CLUSTAL format seed alignment for MF_00101

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

ACPS_STRPN       ---MIVGHGIDIEELASIESAVTRHEG-FAKRVLTAQEMERFTSLKGR---RQIEYLAGR
ACPS_STRP1       ---MIVGHGIDLQEISAIEKVYQRNPR-FAQKILTEQELAIFESFPYK---RRLNYLAGR
ACPS_BACHD       ---MIIGTGIDIVELERIQSMVEKHPR-FVKKILTENEQEVFARLSRR---RRLEYIAGR
ACPS_LACRE       ---MIYGIGIDITNIDRFKALHNPTS--FIKKVLTDKEQAELAGKSGQ---RAYEFLAGH
ACPS_LISIN       ---MIKGIGLDMIDLDRVKQAVEKNPR-FIERILTEKETKQYEKYEGS---RKIEFLAGR
ACPS_LISMO       ---MIKGIGLDMIDLERVKQVVEKNPR-FIERVLTEKEIKQFEKYEGN---RKIEFLAGR
ACPS_BACSU       ---MIYGIGLDITELKRIASMAGRQKR-FAERILTRSELDQYYELSEK---RKNEFLAGR
ACPS_STAAM       ---MIHGIGVDLIEIDRIKVLYSKQPK-LVERILTKNEQHKFNNFTHEQ--RKIEFLAGR
ACPS_STAA8       ---MIHGIGVDLIEIDRIQALYSKQPK-LVERILTKNEQHKFNNFTHEQ--RKIEFLAGR
ACPS_LACLA       ---MVFGTGVDNVELSRIQKALTRSER-FVEQVLTAVELEKYNSFQSTA--RKTEFLAGR
ACPS_CLOAB       ---MIKGVGVDIIEINRVKNAIDRNYK-FIEKLFSRREIAYIKAEKTK----A-QYIAGR
ACPS_CLOPE       ---MIIGIGVDIIEIERVRQAIQNNKN-FLSKLFTERELDYFISRNMN----S-EVIAGN
ACPS_CHLMU       ----MFGIGTDIIEIDRIRRAYHTYGDRFLNKIFTKGEQAYCFSKSD-----PYASLAVR
ACPS_CHLTR       ----MFGVGIDIIEIDRIRKSYQTYGDRFLKKIFTEGERVYCFSKSN-----PYASLAAR
ACPS_CHLPN       --MEIIHIGTDIIEISRIREAIATHGNRLLNRIFTEAEQKYCLEKTD-----PIPSFAGR
ACPS_AQUAE       ------MIGVDIVKNERIKDALERFGDKFLDRIYTKRELEYCYAHCD-----FLPCLAAR
ACPS_HELPY       ------MIGIDIVSIARIEKCVKRFKMKFLERFLSPSEIVLCKDK--------SSSIAGF
ACPS_HELPJ       ------MIGIDIVSIARIEKCVKRFEMRFLERFLSPSEIVLCKDK--------SSSIAGF
ACPS_CAMJE       -----MRVGCDIIAISRIEKIHSRHGKNFLDKFLNPKEQILIKN---------PATLAGL
ACPS2_ECO57      -----MRIGTDIVEIARITKAIINGEMAFYERVYTSHERLLINPAEP-----DYERASGF
ACPS_RICCN       ---MLIGVGTDIVQIPRIEKILHLYPELFAKKILTSKELKQFALLGKIN---HAAFLAKR
ACPS_RICPR       ---MLIGVGTDIVQIPRIEKILNIYQELFAKKILALKELKQFTLLNKTN---HATFLAKR
ACPS_ECOLI       --MAILGLGTDIVEIARIEAVIARSGDRLARRVLSDNEWAIWKTHHQ-----PVRFLAKR
ACPS_ECO57       --MAILGLGTDIVEIARIEAVIARSGERLARRVLSDNEWEIWKTHHQ-----PVRFLAKR
ACPS_SALTY       --MAILGLGTDIVEIARIEAVISRSGERLARRVLSDNEWAIWETHQQ-----PVRFLAKR
ACPS_YERPE       --MAILGLGTDIVEISRIQAVVERTGERLARRILSPSEWQHYQQHQQ-----PVRFLAKR
ACPS_VIBCH       ---MIVGLGTDIAEIERVEKALARSGENFARRILTDSELEQFHASKQ-----QGRFLAKR
ACPS_BUCAI       --MSIIGIGIDFVEILRIKNIFLKYGDKFARKILSTEEWKKYILIDD-----SISFLAKK
ACPS_NEIMA       ---MIYGIGTDIVSLKRIVRLSKKFGQAFAERILTPEELLEFPQAGK-----PVNYLAKR
ACPS_NEIMB       ---MIYGIGTDIVSLKRIIRLNKKFGQAFAGRILTPEELLEFPQAGK-----PVNYLAKR
ACPS_RHILO       ---MIIGIGSDLIDIRRIENSLERHGQRFVQRIYTEVEQARSENRRAR-----AASYAKR
ACPS_RHIME       ---MIIGIGSDLIDIRRIENSLQRFGERFVNRCFTDIEIAKSEGRKNR-----AASYAKR
ACPS_BRUME       ---MIVGIGSDLIDIRRVEKTLERHGSRFRDRVFTEIEQRKSEGRKQR-----AASYAKR
ACPS_CAUVC       ---MIIGIGSDLCDIRRIEKSLERFGDRFTHKVFTETERTRSERKPDR-----ASSYAKR
ACPS_BRADU       ---MIIGIGSDLIDITRVGKVIERHGERFLDRIFTAAERAKAERRAKNE-KMVVATYAKR
ACPS_RALSO       MSGAIYGIGTDIIQIERVEGVMQRTHGRFAEKVLGPDELRIYQARKARSERRGLAFLATR
ACPS_DEIRA       ---MIVAVGHDLIEIARIRRMLEREG-VRAERLFTATELAYAG-RYRD----PAPSLAAR
ACPS_STRCO       --MSIIGVGIDVAEVERFGAALERTP-ALAGRLFLESELLLPG-GERR----GVASLAAR
ACPS_MYCLE       --MGIVGVGIDLVSIPDFAEQVSQPG-TVFMTIFTPGERRDASVKSSS----AVCHLAAR
ACPS_MYCTU       --MGIVGVGIDLVSIPDFAEQVDQPG-TVFAETFTPGERRDASDKSSS----AARHLAAR
ACPS_TREPA       ---MIIGVGIDIVEIERFVSWTHN---VRLLRRFFHQEEIVDFFKNHM----RAQFLATR
ACPS_MYCGE       ---MVVGIGIDVVQLKRFLTLV-ETSDCFAKRLLTSNELNSYWKLN---NNQRANFLAVH
ACPS_MYCPN       ---MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRK--DSEKSSFLAVH
ACPS_BORBU       ----MKSIGCDIIKVERFKNFLENKKK--MERFFTHKEIENFKLKGGS----IIESLAGK
ACPS_UREPA       ---MKLVHGIDIIEWNREELNNPL----FAKRILIDNELEYYFQLNSSR--EKKRYLASV
ACPS_MYCPU       --MTLIMIGVDLVKIERLENKS--DH--FVRKILSLDEYELYQKTKA-----KAIFLATR
                         * *                          *                   :  

ACPS_STRPN       WSAKEAFSKAM------GTGIS-KLGFQDLEVLNNERGAPYFSQAP------------FS
ACPS_STRP1       WSGKEAFAKAI------GTGIG-RLTFQDIEILNDVRGCPILTKSP------------FK
ACPS_BACHD       FAAKEAFVKAV------GTGISAEYGWHDLEVLSDERGKPVLSVN-------------LD
ACPS_LACRE       FSVKESYSKAY------GTGLGKKLNFQDIEVEYDDNGRPVISNHP------------FA
ACPS_LISIN       FAAKEAYAKAN------GTGFGKHLSFTDVEILQVEDGRPHVTMPI------------KQ
ACPS_LISMO       FAAKEAYAKAN------GTGFGKHLSFTDVEILQVEDGRPHVTLPV------------KS
ACPS_BACSU       FAAKEAFSKAF------GTGIGRQLSFQDIEIRKDQNGKPYIICTK------------LS
ACPS_STAAM       FATKEAFSKAL------GTGLGKHVAFNDIDCYNDELGKPKIDYEG------------F-
ACPS_STAA8       FATKEAFSKAL------GTGLGKHVAFNDIDCYNDELGKPKIDYEG------------F-
ACPS_LACLA       WAAKEAFSKAY------GTGFGKALGMHDLEIKNDELGKPFFTKHP------------FD
ACPS_CLOAB       FSAKEAVSKAL------GTGFR-GFSFKNIEIHKDDLGKPIVVLNGGARAIAE----GYG
ACPS_CLOPE       FAAKEAVSKAL------GTGIR-GFSFKDIEILRNELGKPEVILHNGANLIGNKLVGNNN
ACPS_CHLMU       FAAKEAVSKAL------GTGIGKSLKWKEIEISRGTQHP--QVSVPESLLALL------E
ACPS_CHLTR       FAAKEAVAKAL------GTGIGKLLKWKEIEMCRDSRQP--QVVVPEALLCSL------G
ACPS_CHLPN       FAGKEAVAKAL------GTGIGSVVAWKDIEVFKVSHGP--EVLLPSHVYAKI------G
ACPS_AQUAE       WAGKEAVLKAF------YTEFKIFLRFKEIEILGNRGRPPTVVINREGVEEIL------K
ACPS_HELPY       FALKEACSKAL------QVGIGKELSFLDIKISKSPKNAPLITLSKEKMDYF-------N
ACPS_HELPJ       FALKEACSKAL------QVGIGKELSFLDMRISKSPKNAPLITLSKEKMDYF-------N
ACPS_CAMJE       WAAKEAASKAL------GVGICELCSFFDIEISKDEKNAPKLKYSQKITKDF-------N
ACPS2_ECO57      WAAKEALVKAI------GCGFRDGVRFQDIEIKHDAAKAPYFVISGRLQEIFIGQ----G
ACPS_RICCN       FAAKEAVSKAF------GVGIGQGINFKDITILNNDLGKPIVEVSSNYTNTLSPF-----
ACPS_RICPR       FSAKEAVSKAF------GVGIGRGINFKDITILNDNLGKPTVEISSHYTNKLAPF-----
ACPS_ECOLI       FAVKEAAAKAF------GTGIRNGLAFNQFEVFNDELGKPRLRLWGEALKLAEKLG----
ACPS_ECO57       FAVKEAAAKAF------GTGIRNGLAFNQFEVFNDELGKPRLRLWGEALKLAEKLG----
ACPS_SALTY       FAVKEAAAKAF------GTGIRNGLAFNQFEVFNDELGKPRLRLWGEALTLAEKLG----
ACPS_YERPE       FAVKEAAAKAF------GTGIRNGLAFNQFEVVNDALGKPTLRLHSRAAELAVELG----
ACPS_VIBCH       FAAKEAASKAL------GTGIAQGVTFHDFTISHDKLGKPLLILSGQAAELASQLQ----
ACPS_BUCAI       FVAKEAASKAL------GTGINHQITFNQLEFYKNKSGKPKLRFLKHALKKSKEIQ----
ACPS_NEIMA       FAAKEAFAKAV------GTGIRGAVSFRNIGIGHDALGKPEFFYAPALSKWLEEQG----
ACPS_NEIMB       FAAKEAFAKAV------GTGIRGAVSFRNIGIGHDALGKPEFFYGPALSKWLEEQG----
ACPS_RHILO       FAAKEACAKAL------GTGLAQGVFWRDMGVVNLPSGAPTMALTGGALARLEKILPPGH
ACPS_RHIME       FAAKEACSKAL------GTGLAQGVFWKDMGVVNLPGGKPTMQLTGGAAARLQEMLPVGH
ACPS_BRUME       FAAKEACAKAL------GTGIAEGVFWRDMGVVNTPSGKPTMHLTGGAAKQLQKLLPAGT
ACPS_CAUVC       FAAKEACSKAL------GTGLKRGVHLAGMGVVNLPSGQPTMALTGGALERLKAMVPEGM
ACPS_BRADU       FAAKEACSKAL------GTGIRRGVWWRDMGVVNLPGGRPTMQLTGGALARLQALTPDGF
ACPS_RALSO       FAAKEAVSKAI------GLGMHWPMTWRAVQTLNLPSGQPVVRYSGELADWIAQ-----R
ACPS_DEIRA       FAAKEAFQKVW------LRPHGWRDVWVERERTPDGPFPYAAPMLGFAPAIAGEMHER--
ACPS_STRCO       FAAKEALAKAL------GAPAGL--LWTDAEVWVEAGGRPRLRVTGTVAARAAELGVA--
ACPS_MYCLE       WAVKEAVIKAWSGSRFAQRPMLPENIHRDIEVVNDMWGRPRVRLTGAIAKHLTDVTI---
ACPS_MYCTU       WAAKEAVIKAWSGSRFAQRPVLPEDIHRDIEVVTDMWGRPRVRLTGAIAEYLADVTI---
ACPS_TREPA       FAAKEAFGKAL-------GTGLRNMELRNIRVCQNGWGKPRLEVYGAAQAMLAATGGT--
ACPS_MYCGE       WTLKEAIYKAT-------SHIKPLFTKLEIYKLNNQYRCEFIQNIN--------------
ACPS_MYCPN       WSLKEAIYKAV-------NHIKPLFSQLEITKKNQRYNCQIDPKIE--------------
ACPS_BORBU       FAAKESLIKALS----PLLQYKINYTLKDIEVIKSLKGNAEFCLHNEVEKFAIKM-----
ACPS_UREPA       FACKEAVMKAL----------KLKYGYGDILILKTENQRQ-VYLNK----ILIK------
ACPS_MYCPU       WAIKEALFKAD----------NQHFCFKKINITKKD-N--VYKFDG--------------
                 :  **:  *.                                                  

ACPS_STRPN       G-KIWLSISHTDQFVTASVILEENHES------
ACPS_STRP1       G-NSFISISHSGNYVQASVILEDKK--------
ACPS_BACHD       A-TIHVSISHSQSYAIAQVILERLSS-------
ACPS_LACRE       G-VAHVSISHSKHHVVTQVILEGD---------
ACPS_LISIN       GETVFVSITHTARSAAAQVIIEQ----------
ACPS_LISMO       GENVFVSITHTARSAAAQVIIEI----------
ACPS_BACSU       QAAVHVSITHTKEYAAAQVVIERLSS-------
ACPS_STAAM       --IVHVSISHTEHYAMSQVVLEKSAF-------
ACPS_STAA8       --IVHVSISHTEHYAMSQVVLEKSAF-------
ACPS_LACLA       G-QVHLSISHSNLEAVAFVVLEKN---------
ACPS_CLOAB       KYQVQLSISHDREKAIAYAVLEVF---------
ACPS_CLOPE       SLRVHLSISHNNSSAIAYSVLEGEYYGNM----
ACPS_CHLMU       VKRILLSMSHCREYATAVAIAEVTNSSK-----
ACPS_CHLTR       VKRVLLSVSHSREYATAVAIAE-----------
ACPS_CHLPN       ISKVILSISHCKEYATATAIALA----------
ACPS_AQUAE       NYEVIVSLSHERDYSVAVAYIKKKS--------
ACPS_HELPY       IQSLSASISHDAGFAIAVVVVSSSNE-------
ACPS_HELPJ       IQSLSASISHDAGFAIAVVMVSSSNL-------
ACPS_CAMJE       ITQTSLSISHDNGFAIAIVAVV-----------
ACPS2_ECO57      LQNNSLSISHCRTHAIATVIVY-----------
ACPS_RICCN       --NIHLSLADDYPVCVAFAVIESSYNVILG---
ACPS_RICPR       --NIHLSLSDDYPICIAFAIIESNC--------
ACPS_ECOLI       VANMHVTLADERHYACATVIIES----------
ACPS_ECO57       VANMHVTLADERHYACATVIIES----------
ACPS_SALTY       VAHMHVTLADERHYACATVILES----------
ACPS_YERPE       VKSLHVTLADERRYACATVIIES----------
ACPS_VIBCH       VENIHLSISDERHYAMATVILERR---------
ACPS_BUCAI       CKSIHVSISDQKLYAYALVILEN----------
ACPS_NEIMA       ISRVSLSMSDEEDTVLAFAVAEK----------
ACPS_NEIMB       ISRVSLSMSDEEDTVLAFVVAEK----------
ACPS_RHILO       KAAIHLTITDDFPLAQAFVIIEALPVEQAPH--
ACPS_RHIME       RAAIHLTITDDFPLAQAFVIIEALPVAPAEGTV
ACPS_BRUME       NAAIHLTITDDFPLAQAFVIIEALPVLE-----
ACPS_CAUVC       EPVIHLSLTDDHPYAQAFVIIEALPKR------
ACPS_BRADU       EARIDVSITDDWPLAQAFVIISAVPLAKS----
ACPS_RALSO       GLHIQISVTDERDYAVAFAVAELQSKLSA----
ACPS_DEIRA       GWVAHLTLTHTREHASAVVILEHLEQRAAP---
ACPS_STRCO       SW--HVSLSHDAGIASAVVIAEG----------
ACPS_MYCLE       ----HVSLTHEGDIAAAVVILEVL---------
ACPS_MYCTU       ----HVSLTHEGDTAAAVAILEAP---------
ACPS_TREPA       HI--QVSLTHEREVASAIVIIEGEPL-------
ACPS_MYCGE       ---LLLSVSYTNCHVSAICLAQQNG--------
ACPS_MYCPN       ---LLLSVSYSSNNITAICLAQQTPWKN-----
ACPS_BORBU       NLKLYLTISHEKEYAIAFVIVEN----------
ACPS_UREPA       --ELELSISYTETYIVASVVGLINNMN------
ACPS_MYCPU       ---FAISVSSEKEYVIAFVQKIGVACHRD----
                       :::       :