CLUSTAL format seed alignment for MF_00103

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

FPG_BACFI       MPELPEVETVKRTLTELVIGKTIAGITVKWANIIKEP-ADVLEFETLLMNQTIRSIRRRG
FPG_BACHD       MPELPEVETVRRTLAELVIGKTIEQVDVGWAKMIKRP-DDVDQFKWLLKGQTIRSMGRRG
FPG_BACSU       MPELPEVETVRRTLTGLVKGKTIKSVEIRWPNIIKRP-AEPEEFARKLAGETIQSIGRRG
FPG_LISIN       MPEMPEVENVRATLQELVPGKKIDQVIVRVPKMIVAT-P-PDEFVHMLVGQEIEAVRRRG
FPG_LISMO       MPEMPEVENVRATLQELVPGKKIDQVIVRVPKMIVST-P-PDEFVHMLVGQEIEGVRRRG
FPG_LACLA       MPELPEVETVRRELEKRIVGQKIVSIEATYPRMVL---TGFEQLKKELTGKTIHGISRRG
FPG_LACLC       MPELPEVETVRRELEKRIVGQKIISIEATYPRMVL---TGFEQLKKELTGKTIQGISRRG
FPG_STRP1       MPELPEVETVRRGLETLVLGQEIVAVTLKVPKMVK---TDLETFALTLPGQIIQSVGRRG
FPG_STRP8       MPELPEVETVRRGLETLVLGQEIVAVTLKVPKMVK---TDLETFALTLPGQIIQSVGRRG
FPG_STRMU       MPELPEVETVRRGLEHLIVGKKIVSVEVRVPKMVK---TGVEDFQLDILGQTFESIGRRG
FPG_STRPN       MPELPEVETVCRGLEKLIIGKKISSIEIRYPKMIK---TDLEEFQRELPSQIIESMGRRG
FPG_NOSS1       MPELPEVETVRRGLNQLTLNRKITGGDVLLHRTIAHPFS-VGDFLNGITGSTISTWHRRG
FPG_SYNY3       MPELPEVETVCRGLNRLTLEQTIGGGEVLLDRSLAYPVS-VEDFQKQITGCRLVGWQRRG
FPG_SYNEL       MPELPEVETVRRGLELVTLKQPIVDVEVLLARSIALPKE-PQAFIEHLRDRRIEQWQRRG
FPG_MYCLE       MPELPEVEVVRRGLQDYIVGKTITAVRVHHPRAVRRHVAGPTDLTNRLLGTRINGIDRRG
FPG1_MYCTU      MPELPEVEVVRRGLQAHVTGRTITEVRVHHPRAVRRHDAGPADLTARLRGARINGTDRRG
FPG_STRCO       MPELPEVEVVRRGLERWAAHRTVADVEVLHPRAVRRHVAGPDDFAHRLKDHRIGTPSRRG
FPG_CORGL       MPELPEVEVVRRGLEDHMVGHTIVSATVLHPRAARNQLGGGPEIEANIAGLRVSAAKRRG
FPG_AGRFC       MPELPEVETVRRGLAPAMEGARVRKLHLGRPD---LRFPFPADFAGLIEGKTIISLGRRA
FPG_RHIME       MPELPEVETVKRGLAPTMEGALLVRAELRRPD---LRFPFPENFANAVAGRRIIALSRRA
FPG_BRUME       MPELPEVETVRRGLQPFMEGATVVRVEQNRPD---LRFAFPENFAERLSGRRIEALGRRA
FPG_RHILO       MPELPEVETVRRGLQPVLEGARLTRVEARRPD---LRFPFPERFSERLTGKTITALGRRA
FPG_CAUVC       MPELPEVETVRRGLEPVLSGARLSSVRANRPD---LRFPLPDGFVQRLTGARILRLDRRA
FPG_ZYMMO       MPELPEVETTIRGLSEVLMGEKIIDVKVRRAS---LRRPIPSDIQERLIGSTIISLSRRA
FPG_ECOLI       MPELPEVETSRRGIEPHLVGATILHAVVRNGR---LRWPVSEEIYRLS-DQPVLSVQRRA
FPG_ECO57       MPELPEVETSRRGIEPHLVGATILHAVVRNGR---LRWPVSEEIYRLS-DQPVLSVQRRA
FPG_SALTI       MPELPEVETSRRGIEPHLVGATILHAHIRNGR---LRWPVSDEIYRLS-DTPVLSVQRRA
FPG_SALTY       MPELPEVETSRRGIEPHLVGATILHAHIRNGR---LRWPVSDEIYRLS-DTPVLSVQRRA
FPG_YERPE       MPELPEVETSRRGIEPYLVGQTILYAVVRNAR---LRWPVSDEILTLS-DQPVLSVQRRA
FPG_VIBCH       MPELPEVEVSRLGISPHLVGGTIQSLVLRTPK---LRWPIPQELKQLE-GQTILAIHRRA
FPG_HAEIN       MPELPEVETALRGISPYLKNFTIEKVVVRQPK---LRWAVSEELITLK-NVKIVDLTRRA
FPG_PASMU       MPELPEVETTKNGISPYLEGAIIEKIVVRQPK---LRWMVSEELAQIT-QQKVIALSRRA
FPG_NEIMA       MPELPEVETTLRGIAPHIEGKTVEAVVLRQLK---LRWQINPDLGEILSGRQVLSCGRRA
FPG_NEIMB       MPELPEVETTLRGIAPHIEGKTVEAVVLRQLK---LRWQINPDLGEILSGRQVLSCGRRA
FPG_XANAC       MPELPEVETTLRGLSPHLVGQRIHGVILRRPD---LRWPIPEQIERLLPGATITNVRRRA
FPG_XANCP       MPELPEVETTLRGLAPHLVGQRIHGVILRRPD---LRWPIAAQIEQLLPGATITDVRRRA
FPG_XYLFA       MPELPEVETTLRGLLPYLTNQLIYSLTLRRRT---LRWDIPSHIESRLPGHRITTVCRRA
FPG_PSEAE       MPELPEVETTRRGIAPYLEGQRVERVIVRERR---LRWPIPEDLDVRLSGQRIVSVERRA
FPG_RALSO       MPELPEVEVTRLGLVPHLTGRRIVRAVVRHHG---LRWPVDPALPELLGGRTVARVLRRG
FPG_RICCN       MPELPEVETLKNSLKDKLIGLIIENVELKRDN---LRYKLSPLLATETLNTNILDVRRRA
FPG_DEIRA       MPELPEVETTRRKIEPLLRGKTIERIVHD------A--PHRYRNTERAHGRQVRGLTRRG
FPG_THET8       MPELPEVETTRRRLRPLVLGQTLRQVVHR------D--PARYRNTALAEGRRILEVDRRG
FPG_MYCGE       MPELPEVTTVINELKETVLNKPLDQVQVNLRKV--LKNIDPQLLNKQLKNQFFTDIKRKG
FPG_MYCPN       MPELPEVATVITELKSCVLNKPVKQVKVHLDKV--LKNTNVKQLNDALVNHSFVDIKRRG
FPG_UREPA       MPELPEVQTIVDYLNHHVLDIFIKKTIVHLPKI--LKNKTPQEFEKLLINHKIVKIKRLG
FPG_MYCPU       MPELPEVRVVCKSLNEKVQNLVFKKVEIFNPKL--FKEYDPSYFQEFLIGEKILKISNLG
                ***:***      :        .                             .    . .

FPG_BACFI       KFLLF--------EFDDI----------VMVSHLRMEGRYGLYEK---------------
FPG_BACHD       KFLLF--------HLDDY----------TLVSHLRMEGRYGLYQQ---------------
FPG_BACSU       KFLLF--------HLDHY----------VMVSHLRMEGKYGLHQA---------------
FPG_LISIN       KFLLF--------DLTNC----------TILSHLRMEGKFRLMDE---------------
FPG_LISMO       KFLLF--------DLTNC----------TILSHLRMEGKFRLMDE---------------
FPG_LACLA       KYLIF--------EIGEKD---------RLISHLRMEGKYRLASL---------------
FPG_LACLC       KYLIF--------EIGDDF---------RLISHLRMEGKYRLATL---------------
FPG_STRP1       KYLLI--------DLGQL----------VLVSHLRMEGKYLLFPD---------------
FPG_STRP8       KYLLI--------DLGQL----------VLVSHLRMEGKYLLFPD---------------
FPG_STRMU       KYLLL--------NLNRQ----------TIISHLRMEGKYLLFED---------------
FPG_STRPN       KYLLF--------YLTDK----------VLISHLRMEGKYFYYPD---------------
FPG_NOSS1       KYLLAELSASPS--TTSIP---------WLGVHLRMTGQLLWLNQ------D--------
FPG_SYNY3       KYLLGELRSNQA--PGPAG---------WLGCHLRMTGQLLWTER------D--------
FPG_SYNEL       KYLLATLDDG-----SR------------LVIHLRMSGQLLWLTT------P--------
FPG_MYCLE       KYLWFLLDT--------DI---------ALVVHLGMSGQMLLGT----------------
FPG1_MYCTU      KYLWLTLNTAGV-HRPTDT---------ALVVHLGMSGQMLLGA----------------
FPG_STRCO       KYLWLPLED-------TDQ---------AVLAHLGMSGQLLVQPH------E--------
FPG_CORGL       KFLWLELIDAPSGETRPDL---------GLLVHLGMSGQMLIKEP------D--------
FPG_AGRFC       KYLLI--------ELEDGL---------TIVSHLGMSGSFRIEA---EKGEGGEAPGAFH
FPG_RHIME       KYLMI--------ELEGGD---------VIIAHLGMSGSFRIEKGPIEAGADPATPGAFH
FPG_BRUME       KYLTV--------HLDDGL---------SIISHLGMSGSFRIEAE-----DAQGLPGGFH
FPG_RHILO       KYLTM--------HVQDGP---------VLICHLGMSGSFRIETD-----DDGETPGVFH
FPG_CAUVC       KYILA--------PLDRGD---------TLVMHLGMTGRFEIAAP-----EGTVRPGDFA
FPG_ZYMMO       KYGII--------VNDRDD---------ALIFHLGMSGRWKINPE---------------
FPG_ECOLI       KYLLL--------ELPEG----------WIIIHLGMSGSLRILPE-----EL--------
FPG_ECO57       KYLLL--------ELPEG----------WIIIHLGMSGSLRILPE-----EL--------
FPG_SALTI       KYLLL--------ELPDG----------WIIIHLGMSGSLRILSE-----AL--------
FPG_SALTY       KYLLL--------ELPDG----------WIIIHLGMSGSLRILPE-----AL--------
FPG_YERPE       KYLLL--------ELPKG----------WIIIHLGMSGSLRVLSE-----ET--------
FPG_VIBCH       KYLII--------ETAVG----------SAIVHLGMSGSLRILDG-----DF--------
FPG_HAEIN       KYLII--------HTEKG----------YIIGHLGMSGSVRIVPQ-----DS--------
FPG_PASMU       KYLII--------QLETG----------YMIGHLGMSGSLRVVEK-----GD--------
FPG_NEIMA       KYLIV--------RFQTG----------ILLIHLGMSGSLRIFTP-----SDGRI-----
FPG_NEIMB       KYLLI--------RFQTG----------VLLIHLGMSGSLRIFTP-----SDGRI-----
FPG_XANAC       KYLLI--------DTDAGG---------SVLLHLGMSGSLRVLPG-----DT--------
FPG_XANCP       KYLLI--------DTDAGG---------SAVLHLGMSGSLRVLPG-----DT--------
FPG_XYLFA       KYLLI--------DTNAGG---------SLIIHLGMSGTLRLLAP-----ET--------
FPG_PSEAE       KYLLL--------GAEAG----------TLISHLGMSGSLRLVES-----GT--------
FPG_RALSO       KYLLIECVPDIAHGPQAGAG--------WLLVHLGMTGTLRVLET-----PA--------
FPG_RICCN       KYLII--------DFNNDY---------SLIVHLGMSGRFTLQSA-----NY--------
FPG_DEIRA       KYLLL--------HLAAADAAEDEPHDLELIVHLGMTGGFRLEEG---------------
FPG_THET8       KFLLF--------ALEGG---------VELVAHLGMTGGFRLEPT---------------
FPG_MYCGE       KYIIF--------LLSNGL---------YLVSHLRMEGKYFFEER---------------
FPG_MYCPN       KYIIF--------CLSNGL---------FLVSHLRMEGKYFFEAK---------------
FPG_UREPA       KYLLF--------FLSNNL---------VLSVHLRMEGKFYYQAK---------------
FPG_MYCPU       KNIIY--------FLTNNK---------IMLSHLRMEGKYSFYEQ---------------
                *                               ** * *                      

FPG_BACFI       --EEPLPPHTHVIFHFTDGE----ELRYQDVRKFGTMHLFPKGSE---EKVLPLAHLGVE
FPG_BACHD       --NESVAKHTHVRFVFGDGT----ELRYQDVRKFGTMHLFQSGRE---QMEPPLAKLGVE
FPG_BACSU       --EEPDDKHVHVIFTMTDGT----QLRYRDVRKFGTMHLFKPGEE---AGELPLSQLGPE
FPG_LISIN       --NEEVTKHTHIIFHFEDHT----ELRFLDVRKFGTMEVTNKYGE---SETKSIKKLGPE
FPG_LISMO       --NEEVSKHTHIIFHFEDHT----ELRFLDVRKFGTMEVTNKYGE---GETRSIKKLGPE
FPG_LACLA       --NVPMEKHDHLALKFTDE-----QLIYADVRKFGTWELISTDQV---LPYFLKKNIGPE
FPG_LACLC       --DAPREKHDHLTMKFADG-----QLIYADVRKFGTWELISTDQV---LPYFLKKKIGPE
FPG_STRP1       --EVPDNKHFHVFFELKNGS----TLVYQDVRKFGTFDLIAKSQL---SAFFAKRKLGPE
FPG_STRP8       --EVPDNKHFHVFFELKNGS----TLVYQDVRKFGTFDLIAKSQL---SAFFAKRKLGPE
FPG_STRMU       --EVPDNKHFHLFFGLDGGS----TLVYQDVRKFGTFELLPKSQV---EAYFVQKKIGPE
FPG_STRPN       --QGPERKHAHVFFHFEDGG----TLVYEDVRKFGTMELLVPDLL---DVYFISKKLGPE
FPG_NOSS1       ---EPLHKHTRVRIFFEE----EQELRFVDQRTFGQMWWVP-PGIAVESVITGLAKLAVD
FPG_SYNY3       ---QQRPRHTRVVLHFEG----GWELRFVDTRTFGKVWLLP-GDRPWAEVMTGLGQLGPE
FPG_SYNEL       ---QPPCPHTRVRWFFPT----RAELRFVDQRTFGRCWWLP-PDCRVAEAIPALATLAPE
FPG_MYCLE       ---VPRVDHVRISALFDD----GTVLNFTDQRTLGGWLLADLMTVDGSVLPVPVAHLARD
FPG1_MYCTU      ---VPCAAHVRISALLDD----GTVLSFADQRTFGGWLLADLVTVDGSVVPVPVAHLARD
FPG_STRCO       ---TPAEKHLRIRVRFADAL--GTELRFVDQRTFGGLSLHD-TSADG--LPDVIAHIARD
FPG_CORGL       ---APISPHLRAKVELDN----GDEVWFVDQRTFGYWWLGD--LVDG--VPERVSHIATD
FPG_AGRFC       YARSKDGKHDHVVFHLDKGE-ERVCVIYNDPRRFGFMHLVERNKL---DLYPAFAELGPE
FPG_RHIME       HPRGKDEKHDHVVFHLDGGS-GPARVIYNDPRRFGFMDLARRSAL---ADHVFLRGLGEE
FPG_BRUME       HERSKNSLHDHVVFHLMRPDGASARIIYNDPRRFGFMLFAEKGAL---EEHPLLKDLGVE
FPG_RHILO       HERSKSTAHDHVVFDVVAADGARSRVIFNDPRRFGFMLFAE-GSP---ETHPMLAGLGVE
FPG_CAUVC       REVTPDDKHAHVVFQTEDGA---T-VTYFDPRRFGFMDLIPTDRV---SHHAWFAAMGPE
FPG_ZYMMO       ----NFEKHDHFVLQTKNNF---I-VSLYDPRRFGSLDLVKKNQL---LEWSYFRNIGPE
FPG_ECOLI       ----PPEKHDHVDLVMSNGK----VLRYTDPRRFGAWLWTKELEG-----HNVLTHLGPE
FPG_ECO57       ----PPEKHDHVDLVMSNGK----VLRYTDPRRFGAWLWTKELEG-----HNVLAHLGPE
FPG_SALTI       ----PAEKHDHVDLVMSNGK----ILRYTDPRRFGAWLWTKELEG-----HNVLAHLGPE
FPG_SALTY       ----PAEKHDHVDLVMSNGK----ILRYTDPRRFGAWLWTKELEG-----HNVLAHLGPE
FPG_YERPE       ----AAEKHDHVDLVVSNGK----ILRYTDPRRFGAWLWAKDLET-----SNVLAHLGPE
FPG_VIBCH       ----PAAKHDHVDLVMTSGK----RLRYNDPRRFGAWLWCAPDES-----HEVLGRLGPE
FPG_HAEIN       ----AIDKHDHIDIVVNNGK----LLRYNDPRRFGAWLWTENLDD-----FHLFLKLGPE
FPG_PASMU       ----LIDKHDHLDIVVNNGK----VVRYNDPRRFGAWLWTEKLDE-----FPLFLKLGPE
FPG_NEIMA       ---GRSDRHDHVDIVFSDGT----VMRYRDPRKFGAILWYEGIEEH----HPLLEKLGPE
FPG_NEIMB       ---GRPDRHDHVDIVFSDGT----VMRYRDPRKFGAILWYEGIEEH----HPLLEKLGPE
FPG_XANAC       ----LPRAHDHVDISLQSGR----LLRFNDPRRFGCLLWQSGT-----QAHDLLAALGPE
FPG_XANCP       ----PPRAHDHVDISLQNGR----VLRFNDPRRFGCLLWQRDC-----ETHELLASLGPE
FPG_XYLFA       ----PLRPHDHVDIMLNNRR----VLRFNDPRRFGCLLWQEDG-----QIHPLLQRLGCE
FPG_PSEAE       ----PASRHEHVDIELASGM----ALRYTDPRRFGAMLWSLAP-----LEHELLRNLGPE
FPG_RALSO       ----APGTHDHLDIELADAAGRPITLRYRDPRRFGAVLWHDGDEAAL-SAHPLLRNLGIE
FPG_RICCN       ----KTQKHDHVIFDLSNGE----KLIFNDTRRFGMIYSFKTDLL---E-KEFLNDLGIE
FPG_DEIRA       -------PHTRVTFELGSGE----KLYFNDPRRFGKVVAVAPGD--Y-ASMPTLAAMGPE
FPG_THET8       -------PHTRAALVL-EGR----TLYFHDPRRFGRLFGVRRGD--Y-REIPLLLRLGPE
FPG_MYCGE       -GSKFNQKHVLVEFHFDDGS----QLNYHDTRQFGTFHLYEK-----LEQAAQLNKLAFD
FPG_MYCPN       -GSQFDLNHVLVEFLFQDGD----QLNYHDTRQFGTFHLFNRYQ---FENARELNKLALD
FPG_UREPA       -EEWFNLAHTHIIIEFNNGM----QLRYNDTRQFGTFHIYEQQS---FLDSKELKKIALD
FPG_MYCPU       -KPKETLKHIQAIFYFENGS----ELHYRESRPFGTFHIRYLNN---YLKIDPLAKVAQS
                        *                :   : * :*                     :. .

FPG_BACFI       PFS-EQFTSELLMNAFQKTNRKIKVALLDQKTVVGLGNIYVDEALFRARIHPERLAHSLS
FPG_BACHD       PFS-DQFSAKLLTERLSKTSRKIKSALLDQGIIVGLGNIYVDEALFRARIHPERLAKDVT
FPG_BACSU       PDA-EEFTSAYLKDRLAKTNRAVKTALLDQKTVVGLGNIYVDEALFRAGVHPETKANQLS
FPG_LISIN       PLT-PAFTLADFATGVKKTSRAIKTALLDQKLVAGVGNIYADEICFEAKVHPERAANSLS
FPG_LISMO       PLT-QAFTLTDFATGVKKTSRAIKTALLDQKLVAGVGNIYADEICFEAKVRPERAANSLS
FPG_LACLA       PTY-ETFDEQIFREKLQKSTKKIKPFLLEQTLVAGLGNIYVDEVLWLAKIHPEKVANQLT
FPG_LACLC       PTYDEDFDEKLFREKLRKSTKKIKPYLLEQTLVAGLGNIYVDEVLWLAKIHPEKETNQLI
FPG_STRP1       PKK-ETFKLKTFEAALLSSQKPIKPHLLDQTLVAGLGNIYVDEVLWAAKVHPETASSRLN
FPG_STRP8       PKK-ETFKLKTFEAALLSSQKPIKPHLLDQTLVAGLGNIYVDEVLWAAKVHPETASSRLN
FPG_STRMU       PNA-KDFKLKPFEEGLAKSHKVIKTLLLDQHLVAGLGNIYVDEVLWAAKVDPERLASQLK
FPG_STRPN       PSE-QDFDLQVFQSALAKSKKPIKSHLLDQTLVAGLGNIYVDEVLWRAQVHPARPSQTLT
FPG_NOSS1       PFS-PEFTVEYLANKLHNRRRPIKTALLDQSVVAGLGNIYADEALFKSGVLPETLCTEVQ
FPG_SYNY3       PFG-ADFTAEYLYEKLKSSRRPLKNALLDQRLVAGLGNIYADEVLFFCGFHPTMASNQVS
FPG_SYNEL       PLS-EAFTVAFLAARLAHCRRSIKTALLDQSIVAGMGNIYADESLFLSGLHPTQSAHTLT
FPG_MYCLE       PFD-PRFDVEAVVKVLRCKHSELKRQLLDQQTVSGIGNIYADEALWRAEVHGARIAATLT
FPG1_MYCTU      PLD-PRFDCDAVVKVLRRKHSELKRQLLDQRVVSGIGNIYADEALWRAKVNGAHVAATLR
FPG_STRCO       PLD-PLFDDEAFHHALRRKRTTIKRALLDQSLISGVGNIYADEALWRARLHYERPTATLT
FPG_CORGL       VLD-ESADFSAIARNLKSRKSEIKRLLLNQEIVSGIGNIYADEMLWQAKIHPLQRADRLS
FPG_AGRFC       PTG-NALSADYLASRFEGKSQPLKSTLLDQKIIAGLGNIYVCEALWRAHLSPLRAAGTLV
FPG_RHIME       PTG-NALDAAYLATRFAGKIQPLKAALLDQRTIAGLGNIYVCEALWRSGLSPKRSAGTLV
FPG_BRUME       PTG-NLLSGEVLAALFKGRRTPLKAALLDQRLIAGLGNIYVCEALWRPGLSPMRAAGSVA
FPG_RHILO       PTG-NTLDGVLLASLLKGRGSPLKAALLDQKLIAGLGNIYVSEALWRAGLSPLREAGTIA
FPG_CAUVC       PLG-EGFDARTLEKAFANRKQGPKTLLLDQRTVAGLGNIYVCEALHRSGISPFKPSGNIA
FPG_ZYMMO       PLT-GNFNPEYLQKKLFSSSAPIKKILLDQKVVAGIGNIYACEALHQAKIHPQRPSKNLN
FPG_ECOLI       PLS-DDFNGEYLHQKCAKKKTAIKPWLMDNKLVVGVGNIYASESLFAAGIHPDRLASSLS
FPG_ECO57       PLS-DDFNGEYLHQKCAKKKTAIKPWLMDNKLVVGVGNIYASESLFAAGIHPDRLASSLS
FPG_SALTI       PLS-DEFNGEYLQQKCAKKKTAIKPWLMDNKLVVGVGNIYASESLFAAGIHPDRLASSLS
FPG_SALTY       PLS-DEFNGEYLQQKCAKKKTAIKPWLMDNKLVVGVGNIYASESLFAAGIHPDRLASSLS
FPG_YERPE       PLS-DEFTAQYLFDKSRNKRTLIKPWLMDNKVVVGVGNIYASESLFAAGILPDRAAGSLT
FPG_VIBCH       PLT-EAFNAEYMMDKARNKRIAVKAFIMDNAAVVGVGNIYANESLFTSRLHPLRPAHSLS
FPG_HAEIN       PLS-DEFNAEYLFKKSRQKSTALKTFLMDNAVVVGVGNIYTNESLFICGIHPLKLAKNLT
FPG_PASMU       PLS-EEFDSDYLWQKSRKKQTALKTFLMDNAVVVGVGNIYANETLFLCNLHPQKTAGSLT
FPG_NEIMA       PLS-EAFCTDYLYVRLKAQKRAVKLALMDNAVVVGVGNIYANESLFRAGISPHRPANRLK
FPG_NEIMB       PLS-EAFCADYLYARLKAQKRAVKLALMDNAVVVGVGNIYANESLFRAGISPHRPANRLK
FPG_XANAC       PLS-DAFTGDYLHALAQGRRAAVKTFLMDQAVVVGVGNIYAAESLHRAGISPLREAGKVS
FPG_XANCP       PLS-AAFTGDYLHALACGRRAAVKTFLMDQAVVVGVGNIYAAESLHRAGISPLREAGKVS
FPG_XYLFA       PLS-DSFNGDYLYQCSRARNVSVKTFLMDQRIVVGVGNIYAAESLFRAGISPLCEADKIS
FPG_PSEAE       PLT-DAFAGQRLFELSRGRSMAVKPFIMDNAVVVGVGNIYASEALFAAGIDPRKPAGSIS
FPG_RALSO       PFD-TRFDGDWMYARTRGRSAAIKTVLLAGDIVVGVGNIYCSESLFRAGIRPTTAAGRIS
FPG_RICCN       PFS-DLLTLEYLKDKLQTKKIPIKNLIMDNRVIVGVGNIYASESLHLARIHPDKSGNNLR
FPG_DEIRA       PLS-DDFTEAEFV-ALAARCGPVKPWLLSQKPVSGVGNIYADESLWHARLHP--AQTRLN
FPG_THET8       PLS-EAFAFPGFFRGLKESARPLKALLLDQRLAAGVGNIYADEALFRARLSPFRPARSLT
FPG_MYCGE       PLE-AGFDYRKIFQKAQNSKRKVKTFILDQTVISGIGNIYADEILFASKINPETMVDQLT
FPG_MYCPN       PLD-QEFNHQAIFNKGHKSNKKIKTFILDQTNISGIGNIYADEILFASKIHPETLAKNLN
FPG_UREPA       PLD-NNFSAQYLYEKLKKSNKAIKTALLDQSVVSGIGNIYADEILFAAKIFPTILAKNLT
FPG_MYCPU       P---GEIDFETFYNRLSKKALAIKPTLLDQSIVSGIGNIYADEILFASKIHPATPSNLLS
                           .           *  ::      *:****  *      .        : 

FPG_BACFI       K------EEMAVLHKAIVSTLEEAVEMGGSSIKSYV----NGQGEMGMFQQKLGVYGRKN
FPG_BACHD       V------AEVKILHQAILNTLTEAVNLGGSSIKSYV----NGQGEMGMFQQRLDVYGRKG
FPG_BACSU       D------KTIKTLHAEIKNTLQEAIDAGGSTVRSYI----NSQGEIGMFQLQHFVYGKKD
FPG_LISIN       D------KEINRIFEATKSIMTEAVALGGSTVRTYV----NSQGKLGQYQDKLKVYGKTG
FPG_LISMO       D------KEIKRIFKATKSIMTEAVALGGSTVRTYV----NSQGKLGQYQNKLKVYGKTD
FPG_LACLA       E------SSIHLLHDSIIEILQKAIKLGGSSIRTY-----SALGSTGKMQDELRVYGKTG
FPG_LACLC       E------SSIHLLHDSIIEILQKAIKLGGSSIRTY-----SALGSTGKMQNELQVYGKTG
FPG_STRP1       K------AEIKRLHDETIRILALGIEKGGSTVRTYR----NALGADGTMQDYLQVYGQTG
FPG_STRP8       K------AEIKRLHDETIRILALGIEKGGSTVRTYR----NALGADGTMQDYLQVYGQTG
FPG_STRMU       K------SEIKRIHDETIRILQLAIEKGGSTIRSYK----NSLGEDGSMQDCLQVYGKTD
FPG_STRPN       A------EEATAIHDQTIAVLGQAVEKGGSTIRTYT----NAFGEDGSMQDFHQVYDKTG
FPG_NOSS1       L------KQIKLLRTAIIQVLETSIEAGGTTFSN----FLNVKGVNGNYGGVAWVYNRAG
FPG_SYNY3       L------QDCELIHQQIQATLTAAIEAGGTSFSD----YRQVTGINGNYGGMAQVYGREG
FPG_SYNEL       P------EQVQRLHGVICQVLREGIAAGGTTIRT----FMSPAGVNGHYGGQAWVYGRKG
FPG_MYCLE       R------RQLAAVLDAAADVMRDSLAKGGTSFDSL---YVNVNGESGYFDRSLDAYGREG
FPG1_MYCTU      C------RRLGAVLHAAADVMREALAKGGTSFDSL---YVNVNGESGYFERSLDAYGREG
FPG_STRCO       R------PRTTELLGHVRDVMNAALAVGGTSFDSL---YVNVNGESGYFDRSLDAYGREG
FPG_CORGL       L------ARLEELLQAGKDVMTKALAQGGTSFDAL---YVNVNGNSGYFALSLNAYAQTG
FPG_AGRFC       TTRGKPKAQLIDLTEKIRDVIADAIAAGGSSLRDHI----QTDGTLGYFQHSFSVYDQEG
FPG_RHIME       DKRGRPKQALIALTERIRAVIADAIAAGGSSLKDHI----QADGSLGYFQHSFSVYDREG
FPG_BRUME       G----EMDVMERLAGAIRSVIAQAIAAGGSSLKDYI----QADGALGYFQHSFSVYGREG
FPG_RHILO       RPSKKARQQSERLAEAIRSVISDAIAAGGSSLRDYM----HTDGSLGYFQHSFAVYDREG
FPG_CAUVC       K-----K-RLTPLTAAIKDVLAEAVEVGGSTLKDFA----AADGALGYFQHRFRVYDREG
FPG_ZYMMO       F-----D-EITSLVFSIKNILQKAIAEGGSTLKDYA----RPNGELGYFSTKFKVYGKEG
FPG_ECOLI       L------AECELLARVIKAVLLRSIEQGGTTLKDFL----QSDGKPGYFAQELQVYGRKG
FPG_ECO57       L------AECELLARVIKAVLLRSIEQGGTTLKDFL----QSDGKPGYFAQELQVYGRKG
FPG_SALTI       T------EECDLLARVIKAVLLRSIEQGGTTLKDFL----QSDGKPGYFAQELQVYGRKG
FPG_SALTY       T------EECDLLARVIKAVLLRSIEQGGTTLKDFL----QSDGKPGYFAQELQVYGRKG
FPG_YERPE       D------AESVLLVATIKAVLLHSIEQGGTTLRDFL----QSDGKPGYFAQELQVYGRAG
FPG_VIBCH       L------EEWQTLVANIKQVLQVAIKQGGTTLKDFT----QSDGKPGYFAQELQVYGKAK
FPG_HAEIN       R------NQCFSLVNTIKDVLRKAIIQGGTTLKDFL----QPDGRPGYFAQELLVYGNKD
FPG_PASMU       K------AQCGQLVEQIKQVLSNAIQQGGTTLKDFL----QPDGRPGYFVQELRVYGNKD
FPG_NEIMA       K------KECALLVETVKAVLRRAIETGGSTLRDFV----DSDGKSGYFQQEYTVYGRHN
FPG_NEIMB       K------KECALLVETVKAVLQRAIETGGSTLRDFV----DSDGKSGYFQQEYTVYGRHN
FPG_XANAC       L------ERYRRLADAVKDILAYAIQRGGTTLRDFI----SPDGAPGYFEQELFVYGREG
FPG_XANCP       R------ERYRRLADAVKEILAYAIQRGGTTLRDFI----SPDGAPGYFEQELMVYGREG
FPG_XYLFA       L------QRYRRLAEVVKDILLYAINRGGTTLRDFL----SPDGRPGYFKQELFVYGRQQ
FPG_PSEAE       K------ARYLRLAEEIKRILAIAIERGGTTLRDFV----GGDGQPGYFQQELFVYGRGG
FPG_RALSO       R------PRYAALAEAIRATLADAIARGGSTLRDFV----GSDGQSGYFQLDALVYDRAG
FPG_RICCN       D------DEIENLIKAIRDVLTKAITAGGTTLKDFV----NGDNKPGYFTKQLKVYGREG
FPG_DEIRA       A------DEAGRLYRAIREVMAAAVDKGGSSLGNGVGNYRQHDGEGGGFQHSHHVYGRAG
FPG_THET8       E------EEARRLYRALREVLAEAVELGGSTLSDQ--SYRQPDGLPGGFQTRHAVYGREG
FPG_MYCGE       I------KEIEILCKNATKILAKAIVMKGTTISSFS----FKKDHTGGYQNFLKVHTKKD
FPG_MYCPN       L------SQYQLICQNATDILKKAVEMKGTTIGTFT----FKKDHTGGYQHFLKIHGKKG
FPG_UREPA       L------KNYEKITKEAQRILLLSIKNKGTTIHTYK----FGNDETGLFQKMLLVHTHAK
FPG_MYCPU       K------DKVKEILKNAIEILDKSTELGGSSINSYE----SLNKKEGQYQNFLKVHTKKG
                            :       :  .    *::.              *        : .  

FPG_BACFI       EPCRQ--CGTDILKTVVGGRGTHFCPNCQL-----------
FPG_BACHD       ETCRQ--CGTPITKTVVGGRGTHFCSVCQK-----------
FPG_BACSU       EPCKN--CGTMISKIVVGGRGTHFCAKCQTKK---------
FPG_LISIN       EPCVI--CGTPIEKIKLNGRGTHFCPHCQK-----------
FPG_LISMO       EPCVV--CGTPIEKIKLNGRGTHFCPNCQK-----------
FPG_LACLA       EKCVR--CGNEIQKIKVAGRGTHFCPFCQQK----------
FPG_LACLC       EKCSR--CGAEIQKIKVAGRGTHFCPVCQQK----------
FPG_STRP1       KPCPR--CGQAIVKLKVGGRGTHICPKCQKKRL--------
FPG_STRP8       KPCPR--CGQAIVKLKVGGRGTHICPKCQKKRP--------
FPG_STRMU       QPCAR--CATPIEKIKVGGRGTHFCPSCQKQ----------
FPG_STRPN       QECVR--CGTIIEKIQLGGRGTHFCPNCQRRD---------
FPG_NOSS1       EPCKV--CGDVIQRIKLGGRSSHFCRQCQV-----------
FPG_SYNY3       EPCRH--CGTVIAKIKLGGRSAHFCPQCQPKLER-------
FPG_SYNEL       EACRV--CGTTIERLRLAGRSSHYCPQCQPLSSAIGK----
FPG_MYCLE       EGCRR--CGAVMHREKFMNRSSFYCPRCQPRPRR-------
FPG1_MYCTU      ENCRR--CGAVIRRERFMNRSSFYCPRCQPRPRK-------
FPG_STRCO       MPCRR--CATPMRRRPWMNRSSYFCPKCQRPPRVTP-----
FPG_CORGL       EPCGR--CGTLIIRESFMNRGSHYCPNCQKRR---------
FPG_AGRFC       QPCRTPGCGGTVERVVQAGRSTFYCAACQK-----------
FPG_RHIME       EACRTPGCHGTVARIVQAGRSTFYCPHCQK-----------
FPG_BRUME       KPCRNPACGGTVERVVQSGRSTFFCASCQT-----------
FPG_RHILO       EPCPKPGCGGHIERVVQSGRSTFYCRTCQS-----------
FPG_CAUVC       EPCPTPACKGVIAREVQAGRSTFFCPVCQV-----------
FPG_ZYMMO       EQC-E--CGHTIERYTLGGRSTFLCSSCQK-----------
FPG_ECOLI       EPCRV--CGTPIVATKHAQRATFYCRQCQK-----------
FPG_ECO57       EPCRV--CGTPIVATKHAQRATFYCRQCQK-----------
FPG_SALTI       EPCRV--CGTPIVATKHAQRATFYCRHCQK-----------
FPG_SALTY       EPCRV--CGTPIVATKHAQRATFYCRHCQK-----------
FPG_YERPE       EPCRQ--CGHPIEIAKHGQRSTFFCRHCQH-----------
FPG_VIBCH       QPCPH--CGEPLCEQKIAQRNTFFCPQCQH-----------
FPG_HAEIN       KPCPK--CGGKIESLIIGQRNSFFCPKCQKRG---------
FPG_PASMU       KPCPT--CGTKIESLVIGQRNSFYCPKCQKR----------
FPG_NEIMA       QPCPQ--CGGLVVKETLGQRGTFYCPNCQK-----------
FPG_NEIMB       QPCPR--CGGLVVKETLGQRGTFYCPNCQK-----------
FPG_XANAC       EACKQ--CGRVLKHATIGQRATVWCGSCQR-----------
FPG_XANCP       EACRH--CGGELKHATIGQRATVWCAACQR-----------
FPG_XYLFA       QPCKQ--CGSLLRQTTIRQRTTVWCGHCQG-----------
FPG_PSEAE       EFCKV--CGSTLREIRLGQRASVYCPRCQR-----------
FPG_RALSO       LPCRV--CGTPIRQIVQGQRSTFYCPACQR-----------
FPG_RICCN       QSCLS--CSSTIIKIKHSGRSTFYCKTCQYS----------
FPG_DEIRA       QPCDR--CGTPIEKIVLGQRGTHFCPVCQPLRTDRSA----
FPG_THET8       LPCPA--CGRPVERRVVAGRGTHFCPTCQGEGP--------
FPG_MYCGE       QPCSV--CNQLIVKKKINGRGSYFCLNCQKITTKVSTKLNP
FPG_MYCPN       KQCQS--CNTTIIKKKINGRGSYICEKCQIQR---------
FPG_UREPA       EPCQI--CGTIIQKTKVNGRGTYYCPNCQN-----------
FPG_MYCPU       EFCIK--CSSKIEKIKFKGRGTYFCPTCQKQKDFI------
                  *    *   :       * :  *  **