEB3_LEPIN      IEKPKVGLKNFLEES-------------EILFIDSVRAASNA--RVKTHSFQNDDSK---
CHEB_BDEBA       MEKPSIDVSQSLETL-------------SAAIIEKVKAVAKA----------RINPI---
CHEB3_PSEAE      VNTPALGI-GNPQTA------------AAPLL-RKIQNVGWLIGQRDNRGKVQVV-----
CHEB_RHILO       VDIPSVGIEGNASSQ------------SARLLTNKIATIGKLIGDAPTKAKRRM------
CHEB3_RHIME      VIPAPAAHGMQLEQP------------AIEKFLSTIKAMSQVKVVRQWRQKVRGDRA---
CHEB1_PSEAE      LPKNFEDISRNPDK-------------VRQLLCEKVLTIARSNRRSISLPPLPSATS---
CHEB1_SHEON      LPKRFEDIATNKDE-------------AILLLQQRVKALGR--RRIFRPITRPSVAP---
CHEB1_GEOSL      IPKNVTDSADAQRV-------------FREELLRKVKGAAS---SIFGRPMTTSAPR---
CHEB2_RHOPA      IPKPETTREPQAADI------------FKHDLLQKIRSLGGRVRRRAVPGVAAPAIAREP
CHEB2_CAUVC      IAKP-SANKLGGADL------------YRKDLIEKVRHLGARAARPAPPQAA--------
CHEB1_LEPIN      VPKPSSVFQFDPEEI------------GNILKSKILAYFESKIQIPSQNLLK--------
CHEB1_METMA      VPKSE--SHHDVNKI-------------EKELVDKIRNIHS-----SNPSILR-------
CHEB_ARCFU       VTKPDG-ALVDLSSV-------------AQELVRKVQMAAS-----TSLNVLR-------
CHEB_CLOAB       IPKPE--KPFELSKM-------------KDDLIKRIRVAYS-----QNTNKNP-------
CHEB_PYRHO       IPKPSSSISINMKEL-------------KDEIIAKIKEAAK-----VPRRFLE-------
CHEB_THEMA       ITKPHGSISLTFRQV-------------APELLEKIRQAMN-----VDPRTLL-------
CHEB_METMP       IEKPSGSVSLDIRKI-------------GEKIIKQVKDASK-----SKVRIKS-------
CHEB_CALS4       VAKPGGTVSLGIKQL-------------ADEIVSKVRIAAL-----SNKELLS-------
CHEB3_VIBCH      VAKPGGTICGRLQEV-------------APLIREKVRAAAK-----MRVKVHT-------
CHEB_HALSA       FAKPGGTISTELSGH-------------SEELVAAVERVAS-----ADPTAGH-------
CHEB2_METMA      IEKPSGILSQSMHEM-------------AEEICAKVRAVSK-----ADLNNLG-------
CHEB_BACHD       ITKPSGPISLDLEKV-------------RDLLIEKVASA-------PNVKLKP-------
CHEB_BACSU       ITKPSGSISLDLYKI-------------KEQLVERVVAAGL-----SGKRKRP-------
CHEB_OCEIH       IMKPSGSISLDIRNV-------------EDEIRKKVILA-------STVRVKS-------
CHEB2_DESVH      IPKQLSKVSLDIVRI-------------ENDLREKVKEVSKRRMLRTPRPVRP-------
CHEB_TREPA       VTKPFGSESAHLRTVSRKIVDYVTAYGRRYKLLRRTRRCLAMDTPVERPAGEEDLNCLDT
CHEB3_GEOSL      VAKPTKGVSEEILTI-------------REDLHRKVRGVIHLNLAGIVRRERE-------
CHEB_ECOLI       VTKPQLGIREGMLAY-------------NEMIAEKVRTAAKASLAAHKP-----------
CHEB2_PSEAE      IAKPRLGIAEGMQAY-------------AEEIRAKLKTVARARLRRRAA-----------
CHEB1_XANCP      ISKPKIDVARGLEGY-------------AEEIVSKVKMAAKAKVSALNRPSAPK------
CHEB3_CHRVO      IHKPADDIARHMQEY-------------AEEIREKLRVTAEARLRQPNR-----------
CHEB2_VIBVY      FPKPSVANTADMLGY-------------RSLVNEKIRMAAQAQV----------------
CHEB2_SHEON      IPKPKLDSPQGFNEY-------------QDLILEKIKSAAKAKLLKALP-----------
CHEB1_AGRFC      VGKPA----PGDARP-------------FGDLADKVKAAARSQHAAYRA-----------
CHEB1_CAUVC      VGKPAD--ATGTQEA-------------LAEIVAKVKIAARASVRTNAG-----------
CHEB_BORBU       INKLNFKLTVDLFRSK-----------YLALIKLELKNLGKNKLISSFEVKRIQAPDFSS
                 .                                                           

CHEB3_RHOPA      --------------------------KVIEQKLTADAIIPPPVAGRSRPTTERIVCIGVS
CHEB2_GEOSL      --------------------------HAVAPKLSADVILEKPASRAMIQTTERVVVVGAS
CHEB1_CHRVO      --------------------------APPAPKLTADVVLEAPSGLEKYRTTEKIIAIGTS
CHEB3_SHEON      --------------------------MPVIAKHNADVVL-ASTNHALNQTTDRVVALGTS
CHEB3_LEPIN      --------------------------FLENHKQ-------PKTDFSKIDTTDKLIAIGTS
CHEB_BDEBA       --------------------------KAVVPNPGAPVQKVASTSLA--RTTHQLLAVASS
CHEB3_PSEAE      ----------PPKAGG---------------------------------ARQRLVAIGAS
CHEB_RHILO       ----------SRAAEP---------------------------------TPRRLIAIGAS
CHEB3_RHIME      -------AKDQPPTAR---------------------------------TPIGIVGIAAS
CHEB1_PSEAE      -------SSHAPASSSSVG-ASARVGAGASPAPASTSAAPKR-------KAYRLVAIGTS
CHEB1_SHEON      -------VTPRPTTGSAVGNATTPVQSASAPVRSSPLSSIRASG-----KQYKLLLIGTS
CHEB1_GEOSL      -------AIIAPPR-----------QVQPAPRPSQALA-----------GKFHYVGIGAS
CHEB2_RHOPA      HPA----PLPHPAVAT------------PTVASQAALVKRSFGP-----TAPRVLLIGSS
CHEB2_CAUVC      ---------PRPTLAP------------PSSDPAGPI---------------EAVVVASS
CHEB1_LEPIN      ---------KAPAYSK------------VPAGSHLKK------------SPIQAICIGTS
CHEB1_METMA      -------LINMRKF-------------KGEVVRGKWSC-A----------GDFAVLIGSS
CHEB_ARCFU       -------LQNLKKI-------------KGEVVRGNWKGKT----------KDVCVLIGSS
CHEB_CLOAB       -------APINPVI-------------RRETNRISSDS-------------IEAVVIGAS
CHEB_PYRHO       -------LRRIRLL-------------RVQKAKKVKPSVP----------ARIAVAIAAS
CHEB_THEMA       -------FKP-----------------KVSRLTITKPAVS----------GKI-VVIGSS
CHEB_METMP       -------SRILENIKKEKQDESSTPKPQVEKTSGLSPEKL----------NDTAILIGSS
CHEB_CALS4       -------SSRNFKKLLKRRNQEV------TRKVYENKISK----------KEIVVVIGVS
CHEB3_VIBCH      -------QLSVSPAEVEHKHK---------SPVVENNED------------HQLAIMGVS
CHEB_HALSA       -------DVEMEPASP---------------PDATTSEYA----------DNPTLLIGAS
CHEB2_METMA      -------CIRDLEHQIPENHRK--------KKNSLREKTS----------VRNVLAIGAS
CHEB_BACHD       -------TSKKA---------------PVVFRPLQQPVP----------FDKTIIVIGTS
CHEB_BACSU       -------VSQTVRPEPIVR--------AVVKPELSKPKPG---------TGRQIVCIGTS
CHEB_OCEIH       -------TQEASE-EDFQS--------TRTVPTINREKK----------YRRSIVSIGTS
CHEB2_DESVH      -------APTASAPAQTAQ--------VASAAPATAPSRPAMPATRASRPVRDVVAIGVS
CHEB_TREPA       QERASLPSVCARAPARDRASYTITPTEGARQTRIVPLRES---------GALQIIAIGVS
CHEB3_GEOSL      -------QERASVAAGRRTSGSAPYAKAAVRTESTAPRPA---------GRLEVVAIGAS
CHEB_ECOLI       ------------------------------LSAPTTLKAGPLLS------SEKLIAIGAS
CHEB2_PSEAE      ------------------------------DAPAPPESAAPLLS------TEKIIALGAS
CHEB1_XANCP      -------------------------ITLDMQSAPVPGSALRFRT------TDRLIAIGAS
CHEB3_CHRVO      ---------------------------FRQPPPARKTGPGAPLR------KNALVFVGAS
CHEB2_VIBVY      -------------------------GANQSMSPAVASSSAVSTS------QYQLIAIGAS
CHEB2_SHEON      -------------------------SASTPVKSSIKPALSQRTV------NTQLVAIGAS
CHEB1_AGRFC      -------------------------TRPETAAAPQPVPMSEYRA------GRKVVAIGSS
CHEB1_CAUVC      -------------------------AAPTSAPTRR----KDFMP------SGDIVAIGSS
CHEB_BORBU       NSK--VELRENNLNDSSIRKSYRVSDVINFAPKNDPDVIIKYQGLINKHKTGKIIVVGSS
                                                                         :. *

CHEB3_RHOPA      TGGTEALYDVLEVLPPNCPG--ILIVQHMPQG-FTAAFAKRLNAGCQINVKEAEDGD-PV
CHEB2_GEOSL      TGGTEALRVFLESFPADCPP--IVIVQHMPEG-FTRAFAQRLDGICRISVKEAADND-SV
CHEB1_CHRVO      TGGTQALEYLLPKLPATCPG--VAVVQHMPEK-FTASFAERLNRLCRVEVKEAQTGD-RL
CHEB3_SHEON      TGGTHALEYVLTALPRTSAG--IVVVQHMPEH-FTAAFASRLNGVCEMEVKEAEDND-RV
CHEB3_LEPIN      TGGTQALEFILTQLNIHCPG--IVIVQHMPEK-FTEAFANRLNQVCKIQVKEAKDGD-RV
CHEB_BDEBA       TGGTEALKVFLSGMPADIPG--TLVVQHMPPG-FTKSFAENLDKMFPFEVKEAQEGD-QV
CHEB3_PSEAE      AGGPASLAVLLKQLPASFNA-AVVLVQHVDEV-FAAGMAEWLASESKLPVRLARDGE-PP
CHEB_RHILO       AGGPAAVAAVLSAFPVDFGG-AIVLVQHLDAQ-FVPGLVDWLGQHTPLPIRPARERD-SP
CHEB3_RHIME      TGGPAAIRAILKDISADLPV-PILIVQHMSNG-FIDGVAASLNATVPLTVKVARNGE-LL
CHEB1_PSEAE      TGGPVALQRVLTQLPANFPA-PLVLIQHMPAA-FTKAFAERLDKLCRINVKEAEDGD-IL
CHEB1_SHEON      TGGPVALQKVLTQFPANYPH-PILLIQHMPAA-FTPAFASRLNGLCKIEVKEAANGD-IL
CHEB1_GEOSL      TGGPVALQEVLGRIPGNYPH-GIVVAIHMPKA-FTGPYAERLNSKCSLQIKEANDGD-II
CHEB2_RHOPA      TGGPQALMSMVADIGPVIDRFPVLITQHMPPT-FTTILAEHLARASRRPAHEGIEGE-AI
CHEB2_CAUVC      TGGPPALRRFIAGLGADWTS-PILIAQHMPPG-FTRTLAQMLDPISHLTAREAQNGE-PI
CHEB1_LEPIN      TGGPRALQEVFSRIPADISL-PILVVQHMPAG-FTKAFATRLNDHAKIKVKEAEDGE-PI
CHEB1_METMA      TGGPSSLEQVIPRLPGDLPA-PVFVVQHMPEGNFCKQLAERLNFLSELEIKEARNNE-KV
CHEB_ARCFU       TGGPSALEMIIPRLPADIPA-PVFVVQHMPPG-FTKQLAERLNSISEVEVKEAENNE-RV
CHEB_CLOAB       TGGPKALYKVITKFPKDMNV-PVFVVQHMPVG-FTKAFADRLNDNSAIEVKEATDGE-TY
CHEB_PYRHO       TGGPQSLLKIFPKFPEDLKA-GILLVQHMPPG-FTRSFAKRLDSVSKIDVKEAEEGD-VV
CHEB_THEMA       TGGPRSLDMIIPNLPKNFPA-PIVVVQHMPPG-FTKSLAMRLDSTSELTVKEAEDGE-EV
CHEB_METMP       TGGPPVVSSIISNIPKNTP--PIFIVQHMPKG-FTRVFAERMNNNSAITVKEAEHGE-IV
CHEB_CALS4       TGGPKTLMEILPYLPSDFPA-AVLVVQHMPPG-FTQSFAQRLDQSCNLKVKEAEDKA-FI
CHEB3_VIBCH      TGGPGTVETILRHLPADFSL-PIIVNQHMPES-FTAAFAQRLNRHLQQPVKEINRAL-VL
CHEB_HALSA       TGGPNVVESILASLPAEADF-RVLIVQHMPDQ-FTSRFADRLDAASQYDITEAEDGS-RI
CHEB2_METMA      TGGPRALEKLIGSFPAEIPA-AVLIVQHMPPG-FTASLSKRLDAKSALRVKEAQEGD-IM
CHEB_BACHD       TGGPKALKQVLTKLPKDLPA-PILIVQHMPAG-FTESLANRLNSLCEIHVKEAEDGE-II
CHEB_BACSU       TGGPRALQKVIPKLPKDLNA-PVVVVQHMPEG-FTASLADRLNHLSDIQVKEAKDGE-AA
CHEB_OCEIH       TGGPKALQKVLTELPKDIQA-PIVIVQHMPPG-FTKSLADRLNSICAISVKEAVHGE-IL
CHEB2_DESVH      TGGPPAVQKVLSQLPADFPA-SILIAQHMPAA-FTGPFAKRLDGVCAISVKEAESGE-KL
CHEB_TREPA       TGGPSALRHIFAQLDADLPQ-PVVVVQHMPAG-FTREFAYSLNQVCALEVKEAQEGD-LV
CHEB3_GEOSL      TGGPPALQRILCALPGAFPQ-AVVVSQHMPAG-FTRTFAERLNRLSPLEICEAADGD-EV
CHEB_ECOLI       TGGTEAIRHVLQPLPLSSPA--LLITQHMPPG-FTRSFADRLNKLCQIGVKEAEDGE-RV
CHEB2_PSEAE      TGGTEALKEVLLGLPAHSPG--VVITQHMPPG-FTRSFAERLDRLTRLSVSEARDGD-RI
CHEB1_XANCP      AGGTEALRVVLEHMPADAPA--VVMTQHLPAS-FSTAFAERLNRHSAMSVREASDGE-AI
CHEB3_CHRVO      TGGTEAIKDFLMGMPADGPP--ILIVQHMPEH-FTFTFAERLNKLCPMRVKEAEDGE-AA
CHEB2_VIBVY      TGGTEAVKHLLSALPASMPP--IVITQHISAM-FSGPFASRLDASCALSVSELTQGEVAL
CHEB2_SHEON      TGGTEAILALLKQFPAVMPP--IVITQHMPAG-FTCTFADRLNKLTRFNVKQAEEGE-RL
CHEB1_AGRFC      TGGVEALIAVLQKFPANCPP--TVITQHMPPT-FTKSFAERLNRICAPVVEEATDGA-RL
CHEB1_CAUVC      TGGVEALLSILQLFPETCPP--TVITQHMPAT-FTASFAARLDRSSGAKVQEASDGA-LL
CHEB_BORBU       TGGTEALRIFLRSFKKDSPP--IIIVQHMPGG-FTKSFAKNLNNEFNIDIKEAEDGD-IL
                 :**   :  ..  :          :  *:    *       :                  

CHEB3_RHOPA      LPGWAYIAPGA-RHMLLVRSGLRYQIAIKDGP----PVSRHRPSADVLFRSAAQYA-GAN
CHEB2_GEOSL      IRGRALIAPGN-RHMLLKRSGARYYVEIKDGP----LVSRHRPSVDVLFRSAARYA-GKN
CHEB1_CHRVO      ISGVALIAPGG-KHLLVKRNGAQYVADVKDGP----LVSRHRPSVDVLFRSVAVCA-GGN
CHEB3_SHEON      MPGLVLIANGG-KHMLLQRSGAQYRVQLKDGP----LVSRHRPSVDVLFRSVANAA-GKN
CHEB3_LEPIN      QLGSAYIAPGN-KHMEIYLSGAQFHIRVLDGP----LVNRHRPSVDTLFHSVAKAA-GKN
CHEB_BDEBA       VPGRVLIAPGN-YHMEITRSGAFYYVKLHQGP----ALHSVRPAADYLMKSVAKYV-GKN
CHEB3_PSEAE      IPGQILLAGTN-NHIRLLR-----NGSLVYTAEP--RSFVYRPSIDVFFESVANYW-RGD
CHEB_RHILO       QAGTVLVASSA-DHLVFKS-----VQQLGYTPSP--KDNVYRPSVDVFFESAAQWW-PGS
CHEB3_RHIME      KPGTVYLAPDN-CQLGVSG-----RSRLRVSDDA--PVNGFKPSGSYLFGSIARAF-KGE
CHEB1_PSEAE      RPGLALLAPGG-KQMMVDG---RGTVRILPGDE----RLNYKPCVDVTFGSAAKAY-NDK
CHEB1_SHEON      RPGCAYLAPGG-MQMMVERAGVTGRIKVLAGSA----EMNYKPCVDITFASASKAY-GGD
CHEB1_GEOSL      QPGVVLVAPGG-RHMALARQGNSIVVRTLSTAEC--PQYIYIPSVDHMMTTLADAT-NGS
CHEB2_RHOPA      KPGNIYLAPGG-KHMRVAKQ-GGN-PVIALDDGP--PVNFCKPAVDPLFMSAIEVW-QGG
CHEB2_CAUVC      VPGVIYVAPGD-YHMTVRAA-GGGGPSIHLDQGP--EVNYCRPSADPLFESAARFW-KGR
CHEB1_LEPIN      EPNTGYVAPGD-AHLSIQSK-GGR-KWIALNREA--PVNGHRPSIEVLLDSAIEEY-KSG
CHEB1_METMA      TAGVVYIAPGG-YHMTVKKALGVTRIKLIKS----QPVHAVMPAVDVIAESMLDVY-GKN
CHEB_ARCFU       KDGVVYVAPGG-YHMKVRRAANVVRIKVVDG----EPVNAVKPSVDVTADSVVQAY-GGN
CHEB_CLOAB       RKGVVYVAPGG-YHMEVDSN---SRIKLTKE----PPIWGVRPAVDKLFISASKIF-KSH
CHEB_PYRHO       EEGKAYVAPGD-YHMEVTLRAGKPVITLNKK----PKIHGVRPAADPMMITAAQVF-GRR
CHEB_THEMA       KPGFVYIAPGD-FHLGLKAQNGKVFFFLDKS----DKINNVRPAVDFTLDKAAEIY-KSK
CHEB_METMP       KPDHAYVAPGD-SQMVLQKRGGNVYIIIDENM---PKIHGTKPTVDVTAEYVTKYY-GKN
CHEB_CALS4       EPGTVIIAKGG-WHLVVERD--SRSSKLITRLTQKPEETLYKPSINVTMKSVLENVDGRN
CHEB3_VIBCH      EAGTVYVCKGD-RDCIVTL----RDGKLAAMPTPNDSHFSWHPSVSKLVASAIRTCGEDN
CHEB_HALSA       GGGEGLVARGD-YHMRVSG---YSNGRLRVRLDQSERLHSVRPAIDVTFKSAAERV-TDP
CHEB2_METMA      EEGTVFIAPGD-YHMEIVRNKVNGFGEDTVHLSCGPKELGSRPSVNVLFRSVARIY-GPR
CHEB_BACHD       RPGVAYIAPGG-YHLETKRLGTSIALHLTKE----EPRKGHRPSVDVLFESVSALS-SIY
CHEB_BACSU       LNGCVYIAPGG-KNISVIKNSEGLQVVLDNH----DTPSRHKPSADYLFRSVGKLT-DYE
CHEB_OCEIH       QSGTAYIAPGG-FHMQVENVGMSLAIALDKS----PPLKGHRPSVNKLFSSLQHIK-NYN
CHEB2_DESVH      KPGTAYIAPGG-KHLRVEQRVSHMEVVVTTD----PADALYKPSANVLMESVGQSM-GRR
CHEB_TREPA       RRGRVLIAPGD-RHLTVERRSLATVAHINSD----EPENGHRPSVDVLFESVARHF-ENR
CHEB3_GEOSL      RAGRVLIAPGG-HNMVFERQGSEVRARIVKP----GTDDRYVPSVDAMLLSCAEVF-GPR
CHEB_ECOLI       LPGHAYIAPGD-RHMELSRSG-ANYQIKIHDGPA---VNRHRPSVDVLFHSVAKQA-GRN
CHEB2_PSEAE      LPGHALVAPGD-HHMEVQRSG-ANYVVRLNRQAQ---VNGHRPAVDVMFESLARCA-GRN
CHEB1_XANCP      LPGHAYLPPGG-QHLRIIRDG-ARWRCRIDDGPP---VNRHKPAVDVLFRSVAANA-GPN
CHEB3_CHRVO      LAGVAYIAPGH-SHMRVAPAGGGGFRIALDQEEP---VNRHRPAVDPLFDSAARHL-GKN
CHEB2_VIBVY      KANHAYVAPGD-KHLMVFRRG-GQLYAHLDDSPA---VNRHKPSVDVMFGSVAESL-KGK
CHEB2_SHEON      LPCYAYVAPGD-QHLEIIKVG-GSFKAKLSQGDK---VSGHRPSVDVLFHSVAQYA-GEN
CHEB1_AGRFC      QTGKIYLAPGGERHLQIANRS--APCCRLLDRDP---VNGHRPSVDVLFDSVAELA-GRN
CHEB1_CAUVC      EPGKVYVAPGGATHLEVVRSA--GLRCRLVAGDP---VSGHRPSVDVLFNSVAHAV-GDK
CHEB_BORBU       RPGLVIIANGS-YHLIVKYSSGNYFVNLLDGP----LVSRHKPSVNVLFRSAAMYA-GSN
                       :      .                            *  .              

CHEB3_RHOPA      ALGIIMTGMGDDGARGLLEMRKL--GAYTCAQDEESCVVFGMPKEAIACGAVEKVVSLNQ
CHEB2_GEOSL      AVGVIMTGMGDDGASGMREMKDA--GAMTIAQDEASCVVFGMPNEAIKRGGTVKVLPLES
CHEB1_CHRVO      AIGVIMTGMGDDGARGMREMHDA--GARTVAQDEESCVVFGMPAEAINHGGVDEVMSLER
CHEB3_SHEON      ALGVIMTGMGDDGARGLLEMHQC--GAITLAQDEASCVVYGMPKEAVKLGAVSRQVALDN
CHEB3_LEPIN      AKGIIMTGMGNDGANGLLKMKQS--GAHTIAQDEASCVVFGMPKEAILKGAVNTILPLSK
CHEB_BDEBA       AMGVVLTGMGKDGAEGLLEMKNA--GAYTVAQNEETCVVYGMPAAAVALGAADKVLPLDR
CHEB3_PSEAE      AVGVLLTGMGRDGAQGLKQMRER--GFLTIAQDQASCAVYGMPKAAAAIDAAVQILSLEK
CHEB_RHILO       VIGVLLTGMGRDGARGLRQLRDK--GHLTIAQDRATSAVYGMPKAAADIGAAVDILPLSA
CHEB3_RHIME      SLAVVLTGMGDDGTEGLRALRMA--GGKAIAQDEKSSVVFGMPKSAIGAGLVDLVLPLES
CHEB1_PSEAE      VLAVVLTGMGADGREGARLLKQG--GSQVWAQDEASCVIYGMPMAVVKANLADAVYGLDD
CHEB1_SHEON      VLAVVLTGMGADGREGARMLKAA--GATIWAQDEASCVVYGMPQAVASTGIATQSISLDN
CHEB1_GEOSL      ALGVILTGMGSDGFKGMKHLKSK--GGITIVQDEATSTIYGMPRACIEGGVADTVLPLTQ
CHEB2_RHOPA      ILAVVLTGMGSDGMRGGKDIVAA--GGSVIAQDEASSVVWGMPGAVANAGVCAAVLPLNQ
CHEB2_CAUVC      VLGVVLTGMGRDGRDGAAVLAKV--GGTIIAQDEATSVVWGMPGAVANAGLAEAVLPLDQ
CHEB1_LEPIN      IIGVIMTGMGKDGSAAIVRVREI--GGSTIAQDEQTSVIYGMNRQAVEMGGVEYIEPVTE
CHEB1_METMA      IVAAILTGMGFDGAAGFKKIRDA--GGSTIACSEDTCVIFGMPKAAIAAGGIDTVKPIFE
CHEB_ARCFU       VVGAILTGMGEDGAYGMKLIKDR--GGLTIASSEDTCMVFGMPKAAIELGGITSVKPVFE
CHEB_CLOAB       IVSAVLTGMGKDGSNGTGIIKDN--GGVTISESETTCVIYGMPKAAFETGKVDLVVPIDN
CHEB_PYRHO       TVGVVMTGMGRDGAQGIVEIKKK--GGITIAQDEKTSIIFGMPKAAIETGMVDYVVPLEK
CHEB_THEMA       TIAVILTGMGKDGTKGAFKVKFY--GGTVIAEDKETCVVFGMPKSVIEEGYADYVLPAYK
CHEB_METMP       TIGVLLTGIGRDGANGLKMVKNK--GGYTIAQNQDTCVIYGMPKTAIEMNVVDKVMDPID
CHEB_CALS4       IIGILLTGMGDDGADMMVEIRKR--GGLTIAESQETAIVYGMPRAAVERGGAEIVAPAYK
CHEB3_VIBCH      LLCVMLTGMGDDGATEMAQVAQG--NGIVFAQEPTTCVVPSMPEALLKRVPHIPTGTPEH
CHEB_HALSA       LVSVVLTGMGSDGADGVRAVKDA--GGATLAQNEATSAVFGIPERAIETGCVDDVLPVDQ
CHEB2_METMA      VISLVLTGMNCDGADGAEEIKKM--GGKVIAEDQSSCVIYGMPGEIVRRNLADFVLPLDK
CHEB_BACHD       KVAVIMTGMGSDGTEGL-EQLKR-GSCYAIAESEQSCVVFGMPKVAIERKLVDEVTHLEL
CHEB_BACSU       KVAVIMTGMGSDGTAGLKDMLTA-GNVKAIAESEESCVVYGMPKAAVKAGLIHEIKHVED
CHEB_OCEIH       KITCILTGMGNDGTDGLQQLRLNEGSTISLAESADTAIVYGMPKAAVNAGLIDYEMSLHE
CHEB2_DESVH      ALGVILTGMGSDGMEGMKVLKQK--GGRSIAQSDATCVVYGMPKAIVDAGLADEIVDIDD
CHEB_TREPA       ALGILMTGMGRDGAAQLARLYTE--GSRTIAQDADSCIVYGMPRVACELGAVGEQVSLDD
CHEB3_GEOSL      TLGVVLTGMGNDGSKGVAAINRA--GGQTLAEAEETAVVFGMPKEAIATGVVDKIVSLDR
CHEB_ECOLI       AVGVILTGMGNDGAAGMLAMRQA--GAWTLAQNEASCVVFGMPREAINMGGVCEVVDLSQ
CHEB2_PSEAE      LLAGLLTGMGKDGARGLLAIRQA--GGYTLAQDEATCVVYGMPREAVELGAAEDVLPLER
CHEB1_XANCP      AVGAILTGMGDDGARGLLEMLQA--GAPTLVQDEASSVVWGMPGAAYKLGAAQEVVPLER
CHEB3_CHRVO      AIGVILTGMGKDGAEGLLRMRHA--GAVTFGQDEASCVVYGMPREAFRIGAVAHVLPLNR
CHEB2_VIBVY      AIGVILTGMGKDGAQGMLQMKQQ--GAITVAQDEQSCVVYGMPRAAVECGAAMHIKPLNK
CHEB2_SHEON      ATAVILTGMGKDGADGIEAIDMQ--GGKTFAQGEQSCVVFGMPKEAIKRGAIHHVVELPQ
CHEB1_AGRFC      AVGVILTGMGRDGAAGLLKMRHA--GARTVGQNEKTCVVYGMPRVAYELGAVEQQLPLAS
CHEB1_CAUVC      AVGVILTGMGRDGAQGLLTMRKA--GAKTLGQDEASCVVYGMPRSAFEIGAVERQVSLSS
CHEB_BORBU       AIGVILTGMGDDGAVCMLEMKKN--GAYTIAQDQETSVVFGMPMEAIKIGAVDKILPLSE
                     ::**:. **            .         :. : .:                  

CHEB3_RHOPA      IPREIMAWQQAKQPASAD--------
CHEB2_GEOSL      IAADVIRHCS----------------
CHEB1_CHRVO      IAHMLAGIRG----------------
CHEB3_SHEON      IAEEIIAFTKQ---------------
CHEB3_LEPIN      IVGEVQYF------------------
CHEB_BDEBA       IAGDLLKQLQTRNAA-----------
CHEB3_PSEAE      IAPRLAEVFD----------------
CHEB_RHILO       IGSRIIEACERST-------------
CHEB3_RHIME      IAENITAIARGRSEPEGETRT-----
CHEB1_PSEAE      IGRHLVEACQ----------------
CHEB1_SHEON      MAESILKESARG--------------
CHEB1_GEOSL      IGSEIARLGG----------------
CHEB2_RHOPA      IGPKVVRLFAGDRS------------
CHEB2_CAUVC      IGPYIASRARSVA-------------
CHEB1_LEPIN      IINRIQIILKERGI------------
CHEB1_METMA      IPEEIVRMSEVKCNGK----------
CHEB_ARCFU       IAEEIVRFLEVKLNER----------
CHEB_CLOAB       VADEIIKIVRGLRR------------
CHEB_PYRHO       IPETVVKAVEIIRGGGNLGRHVTISR
CHEB_THEMA       IPEKLIELV-----------------
CHEB_METMP       IPLEIIKFAKKIGG------------
CHEB_CALS4       ISDILLKKVNEYARTSEY--------
CHEB3_VIBCH      LAYLMTEVVRQSSRELHYGNH-----
CHEB_HALSA       LTEAIADSIRRTT-------------
CHEB2_METMA      MADEIVKIVR----------------
CHEB_BACHD       IADSIVRQCKR---------------
CHEB_BACSU       IAASITSCVKKERV------------
CHEB_OCEIH       IPSLIVKQLT----------------
CHEB2_DESVH      MAAAIMNGLYK---------------
CHEB_TREPA       MAATINRYGKVFASS-----------
CHEB3_GEOSL      MSREIIQRCGLLSDVD----------
CHEB_ECOLI       VSQQMLAKISA-GQAIRI--------
CHEB2_PSEAE      IAAALLQQAARRGSGNRL--------
CHEB1_XANCP      VAERLIALSAQAR-------------
CHEB3_CHRVO      LAEKVVECLQSQAERAIT--------
CHEB2_VIBVY      LPQFLCDLLS----------------
CHEB2_SHEON      LGDKLLQYLASVNRD-----------
CHEB1_AGRFC      IGEEILKLTTARKEGAD---------
CHEB1_CAUVC      MGQSILDLASARR-------------
CHEB_BORBU       IADHVLRRS-----------------
                 :   :