CLUSTAL format seed alignment for MF_00104

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RNC_BACTN         --------------------------MLRNQIDKIRLLFRKDRES--YLCFYRILGFY--
D9RT83_PREMB      ---------------MVTMLVLYSRSMLNNIIDRIKLPFRKEKEL--YLSLYQIIGII--
RNC_AZOPC         --------------------------MFRNILNTIGAFFSKKKES--YFALYRMLGFP--
E4T6E6_PALPW      --------------------------MIKNILLKIRLLSKARKEP--YLLFHKVLGFY--
E4TVQ3_MARTH      --------------------------MVRRFFTSFKKLSNKDKRL--VAAVKSIVGYK--
B3ETI2_AMOA5      --------------------MDKLINFFRQYFFPYEDA--RTKQF--KNAIYAITTLH--
C7PEN8_CHIPD      --------------MHLLFSKNLLLDCVKLLPGFLYRFVPKKRSL--YKDLYNLLGFA--
E4TC94_RIEAD      ---------------------MKIGRYFNRILSRRKKPRYTQREAFIVKGLEKILGIQ--
C6X2R2_FLAB3      ---------------------MELKKYIPKFLITKKN-NLSEKDYILSNEISKITGCS--
A3XQM1_LEEBM      ------------------------MSVIRNIFTS-----RPEKGGNFFVTVKKIIGFK--
RNC_FLAPJ         ------------------------MSFIKKIFLSS----RSSEDGLFFSKLEKILGFK--
F0P289_WEEVC      ------------------------MFFLKKLFGWLDKPNSKSENPDLVQFVTQLVGVK--
D0J9Y6_BLASP      ------------------------------MLSDDITFQKEEKNSILVSRLKKILGFC--
C5J6D4_MYCCR      ---------------------------------------MKTNRSYQILKLLDKLEIL--
E0TKT7_MYCHH      --------------------------------------------MSSIKELLLNLNIV--
E4QT51_MYCH1      -----------------------------------------MEIEDKILELLKKLKII--
RNC_MYCMO         --------------------------------------MNKKTKIEGLENFLTLNNII--
Q98R47_MYCPU      -------------------------MRKKTSWNINTHIQKHFKDLVFELNKLGINQIS--
RNC_UREPA         ------------------------------------------MDNKKFLDFLKQNRIE--
Q8EW40_MYCPE      ---------------------------------MKKIMKDNNYRQLDVTKILNKLGIK--
RNC_MYCS5         ------------------------------------MEKDNQPSIEELKAFLQKNNIE--
D5E4P5_MYCCM      -----------------------------------------MLKCSNLTEFFHIHEIE--
RNC_ACIBT         -----------------MTKHQFKLSDPR---------------------LLSRIGY---
RNC_PSYA2         --------------MKPTSQYPQAVPNPPKNSLSDDTLVISSEFIQRLAVLTRKLGY---
RNC_FRAP2         -----------------------MVPEYSR--------------------LYKILGY---
RNC_AZOVD         -----------------------MSASLNR--------------------LERKLGH---
RNC_MARMS         -----------------------MSSLYQK--------------------LSRRIGY---
RNC_ALCBS         -----------------------MNGDLNR--------------------LMARLGY---
RNC_LEGPC         -----------------------MKINLER--------------------LCRRLNY---
RNC_COXBU         ------------------------MNHLNK--------------------LMERLGH---
RNC_BUCAI         ----------------------MNHIVTKK--------------------IQKVLGY---
RNC_ECOLI         ----------------------MNPIVINR--------------------LQRKLGY---
RNC_BLOFL         -------------------MQCIKCIEINL--------------------LQKKLGY---
RNC_WIGBR         ----------------------MKNLFFNK--------------------LQKKMGY---
RNC_COLP3         --------------------MKINPHNLAR--------------------LTKKLGY---
RNC_PSYIN         --------------------MMIKQAELKR--------------------LERRVDY---
RNC_IDILO         --------------------MSLPKPPLTE--------------------LEKIVGY---
RNC_HAEIN         ------------------------MNHLDR--------------------LERKIGY---
RNC_ALKEH         -----------------------MPTPKDA--------------------LQDRLGY---
RNC_NITOC         -----------------------MTDGLER--------------------LCRKLGY---
RNC_METCA         -----------------------MIRSHEH--------------------LARKLGI---
RNC_XYLFA         ----------------------MISSKASD--------------------YQQRIGY---
RNC_AROAE         -----------------------MAGKLDR--------------------LQRSLGH---
RNC_BORBR         ----------------------MTAMSLAT--------------------LETRLDH---
RNC_THIDA         ---------------------MNNALLDAR--------------------LQQALGY---
RNC_DECAR         -------------------------MTSQS--------------------VAKKLNH---
RNC_NITEU         ----MTSSRPIAHNTKNKQTKTLKGRDYAV--------------------FLQKLGY---
RNC_RHOFT         -----------------------MNNGLMA--------------------LQARLQH---
RNC_VEREI         -----------------------MRPDLIA--------------------LQERLQH---
RNC_NEIG1         -----------------MKDDVLKRQAHTA--------------------IQKKLGY---
RNC_AGRRK         -----------------------MTKTPTLSQADRLT-------------LEAAIGH---
RNC_BRUAB         -----------------------MNRTRPLPEIKMVSANK------TASILEERTGH---
RNC_METSB         -----------------------MAAAPDLS------------------ALEARIGH---
RNC_RHOPA         -MTDDVTNVEQPSTASEQQPQDVPAAEPSAAKKRRANKAKS---KATAAAIEQRLGH---
RNC_DINSH         -----------------------MKLSKEIS------------------AFCDRIGH---
RNC_SPHAL         -----------------------MSDPLNTE------------------ALADIIGC---
RNC_ZYMMO         MADKRFFGTKTFPNQEKALKAKIMNNDAFIS------------------WIEKNLGH---
RNC_CAUSK         -----------------------MDRRAAAVA-----------------DLERRIGH---
RNC_PHEZH         -----------------------MNARAAAVA-----------------ELERRIGY---
RNC_ANAMF         ---------------MHPVDKK---SLALK--------------------IYEATGY---
RNC_ANAPZ         ---------------MEPYSEDSILALTEK--------------------VFKISGY---
RNC_EHRRG         -------------------------MITNA--------------------ISKIIKY---
RNC_WOLTR         -------------MGDTPFKATSMEDLNDT--------------------ISKIINY---
RNC_RICAE         ------------------------MESFEK--------------------LEKLLSY---
RNC_AQUAE         ------------------------MKMLEQ--------------------LEKKLGY---
RNC_HYDS0         ------------------------MDSFEL--------------------LEEKIGY---
RNC_PELUB         -----------------------MKTNPIK--------------------LEKKLKL---
RNC_CARHZ         ------------------------------------------MDKENLISLEKILGF---
RNC_DEHM1         --------------------------------------------MLDLTELEKSLGV---
RNC_BDEBA         ------------------------------------------MIDQGRKSLEERVGH---
RNC_CAMFF         --------------------------------------------MDKLNRLEEHLGY---
RNC_CAMJD         --------------------------------------------MKNIEKLEQSLTY---
RNC_HELHP         --------------------------------------MSKSILPKSPQLLEKKLGY---
RNC_WOLSU         --------------------------------------------MESIEEFEKRLGY---
RNC_HELPY         ------------------------------MKNKRSQNSPYITPNSSYTTLEKALGY---
RNC_SYNFM         -----------------------------------------MKPSDGLEALQNLLGY---
RNC_GEOMG         --------------------------------MGERGVEDKSAVQESATELEAGIGY---
RNC_GEOSL         --------------------------------MRETDEQPVAGGAASTEGLETSIGY---
RNC_PELCD         --------------------------------MLE---------AKSAALLEDTIDY---
RNC_MAGMM         --------------------------------MNAQRE------PSGLERLEQALDY---
RNC_MYXXD         --------------------------------MMRLSGADKMSPSERVQLLESRLGL---
RNC_BORBU         -----------------------------MKKKSSDFCLCN-ERKSQLSKFLENLSI---
RNC_LEPBJ         ---------------------------MVFKKTQPSPSLKNPERIQSFKKLSKKIGI---
RNC_TREDE         ----------------------------MFP-IKSGL---EPKRKQELLEFQKQAGL---
RNC_TREPA         ---------------------MSLCLGHIFSRSRSPL---TPERRESLRRLQETLGV---
RNC_FUSNN         --------------------------------------------MKNLLDLEHKLNY---
RNC_SOLUE         -------------------------------------------MRAEPALLELKLDY---
RNC_PSELT         ---------------------------------------MNKEEAKILIDFMEKIGY---
RNC_THEMA         ---------------------------------------MNESERKIVEEFQKETGI---
RNC_DESPS         ------------------------------MGIDVKELIRR--NRQKHAEFEKKINY---
RNC_DESVH         -------------------MWARTAAWVFGLPETLREICYRRDNVKPVDELQKTIGH---
RNC_BACHD         -------------MPHSKNQRKHRHHSHSERRRQPKRLTLTAKQQQMFDELLRTLNL---
RNC_LISIN         --------------------------------------------MNQWEELQESVGF---
RNC_LACRD         ------------------------------------------MIEELQDYLAKEFNI---
RNC_LACSS         ------------------------------------------MDAALVSELRARYGI---
RNC_ENTFA         ------------------------------------------MDNQLTTELKERYGI---
RNC_STAES         -------------------------------MANQKKKEMVHNFQQKFTDKMKSLGL---
RNC_LACAC         -----------------------------------------MVSTKFLNKLKNEYNI---
RNC_LEUMM         -----------------------------------------MSQDSFKSYILKKFNI---
RNC_LACLM         -------------------------------------------MLKLQKKLKNDYGL---
RNC_STRT2         -----------------------------------MFKKKGCFMNQLEQKLEQDFGI---
RNC_MESFL         ---------------------------------------------MTMHEFFENFGI---
RNC_MYCCT         ---------------------------------------------MNIKNFFEKYNI---
RNC_SPICI         ---------------------------------MQFINKQSEQLFIELKAFFKQYHV---
RNC_CLOK5         ----------------------------------------MEKVN-FFEEVEKTLNI---
RNC_CLOPE         ----------------------------------------MKDIN-LIE-VEKLIGI---
RNC_CLOAB         ----------------------------------------MEEER-LLEELESKLGI---
RNC_CALS4         ----------------------------------------------MLTYLEQKINY---
E6UF22_RUMA7      ----------------------------------------MDEQK-CLEAFQKKIGY---
RNC_NATTJ         ---------------------------------------MGKECR-DIVELKEKLGI---
RNC_DESRM         ---------------------------------------MSKQDE-QANRLKTRLGF---
RNC_PELTS         ---------------------------------------MPDAQD-KLTLLKNRLGI---
RNC_HELMI         ---------------------------------------MKRAPN-HPAELARRIGI---
RNC_MOOTA         ---------------------------------------MDNKRQEQLQHFWEQFHL---
RNC_SYNWW         ---------------------------------------MQNERR-IAQRFLEDKQL---
RNC_RHOBA         --------------MDASSSSNPDDGLQAIRLVDASDDEPYADAVAKIERCQEILGY---
RNC_SYMTH         ---------------------------MAVSVLDP----------GRRAWCAEALGY---
RNC1_NOSS1        ----------------------------------------------------MYKLL---
RNC1_SYNY3        --------------------------------------------------MNHPDFP---
RNC_CHLSY         -------------------------------------------MSDRLAELERAIGI---
RNC_ROSS1         -------------------------------------------MRKSVDELSARLGV---
RNC_CORDI         --------------------------MSRRKKRVTGEQALRLEFESVDHQPLIDALG---
RNC_CORJK         --------------------------MAR-KRRLTGEAALNAAYGKSDHAPLLEAWG---
RNC_MYCBO         --------------------------------------------MIRSRQPLLDALG---
RNC_STRAW         ----------------------------MSDAKADSTAKKKADNTASSHTLLEGRLG---
RNC_LEIXX         -----------------------------------------MVGENTDRSALLEKLG---
RNC_BIFLO         -------------------------------------MSNETPQQPTPANELLEALG---
RNC_TROW8         --------------------------------------------MDGVDELLLRKFN---
RNC_CHLPN         ------------------------------MHPPI-----------DITAIEAKLNF---
RNC_PARUW         ------------------------------MLPRILYMNPIEHVIRQAPAIEAKLGY---
RNC_CHLTE         -----------------MSLQFLRSEASDGAGETSDASSADFLLDPQTATHLARLTG---
RNC_PELLD         -----------------MEPLWHKLSALPFFSSRPEKWEGSGAPPSLTAFIRSLFKG---
RNC_CHLCH         ------------------------------------------MPPETLAYLQTLIGS---
RNC2_SYNY3        ------------------------------------MSLL-PHRQTQLKALLRRLGLTDN
RNC2_NOSS1        ------------------------------------MTLVYPRRQRQLESLVRKLGLPIT
RNC_GLOVI         ----------------------------------MAESALTPLRLAQLRRFAARFALSEP
RNC_PROMA         ------------------------------MTKKDIVSIVSKERAEEIYGLLTQSNLHSS
A9BD45_PROM4      -------------------------------MTHSKKTIISKERIQQIYNLLDKIVVNKS
Q7V4K2_PROMM      -----------------------MTHRSKTKTSRTTPKNLSNERVQQLQNLLQKLALVDP
Q46IK9_PROMT      -------------------------------------MKISNHRVEEIINFIKGLKLDQK
A4CTC0_SYNPV      ------------------------------MITPLLRKGEQNPAYVLLSPLSRRRNNTVM
Q0IDN5_SYNS3      ------------------------------MIT---RQREQQ-----LQELWRQLVPDSS
Q3ANA7_SYNSC      ------------------------------MDPS--RAAE-------LTDLIQRLDAEIP
A5GQ81_SYNR3      --------------------------------------------MTTLQELLIRLGLQQP
RNC_ONYPE         --------------------------------------------MKNIQTLFQTLNI---
Q1AW81_RUBXD      ----------------------------------------MWRSGAWNSNIATGMSIKEL
B3PN90_MYCA5      --------------------------------------------------MLERNGLDIK
D1J8Q7_MYCHP      ---------------------------------------MKINFEENLQNALLKFGINFQ
E8ZGH5_MYCHL      ----------------------------------------MVSKLSLEEFLNKSFGL---
RNC_MYCPN         ------------------------------MKNKKDKTQKPKVIDEKFVAFFKSLNIE--
RNC_TRES6         ------------------------------------------MNRQDIGFVQSSINY---
RNC_ROSHA         ------------------------------------------MDEKEIKFIQDQIGY---
                                                                              

RNC_BACTN         ------------------------PHNIQIYEQALLHKSS--AVRSEKGR---PLNNERL
D9RT83_PREMB      ------------------------PHDISYYKTALLHKSV--ARRNAKGK---PVNNERL
RNC_AZOPC         ------------------------PKNFSIYEKALLHKSS--SKRDENGC---YQNNERL
E4T6E6_PALPW      ------------------------PDKIEYYQLAVRHKSV--SIPTENGR---NLSNERL
E4TVQ3_MARTH      ------------------------PFRLELFRLVTQHSSV--AKTLPNGF---RASNERL
B3ETI2_AMOA5      ------------------------PHNLSLYRLALQHSSA--KIE--------ENSNERL
C7PEN8_CHIPD      ------------------------PGNFSLYEVALSHRSS--KEK----F---LESNERL
E4TC94_RIEAD      ------------------------PKEVSWYQEAFSLKSTSSQL-----------NYDRL
C6X2R2_FLAB3      ------------------------VQNINLYREAFSLKTASPRTQVK--------NYERL
A3XQM1_LEEBM      ------------------------PINITHYEEAFTHRSMALQDKKGNA-----FNYERL
RNC_FLAPJ         ------------------------PLNLTHFRRAFTHRSMNKLDEKGNP-----MNYERL
F0P289_WEEVC      ------------------------PKDIRVYEEAFTHRSAQRKDDKGQN-----VNFERL
D0J9Y6_BLASP      ------------------------PKNLKLLKDVFIYSFSTKRKTLDKNY---FLDFQRL
C5J6D4_MYCCR      ------------------------PKNLEIYNQALTHKSYQHFNPNSS-------HYEML
E0TKT7_MYCHH      ------------------------ANDLSLYEQAFTHKSYHHVRPNKP-------HYEML
E4QT51_MYCH1      ------------------------PNSKQIYIQALTHKSYNFINPDKP-------HYEML
RNC_MYCMO         ------------------------FKDIKYYIQALTHKTYANEHANIE-------SYDIL
Q98R47_MYCPU      ------------------------QKEKNIFFQAFTHTTFHNLYKAK--------SYEML
RNC_UREPA         ------------------------PKNLSIYLEALTHKSYANEHKLTK-------NYQRL
Q8EW40_MYCPE      ------------------------TNKYYLYVEALTHNSYNNEKKVGY-------TYQRL
RNC_MYCS5         ------------------------YKNIDLFIEATTHKTYSKVNKNSK-------DYERL
D5E4P5_MYCCM      ------------------------PNNTKIYLQAITHSSFFSSSNKKN-------SYERL
RNC_ACIBT         -----------------------QFKQPELLQLALTHRSVSHK-----------YNYERL
RNC_PSYA2         -----------------------VFNDLSLAKLALTHRSFDSK-----------KNYERL
RNC_FRAP2         -----------------------SFKNYTLLVRALTHRSKT-K-----------KNYERL
RNC_AZOVD         -----------------------TFKNQDLMLLALTHRSFAS------------RNNERL
RNC_MARMS         -----------------------FFADLGLLELALTHRSFGG------------KNNERL
RNC_ALCBS         -----------------------QFQDLSLLELALTHRSVSRH-----------RNYERL
RNC_LEGPC         -----------------------HFNNIAYLKQALTHCSAGS------------DNYERF
RNC_COXBU         -----------------------QFNNLELLKIALTHCSSGA------------DNNERL
RNC_BUCAI         -----------------------TFTHKDLLKQALTHRSASS------------KHNERL
RNC_ECOLI         -----------------------TFNHQELLQQALTHRSASS------------KHNERL
RNC_BLOFL         -----------------------FFHTVDLLLRALTHRSFSN------------KHNERL
RNC_WIGBR         -----------------------LFHNNIILKQALTHRSFSS------------KNNERL
RNC_COLP3         -----------------------EFNEPLLLVQALTHRSAKG------------AHNERL
RNC_PSYIN         -----------------------TFSDFSLLQQALTHRSALG------------NHNERL
RNC_IDILO         -----------------------SFEQQGLLHQAMTHRSASS------------THNERL
RNC_HAEIN         -----------------------RFNDIALLKQALTHRSAAT------------QHNERL
RNC_ALKEH         -----------------------RFRRPELLDEALTHRSVTG------------PDNERL
RNC_NITOC         -----------------------RFAEPALLRHAITHRSATK------------ENNERL
RNC_METCA         -----------------------PFRDPGLLRNALTHRSAEG------------VNNERL
RNC_XYLFA         -----------------------VFTDPSLLLQALRHCSAGT------------PHNERL
RNC_AROAE         -----------------------RFDNPALLEQALTHRSFGQ------------PNNERL
RNC_BORBR         -----------------------RFGDKALLEQALTHRSHGA------------RHNERL
RNC_THIDA         -----------------------TFSRSGLLQQALTHRSYGA------------LNNERL
RNC_DECAR         -----------------------CFSDQALFRTALTHRSFGT------------PNNERL
RNC_NITEU         -----------------------TFKQPDLLREALTHRSLGF------------PNNERF
RNC_RHOFT         -----------------------EFSNPGLLTRALTHRSFSL------------DHNERL
RNC_VEREI         -----------------------VFSDPGLLERATTHRSFSA------------EHNERL
RNC_NEIG1         -----------------------AFRDMSLLRRALTHRSHHA------------KHNERF
RNC_AGRRK         -----------------------AFVEKERLDWALTHASARTHKA---------GNYERL
RNC_BRUAB         -----------------------RFLNLKRLERALTHSSVQAPAR---------ANYERL
RNC_METSB         -----------------------RFSAADLIEAALTHVSAAQGKR---------VSYQRL
RNC_RHOPA         -----------------------SFADPSLLTTAFTHVSALKSARRT-------DSYQRL
RNC_DINSH         -----------------------RFDRPELLVRALTHASRSTAGR---------SDNQRL
RNC_SPHAL         -----------------------IPDDLTLYDLALTHGSTGR------------ADYQRL
RNC_ZYMMO         -----------------------RPKDPALFLRAMTHPSHGN------------SDYQRL
RNC_CAUSK         -----------------------TFADRKLLELALTHASVGDGAKKA-------GDNEVL
RNC_PHEZH         -----------------------VFTDRDLLERALTHASVGDGARAV-------RHNERL
RNC_ANAMF         -----------------------QFRDLDLLLEALTHPSLSYKSAAN---------YERL
RNC_ANAPZ         -----------------------RFQDHELLKTAVTHPSIAAERYAS---------YERL
RNC_EHRRG         -----------------------DFKNTQLLNEALTHPSVLSKDNNN-------FNYERL
RNC_WOLTR         -----------------------RFKNDAILEEALTHPSLNKRNSKNQ-----IENYERL
RNC_RICAE         -----------------------SFKNKELLIEALSHPSLRQHHEYKD-----DKDYERL
RNC_AQUAE         -----------------------TFKDKSLLEKALTHVSYSKK-----------EHYETL
RNC_HYDS0         -----------------------RFKDKNLVKKAFTHISFSKSS----------ENYEVL
RNC_PELUB         -----------------------KFSDQKIFIKSLTHKSFDSIN-----------NNEKI
RNC_CARHZ         -----------------------NFNNPSILLSAITHPSYAFEH-----PEEGIEHNERL
RNC_DEHM1         -----------------------KFENLSLLEQALIHTSWVNEN-----PNHLSGSNERM
RNC_BDEBA         -----------------------QFKNPALLERALTHKSFANEL-----RNT-VEHNEKL
RNC_CAMFF         -----------------------KFKNKTLLKEALTHKSMKSSVN-----------NERL
RNC_CAMJD         -----------------------EFKDKNLLIHALTHKSFKKSYN-----------NERL
RNC_HELHP         -----------------------VFQNQQLLLEALTHKSCKKQYN-----------NERL
RNC_WOLSU         -----------------------RFQNKNLLIEALTHKSYKKPYN-----------NERL
RNC_HELPY         -----------------------SFKDKRLLEQALTHKSCKLALN-----------NERL
RNC_SYNFM         -----------------------RFGDEGLLHRALVHRSYLHENPH-----LDEKDNETL
RNC_GEOMG         -----------------------RFVNRQFLAEALTHRSWVNER---R-GEEGIRDNERL
RNC_GEOSL         -----------------------RFTDRRFLDEALTHRSWLNEV---R-SPT-VPDNERL
RNC_PELCD         -----------------------VFDNQALLLEALTHKSFSNE----Q-NDRTEPDNERL
RNC_MAGMM         -----------------------RFTQSDLLQLALTHRSAPLDGSKAG-EVVATTHNERL
RNC_MYXXD         -----------------------SFSRMETALEALTHKTYVNET-----RDKELKDNQRL
RNC_BORBU         -----------------------DFSNFDLLNTALCHSSY--SNELDQ----KSSNNERL
RNC_LEPBJ         -----------------------KFSKIEYYNTAFIHSSY--KNENPE----ILEDNERL
RNC_TREDE         -----------------------KFKDLRLLDLAFHHRSF--SNEHNN----FHANNERL
RNC_TREPA         -----------------------KFRDPTALDQALSHRSLFSSKEDHC----GVRHNERM
RNC_FUSNN         -----------------------YFNDRNLLKNALLHKSLGNERKE-----YKNQTNERL
RNC_SOLUE         -----------------------RFNDPELLRRALTHSSLANENRPGAGVGSPLNDNEQL
RNC_PSELT         -----------------------RFYEPELLYNALCHSSYAHEQKQRG--RKDVESNERL
RNC_THEMA         -----------------------NFKNEELLFRALCHSSYANEQNQAG--RKDVESNEKL
RNC_DESPS         -----------------------KFIDLRLLQKALIHSSYAFEQAQAG------KNNERL
RNC_DESVH         -----------------------RFGDMELLLTAMTHSSWANEQAVPV------EHNERL
RNC_BACHD         -----------------------TFANKKLLVQAFTHSSYVNEHRI-----QSCKDNERL
RNC_LISIN         -----------------------DFQNVELLQQAFTHSSYVNEHRR-----ENVKDNERL
RNC_LACRD         -----------------------HFDNPALLAEAFTQASYVNEHPN-----QGLKYYERI
RNC_LACSS         -----------------------EFNNLALLDEAFTHSSYVNEHRE-----LGLRDNERL
RNC_ENTFA         -----------------------VFHDVNLLEQAFTHSSYVNEHRY-----LKLSDNERL
RNC_STAES         -----------------------HFKNIDLYQQAFSHSSFINDFNM-----NRLEHNERL
RNC_LACAC         -----------------------EFNNEKLLEEAFTHSSYSNEHPD-----DGIRDYEKL
RNC_LEUMM         -----------------------SFNDESLLTEALTQRNYLNEHPD-----EKGRDYQRL
RNC_LACLM         -----------------------VFNDEYLLKTAFTHSSFTNEERL-----PKIANNERL
RNC_STRT2         -----------------------VFSQKDLLETAFTHTSYANEHRL-----LNISHNERL
RNC_MESFL         -----------------------KINDSKIFSTALTHNSYANETK-------TKETYQRL
RNC_MYCCT         -----------------------KINDQQIYKEALTHNSYANERK-------LKYSYQRL
RNC_SPICI         -----------------------FIKERQYYLEALTHNSYANEHN-------LSYTYQRM
RNC_CLOK5         -----------------------SFNDKELIDTALTHSSYANGKK------GVKF-NERM
RNC_CLOPE         -----------------------EFENKGVLITALTHSSYANQFK------DVKY-NERL
RNC_CLOAB         -----------------------EFQNINLLVTALTHSSYANENK------NAEY-NERL
RNC_CALS4         -----------------------EFKDKTLLLEALTHSSWAHEGK------NEKVSNERL
E6UF22_RUMA7      -----------------------HFKNEKLLYEALSHSSFANENK------KQRHSNERL
RNC_NATTJ         -----------------------YVDDK-LLLQAVTHTSYAHEQK------DVVDHNERL
RNC_DESRM         -----------------------KWHNPTLLIQALTHSSCVHENRG-----HGLCHNQRL
RNC_PELTS         -----------------------AWRDEGLLTRALTHSSFTYENRQ-----NGLENNQRL
RNC_HELMI         -----------------------ASEDLATLEMALTHPSFVYENPQ-----APPEHNQRL
RNC_MOOTA         -----------------------PAIDLEGLDLALTHPTYAFEH-------HLPGDNQRL
RNC_SYNWW         -----------------------PYSSNELITMALTHPSYAQEK-------NTVANNQRL
RNC_RHOBA         -----------------------DFRDLDLLRSALTHASGASH---------RLASNERL
RNC_SYMTH         -----------------------EFRDESLLLEALTHTTYANEHP-------RARANERL
RNC1_NOSS1        -----------------------MFRDDKLLRRALTHRSYVNENPEEG------EHNERL
RNC1_SYNY3        -----------------------PIGDPQLKLEALTHRSYCNEHPGT-------PSYDRL
RNC_CHLSY         -----------------------TFRDRTLLQTAFMHRSLFNEQPHLLN---HLTDNERL
RNC_ROSS1         -----------------------TFSDQRLLEQALTHSSFLNEHVEERM---HLDSNERL
RNC_CORDI         -----------------------VDIPRELLVLALTHRSFANENGMLP-------NNERL
RNC_CORJK         -----------------------VDLPDDLLRLALTHRSFANENGHLP-------NNERL
RNC_MYCBO         -----------------------VDLPDELLSLALTHRSYAYENGGLP-------TNERL
RNC_STRAW         -----------------------YKLESALLVRALTHRSYAYENGGLP-------TNERL
RNC_LEIXX         -----------------------VDIDPELLELALTHRSYAYENGGIP-------NNERL
RNC_BIFLO         -----------------------TTLSPDLLVQALTHRSFSHEHPGVA-------NYERL
RNC_TROW8         -----------------------LTLPPGLLRTAFVHKSFSFENGACQ-------NNERL
RNC_CHLPN         -----------------------TFTQPKLLEIALTHPSYKNESAV------QIEDSERL
RNC_PARUW         -----------------------TFKDPQLLVLAFVHRSFINENRE------VNQHNERL
RNC_CHLTE         -----------------------RPCNRLIYRTALTHRSVLHDHHSEE---HKPESNQRL
RNC_PELLD         -----------------------KALSLELYATALTHRSMVHDTTAPE---ITR-SNQRL
RNC_CHLCH         -----------------------LDGNARLYQTALTHRSVIGNTALSH---HNE-SNQRL
RNC2_SYNY3        T-----------------------PVDWNLVDLALTHASQSPEQ-----------NYQQL
RNC2_NOSS1        A-----------------------PIKWELLDLALTHPTVSESA-----------NYEQL
RNC_GLOVI         E-----------------------ALSWELLHRALIHPSWSAQEGG--------EDNDRL
RNC_PROMA         D-IEVIK--------------KNEDYCLKILNEALTHTSFNLSI-----------NHERL
A9BD45_PROM4      N-LEFIK--------------KSKSYCLNIFNEALTHTSTNSKT-----------NHERL
Q7V4K2_PROMM      ARSKSCP--------------GTEPRGLAVIDEALTHTSAQEII-----------NHERL
Q46IK9_PROMT      F-QKEFT--------------KEKIKNILYINESLTHSSANSEI-----------NYENL
A4CTC0_SYNPV      QEANRDPQLRSLWNELGNHPERLQREELDCLNEALTHTSSGLHP-----------HHEQL
Q0IDN5_SYNS3      TANNND----------------LNREQLEHLNEALTHTSTGLAR-----------HHEQL
Q3ANA7_SYNSC      IE----------------------PELLILVDQAMTHVSSGRDR-----------NLERL
A5GQ81_SYNR3      A----------------------DEAALKPLHTALTHTSAGLEV-----------NHEEL
RNC_ONYPE         -----------------------TPQNLTLYKQALTHSSYSNEQNPPQ------EDNERL
Q1AW81_RUBXD      I----------------------EILPDPLRKRALTHPSVADPYHS----------NGRL
B3PN90_MYCA5      -----------------------KIRRPEFVFKSLTHKSFDQSDHFKF-------NYEYL
D1J8Q7_MYCHP      KLD---------------------EQKRRYFCNAFTHSSYSNEHKNL-------ESYQYL
E8ZGH5_MYCHL      -----------------------TIKDKNLFTKAFTHSSYKGCNPNFK------GDYEKL
RNC_MYCPN         ------------------------PQNWQFYEDAFVHSSYVNENED------ARASYDRL
RNC_TRES6         -----------------------QFKNLQLLEQAFTRKSYSEEHPELQ-------NNEVL
RNC_ROSHA         -----------------------TFKNQELLVQAFTRRSYSMENGG--------QDNEVL
                                                                             :

RNC_BACTN         EFLGDAILDAIVGDIVYKRFEGKR-----------------------EGFLTNTRSKIVQ
D9RT83_PREMB      EFLGDAILDAIVGDIVYEHFPGKR-----------------------EGFLTNTRSKIVQ
RNC_AZOPC         EFLGDAIFNAIIAVILYKKFPTND-----------------------EGFLTNTRSKIVK
E4T6E6_PALPW      EFLGDAVLNSVVTDILYRRYKEER-----------------------EGFLTNTRSKIVK
E4TVQ3_MARTH      EYLGDAILGAVVADYLFKKYPFKD-----------------------EGFLTEIRSRIVN
B3ETI2_AMOA5      EFLGDAVLSLVVAEYLFKKYPLQE-----------------------EGFLTEIRSRIVN
C7PEN8_CHIPD      EYLGDAILGAIIGDYLFKKYPYKT-----------------------EGYLTEMRSKIVN
E4TC94_RIEAD      EFLGDAVLGSIVSYYLYRQYPQES-----------------------EGFLTQMKSKIVN
C6X2R2_FLAB3      EFLGDSVLGAIISCHLFSTYPHAN-----------------------EGYLTQMKSKIVN
A3XQM1_LEEBM      EFLGDAMLGAVIAAYLFDEVGKGD-----------------------EGYLTKMRSKVVS
RNC_FLAPJ         EFMGDAMLGSVIAAHLFNMSPTGD-----------------------EGYLTKMRSKIVS
F0P289_WEEVC      EFLGDALLGASAAVHLYNSAPDRQ-----------------------EGYLTKMRSKIVS
D0J9Y6_BLASP      EFLGDAVLNSIISHFLCEKLPEKK-----------------------EGELTQVRSKIVC
C5J6D4_MYCCR      EFLGDSIINFKVSEFIFSKIN-------FQK----------------EGQASQLRAKSIS
E0TKT7_MYCHH      EFLGDSLLNLQTSLYIFKNID-------AKN----------------EGNATILRSQIVS
E4QT51_MYCH1      EFLGDSVINYAVSKVIYDNF--------YKN----------------EGNSTQIRSLLTS
RNC_MYCMO         EFIGDAILQMKSSIFIFQHFQ-------NIT----------------EGEASLIRAKNVC
Q98R47_MYCPU      EFLGDAILQKNVSEYIFKNTESN-----KIN----------------PGTATLIRSKLVN
RNC_UREPA         EFLGDACVEWVISNFIFNYKIKDNEKMRSLD----------------EGEMTRARSNMVR
Q8EW40_MYCPE      EFLGDAVISKLISEFLFKNK--------SLD----------------EQKMTEIRKNLVN
RNC_MYCS5         EFLGDSLVGFLISDYCVREFSSLE-----------------------PGELSRLRSKLVD
D5E4P5_MYCCM      EFLGDSVIQFVVSSELFK-MDDLN-----------------------QGKMTELRAKVVR
RNC_ACIBT         EFLGDSLLGMIIANYLYHAYPHEN-----------------------EGRLTRMRATLVR
RNC_PSYA2         EFLGDALLGMIVGEALYHRYPTQN-----------------------EGRLTRMRATLVR
RNC_FRAP2         EFLGDSILGFVIAEVLYMEFPDLA-----------------------EGKLSQIRSKLVK
RNC_AZOVD         EFLGDAILNFVAGEALFERFPQAK-----------------------EGQLSRLRARLVK
RNC_MARMS         EFLGDSILNYVIAEDLFHRFPKAK-----------------------EGELSRLRASLVK
RNC_ALCBS         EFLGDAQLGQIISVALFEQFPEAA-----------------------EGQLTRMRASLVR
RNC_LEGPC         EFLGDSILSFVIANELFNRFPLHS-----------------------EGQLSRLRSFLVK
RNC_COXBU         EFLGDSVLGFIIASELYQRRPQAR-----------------------EGDLSRMRASMVN
RNC_BUCAI         EFLGDSILSFVIANALYQHFPYID-----------------------EGDMSRMRATLVR
RNC_ECOLI         EFLGDSILSYVIANALYHRFPRVD-----------------------EGDMSRMRATLVR
RNC_BLOFL         EFLGDSILNYSITNILYHRYNHMD-----------------------EGDMSRIRSSLVC
RNC_WIGBR         EFLGDSILNYIISDALYNNFTNIP-----------------------EGKLSQMRSYLVR
RNC_COLP3         EFLGDSILGFVIAEALYDKFPKHD-----------------------EGDLTRMRSSLVK
RNC_PSYIN         EFLGDSILSYAISTDLYARFPKVD-----------------------EGDLSRMRATLVC
RNC_IDILO         EFLGDSILGLVIAEALYQKFPKVA-----------------------EGDLSRMRAAIVC
RNC_HAEIN         EFLGDSILNFTIAEALYHQFPRCN-----------------------EGELSRMRATLVR
RNC_ALKEH         EFLGDGILNFVIADELYHRRPDAT-----------------------EGVLSRLRATLVN
RNC_NITOC         EFLGDSILNFLIADFLYSGFPRAQ-----------------------EGELSRLRATLVK
RNC_METCA         EFLGDSVLGFVVTEYLYQRFPSAD-----------------------EGVLSRLRATLVN
RNC_XYLFA         EFLGDSVVNLLIAEALFQRWPRAD-----------------------EGALTRARSELVR
RNC_AROAE         EFLGDSILNCVVAIALFERFASLR-----------------------EGEMSRLRASLVC
RNC_BORBR         EFLGDSVLNFVVAAMLFERYGKLD-----------------------EGDLSRLRANLVK
RNC_THIDA         EFLGDSVLNCSVARALYDAFPDLP-----------------------EGSLSRLRANLVR
RNC_DECAR         EFLGDGVLDFVIAASLYHRFPDLP-----------------------EGDLSRLRANLVR
RNC_NITEU         EFLGDSVLNCAVSTLLFKRFPSLP-----------------------EGDLTRLRANFVN
RNC_RHOFT         EFLGDSVLGLAVADLLYERLSTLP-----------------------EGDLSRVRANLVK
RNC_VEREI         EFLGDSVLNLAVSSLLYQRLSALP-----------------------EGELSRVRANLVR
RNC_NEIG1         EFVGDSILNYTVARMLFDAFPKLT-----------------------EGELSRLRASLVN
RNC_AGRRK         EFLGDRVLGLCIAELLFRTFGTAT-----------------------EGELSVRLNQLVS
RNC_BRUAB         EFLGDRVLGLTVAEMLFEAFPEAS-----------------------EGELSVRLNALVN
RNC_METSB         EFLGDRVLGVVVANMLYGAFPDAD-----------------------EGELSRRLADLVR
RNC_RHOPA         EFLGDHVLGLIVSDMLYRAFPDAD-----------------------EGELSKRLADLVR
RNC_DINSH         EFLGDRVLGLVMAEALLEADPQAR-----------------------EGQLAPRYNALVR
RNC_SPHAL         EFLGDRVLGLVLASELYTRFPAAS-----------------------EGEMSSRLHVLAS
RNC_ZYMMO         EFLGDRVLGLVIANWLYDLFPREP-----------------------EGKLSRRLNSLVS
RNC_CAUSK         EFIGDRVLGLLAAEALAERFPKAK-----------------------EGELAPRLNALVS
RNC_PHEZH         EFLGDRVLNLCAAERLMALDPDAR-----------------------EGEMSRLLASLVN
RNC_ANAMF         EFLGDAVLSMTVSEMLYRLFPDDD-----------------------EGCLTRKRTALVR
RNC_ANAPZ         EFLGDAVLGLVVSEMLYTLFPDDS-----------------------EGLLTKKRIALVR
RNC_EHRRG         EFLGDAVLNLVVSEMLFNIFPYDT-----------------------EGNLAKKKTALVC
RNC_WOLTR         EFLGDSILNMIVSAILFRLFPKEK-----------------------EGALARRKTDLVC
RNC_RICAE         EFLGDAVLNLVITEILFRNFANYN-----------------------EGNLAKIRSYLVC
RNC_AQUAE         EFLGDALVNFFIVDLLVQYSPNKR-----------------------EGFLSPLKAYLIS
RNC_HYDS0         EFLGDALVNFMTVNILVEAFPNKK-----------------------EGELSQLKSFLIS
RNC_PELUB         EFLGDRVLGLIIAKKLLELYPDEK-----------------------EGVLDKKFASLVN
RNC_CARHZ         EFLGDAVLELFISDYLFRTFPQKS-----------------------EGDLTKLRSRLVC
RNC_DEHM1         EFLGDAVLGVIFADRLYHDFPDIQ-----------------------EGDLTRFRSLLVR
RNC_BDEBA         EFLGDAVLDLVVGEFLYEKFPTDT-----------------------EGGLSKKRASIVN
RNC_CAMFF         EFLGDAVLDLIVGEYLFFKFKDTD-----------------------EGNLSKLRAALVN
RNC_CAMJD         EFLGDAVLDLVVGEYLFHKFTKDA-----------------------EGDLSKLRAALVN
RNC_HELHP         EFLGDAVLDLLVGEYLFKKFPLAK-----------------------EGELSKLRACIVN
RNC_WOLSU         EFLGDAVLDLVIGEFLFLKFPKAD-----------------------EGELSKMRASLVN
RNC_HELPY         EFLGDAVLGLVIGELLYHKFYQYD-----------------------EGKLSKLRASIVS
RNC_SYNFM         EFLGDAVLGLAISHFLLEQFPDYN-----------------------EGELSRLRSAIVN
RNC_GEOMG         EFLGDAVLGLLVGKMLFARFPQSR-----------------------EGVLARMKASLVG
RNC_GEOSL         EFFGDAILGFCIGKMLLRHYPESR-----------------------EGALARMKSALVG
RNC_PELCD         EFLGDAVLGVVVSHYIFRTFPHLP-----------------------EGELTRIRSEVVS
RNC_MAGMM         EFLGDSVLNLIVSHRLYKRFGEVP-----------------------EGQLSQWRAMLVN
RNC_MYXXD         EFLGDSVVNLAVSHRLMARCPGLP-----------------------EGDLTKMRARVVN
RNC_BORBU         EFLGDSVLNLIITDHLYKTYPNKS-----------------------EGELSKARSYIVS
RNC_LEPBJ         EFLGDSVLGLVAARSLFQKYPKAS-----------------------EGELSRIKSKIVS
RNC_TREDE         EFLGDSVLGLVAASYLYKSFEDRP-----------------------EGELAKIKASAVS
RNC_TREPA         EFLGDAVLGAVAAACLYRALPDSH-----------------------EGDLAKTKAVLVS
RNC_FUSNN         ELLGDAVLDLIVAEYLYKSYKNAS-----------------------EGPIAKLKAMIVS
RNC_SOLUE         EFLGDSVLGFLIAEALVRRFPEYH-----------------------EGDLSRLKAHLVS
RNC_PSELT         EFLGDAVIDLLLAEYLYLEFPEAS-----------------------EGVMAKVKAAIAS
RNC_THEMA         EFLGDAVLELFVCEILYKKYPEAE-----------------------VGDLARVKSAAAS
RNC_DESPS         EFVGDAVLDLVVGNALYRRFPEMR-----------------------EGELTRLRAALVN
RNC_DESVH         EFLGDAVLELCVSEELFRRFPSAR-----------------------EGDLTRMRSRLVS
RNC_BACHD         EFLGDAVLELAVSQYLYKAFEQMS-----------------------EGDMTKLRASIVC
RNC_LISIN         EFLGDAVLELTVSDYLFNKYPDMA-----------------------EGHMTKMRAAIVC
RNC_LACRD         EFLGDAVLELIVSEYIYKRFPELP-----------------------QGKLTRLRAAMVC
RNC_LACSS         EFLGDAVMEITVSEYLYKKYPDWP-----------------------EGKLTRLRAAIVC
RNC_ENTFA         EFLGDAVLELIVSQYLYLKFPELP-----------------------EGKLTKMRAAIVR
RNC_STAES         EFLGDAVLELTVSRYLFDRHPHLP-----------------------EGNLTKMRATIVC
RNC_LACAC         EFLGDAVLELAVSNYLYRHYPKLN-----------------------EGELTRLRSNIVR
RNC_LEUMM         EFLGDSVMQMIVAEYLFKRYPDWH-----------------------EGQLTEMRIAMVQ
RNC_LACLM         EFLGDVALSLVISDYLYRTYPEKL-----------------------EGELSKMRSSIVR
RNC_STRT2         EFLGDAALQLVISVYLYNRYPNKP-----------------------EGEMSKMRSTIVR
RNC_MESFL         EFLGDAVLQMYVSKFLYLNFTNAP-----------------------EGKLTKTRSDIVR
RNC_MYCCT         EFLGDAILQMYVSKFLFFHYSKLG-----------------------EGELTRLRSSTVR
RNC_SPICI         EFLGDAILAKEISLYLFLSFPDKN-----------------------EGEITNLRSKIVR
RNC_CLOK5         EFLGDSVLQLCISEYLFLIYKSKS-----------------------EGELTKKRSLIVC
RNC_CLOPE         EFLGDSVLQLCVTKYLFNNYKDKS-----------------------EGELTKIRALVVC
RNC_CLOAB         EFLGDAVLQLSISEYFFKKYPTIS-----------------------EGELTKKRALVVC
RNC_CALS4         EFLGDSVLSLVISEYLYKNRKDLE-----------------------EGSLSKYRAEIVC
E6UF22_RUMA7      EFLGDSVLSIVVSDHIFEHFKHLP-----------------------EGELTKLRASLVC
RNC_NATTJ         EFLGDAVLELAISETLYKKYPELP-----------------------EGELTKLRAELVC
RNC_DESRM         EFLGDAVLELIISEHLYKMFPDRT-----------------------EGELTKMRASSVC
RNC_PELTS         EFLGDAVLELAVSDYLYRSKPEMD-----------------------EGDLTKLRASVVC
RNC_HELMI         EFLGDAVLGLVIGEQLFVRYPTWT-----------------------EGELSRRRAAVVC
RNC_MOOTA         EFLGDAVLGLVVATYLYQHFPQLP-----------------------EGDLTRMRAAVVC
RNC_SYNWW         EFLGDAVLNLVVAEYLYNHYGRKA-----------------------EGELTKIRAKVVC
RNC_RHOBA         EFLGDSVLGLTVCEWLFNEYPEYS-----------------------EGDLTKIKSAVVS
RNC_SYMTH         EFLGDSVLGMVIAAHLYERYPDLP-----------------------EGELTKIRAAVVC
RNC1_NOSS1        EFLGDAILNFLSGEYLYRSHPDRG-----------------------EDELTRRRSALVD
RNC1_SYNY3        EFLGDAVLGFVVGRILFERYPHFT-----------------------EAELTRLRSQLVN
RNC_CHLSY         EFLGDSVLHFVTTTWLFETFPDQD-----------------------EATLTNWRAALVS
RNC_ROSS1         EFLGDAIINFLAARLVFERFPDAG-----------------------EGELTAWRTALIR
RNC_CORDI         EFLGDSVLGLSVAGQLYQQYTSSP-----------------------ESDISKMRASIVS
RNC_CORJK         EFLGDAVLGLAVAEQLYRQFPERA-----------------------ESDISKMRSGVVN
RNC_MYCBO         EFLGDAVLGLTITDALFHRHPDRS-----------------------EGDLAKLRASVVN
RNC_STRAW         EFLGDSVLGLVVTDTLYRTHPDLP-----------------------EGQLAKLRAAVVN
RNC_LEIXX         EFLGDSILGQAVTVKLFRENPGLD-----------------------EGELAKRRASLVS
RNC_BIFLO         EFLGDAVLELVSTETLFTIHPDMT-----------------------EGQLAKMRAKAVS
RNC_TROW8         EFLGDAVLGLVVSHYLFETCPEYT-----------------------EGQLSAARSYIVS
RNC_CHLPN         EFLGDAVLGLIVTEHLFLLFPSMD-----------------------EGTLSTARASLVN
RNC_PARUW         EFLGDSVLGMLISDYLYCKLPKTP-----------------------EGQLSYLRSRLVE
RNC_CHLTE         EFLGDAVLDLLISEHLFKQFPGSD-----------------------EGHLSSNRAKIVN
RNC_PELLD         EFLGDSVLGLIISEYLYRRFPEGT-----------------------EGELSSYRAKIVN
RNC_CHLCH         EFLGDAVLGLLISHFLFQNFPASA-----------------------EGDLSKTRAKIVN
RNC2_SYNY3        EFVGDAVVRLASAEVLMKHYPQTS-----------------------VGEMSALRAILVS
RNC2_NOSS1        EFVGDAVVRLAAAVMLWETYPDCP-----------------------VGDFAAIRSVLVS
RNC_GLOVI         EFLGDEILRLLAAEFLYRADPELT-----------------------VGEMTAVRSVLVS
RNC_PROMA         EFQGDAVLRLAASEYIQSHFPKLS-----------------------VGDRSALRAQLVS
A9BD45_PROM4      EFLGDAVLRLAASEYIEENFPNLK-----------------------VGDRSALRAQLVS
Q7V4K2_PROMM      EFLGDAVLRLAASEYIDRHFPRMN-----------------------VGERSALRAHLVS
Q46IK9_PROMT      EFLGDAVLRLIASDFIKNKYPYMQ-----------------------VGERSELRSHLVS
A4CTC0_SYNPV      EFLGDAVLRLAASEFIAVAYPQMP-----------------------VGERSSLRAQLVS
Q0IDN5_SYNS3      EFLGDAVLRLAASDFIESEHPQMP-----------------------VGERSALRAQLVS
Q3ANA7_SYNSC      EFLGDAVLRLAATEFIDRHHADLT-----------------------VGACSNLRAQLVS
A5GQ81_SYNR3      EFLGDAVLRLACAEFLEENNSKLS-----------------------VGERSAFRAQLVS
RNC_ONYPE         EFLGDAIVGLLMADYLYSQ-SKED-----------------------EGIMTKKRAQAVC
Q1AW81_RUBXD      EFLGDSILNHRVAELVFHSYPELL-----------------------EGDLTRIRAHLVR
B3PN90_MYCA5      EFLGDAVLEFYTSDRIFQNFPKYT-----------------------EGEATRHRQMIVS
D1J8Q7_MYCHP      EFLGDSVLGFVVSDFIFDNYKNFG-----------------------EGKATKLKSEIVD
E8ZGH5_MYCHL      EFLGDSVIGLSIASELFKRDISLG-------------------------AISTSKDQIVS
RNC_MYCPN         EFLGDALIDFIVAKKLFELYPNYN-----------------------EGMLTRTKIEIVK
RNC_TRES6         EFYGDEILDFFVTKMMYKRFSRILNNELVSEKN--------------EGELTKLKSILVS
RNC_ROSHA         EFIGDKALDFVVVKQLSEEFGHYSKKYQNWEKWGKTEETGTFISDLDEGELTEIKKQLVQ
                  *  **  .                                                    

RNC_BACTN         RETLNKLAVEI---GLDKLIKYSTRS-----------------------SSH-NSYMYGN
D9RT83_PREMB      RDTLNRLAKEM---GIGQLILSNGQT-----------------------SSH-NSYLGGN
RNC_AZOPC         RDTLDKIAYQL---GINHLIMISAKV-----------------------KNH-KHIM-GN
E4T6E6_PALPW      RDSLNKLALEI---GLDKLVKVTKYV-----------------------NAHTNNNIYGN
E4TVQ3_MARTH      RESLSLLAKKI---GISQMLESDFSR-----------------------SRYHFKSIYGD
B3ETI2_AMOA5      RASLGELAKRI---GMDELLTYDTRSV----------------------NHHNIKFVYGN
C7PEN8_CHIPD      RQQLNDIAIKM---GLRKLTIYDKYN-----------------------SFLKISQIFGN
E4TC94_RIEAD      RKNLNQIGEKL---NLTSLVLKNG--------------------------SKFVADLSGN
C6X2R2_FLAB3      RKNLNKLGDEL---GLTGFLQNESP-------------------------STLSENTSGN
A3XQM1_LEEBM      REHLNELGRDL---GLLGLVKSAIPK------------------------ENFGANIHGN
RNC_FLAPJ         REHLNELGKDL---NLIQFLESKVTL------------------------QNFGENIHGN
F0P289_WEEVC      RRQLNEVSRKL---HLTEFLIPANNL------------------------ANLGEDVNGD
D0J9Y6_BLASP      RKNLNEISKKL---TLAEVFFQNNQ-------------------------PIISENILGN
C5J6D4_MYCCR      SLTFAKICDDL---QLSDLIQVGKGA----------------------KDILTNTKLKAD
E0TKT7_MYCHH      SVSFAKISEKL---QLSKYLKVAKGS----------------------EEILNNTKIKAD
E4QT51_MYCH1      TSSLANATKKV---GLMNYVLLGRGA----------------------SEIRENNKLKAD
RNC_MYCMO         SSGLSELSKKL---GLSKLLLISKGS----------------------EHLRENVKINAD
Q98R47_MYCPU      KTCLSNLAKEL---KLDKFLLLPKGQ----------------------EELVKNEKVLSD
RNC_UREPA         SEILSYAAKDL---GLTDFLMIGVGLEQ--------------------DQSARMEKIYED
Q8EW40_MYCPE      SEIFKKASEEL---GLLDYAFIGKGINL--------------------EN--DTKKIKAD
RNC_MYCS5         KLALFKIAQKL---KVEQIIKTGPKKAR--------------------NEVLSSSNVLSD
D5E4P5_MYCCM      AETLASISIAI---GLIDILKTAPGGSQ--------------------ETIKNSTKIQCD
RNC_ACIBT         QEALGKIATDL---QLSRCLILSTG--------------------ELKSGGHHRESILAD
RNC_PSYA2         QESLVIIAQNL---ELSNQLILGVG--------------------ERKGGGRNRASILAD
RNC_FRAP2         GVTLANLALNF---KLDEYIILGAS--------------------EQ--GGHKREKILED
RNC_AZOVD         GETLALLARGF---DLGDHLRLGSG--------------------ELKSGGFRRESILAD
RNC_MARMS         GDTLAELAREF---ELGDYLKLGAG--------------------ELKSGGFRRDSILAD
RNC_ALCBS         GQTLALVAREL---GLGEYLVLGGG--------------------ELKSGGFRRDSILAD
RNC_LEGPC         GEMLAEIAREI---GLGDYLFLGQG--------------------ELRSGGFRRTSILAD
RNC_COXBU         GDELAQMSTKL---GINEYLQLGVG--------------------EQKSGGKRRRSILAD
RNC_BUCAI         GNTLAEIAYEF---DLGEYLKLGQG--------------------ELKSGGFRRESILAN
RNC_ECOLI         GNTLAELAREF---ELGECLRLGPG--------------------ELKSGGFRRESILAD
RNC_BLOFL         SRTLVELAKEF---KLGNCLKLGQG--------------------ELKNKGYNRESILAD
RNC_WIGBR         GNTLAEIAREF---CLGDYLILGIG--------------------EVKTGGKNRDSILSN
RNC_COLP3         GVTLAEVARDF---NLGECLILGPG--------------------ELKSGGHHRESILED
RNC_PSYIN         GKMLAEIGREF---QLGDCLILGPG--------------------ELKSGGFRRDSIIAD
RNC_IDILO         GRSLAKLGKKM---GLGDFLSLGQG--------------------ELKSGGYRRESILAD
RNC_HAEIN         EPTLAILARQF---ELGDYMSLGSG--------------------ELKNGGFRRESILAD
RNC_ALKEH         GRTLAEIGKGL---DVGTALRLGGG--------------------EMKSGGQRRKSILAD
RNC_NITOC         GETLAELAREL---EIGDHLILGLG--------------------ELKSGGYRRTSILAD
RNC_METCA         ETSLARIAREL---ELGEYLILGSG--------------------ELKSGGYRRDSILSD
RNC_XYLFA         ETSLASIARTM---QLGEQLILGPG--------------------ELKSGGHRRDSILAD
RNC_AROAE         QDGLHRVALEL---DLGEYLRLGEG--------------------EMKSGGFRRPSILAD
RNC_BORBR         QASLADIAQRL---DLSQYLRLGEG--------------------ELKSGGFRRPSILAD
RNC_THIDA         QETLAEIAGAL---RLGDSLRLGEG--------------------ELKSGGFRRPSILAD
RNC_DECAR         QETLHRLALEL---NIGAFLRLGEG--------------------ELKSGGAQRPSILAD
RNC_NITEU         QQALHRLASAL---GIGELILLGEG--------------------ERKSGGHHRPSILAN
RNC_RHOFT         QDTLHHLALGL---GLPEVIRLGEG--------------------EARSGGHKRPSILAD
RNC_VEREI         QESLYQLALRL---PLAQALRLGESLSGNRQRRSRRRCADELQPDEAGSGGLQHPSILAD
RNC_NEIG1         EGVLAEMAAEM---NVGDGLYLGAG--------------------ELKSSGFRRPSILAD
RNC_AGRRK         AETCAAVADEM---QLHLFIRTGAD--------------------VKKLTGKRMLNVRAD
RNC_BRUAB         AETCAAIADEI---GLADLIHTGSD--------------------IKSLNDKRLLNVRAD
RNC_METSB         KESCAEVALEW---GVEAYVRVGE---------------------SEKQNASVNRAILGD
RNC_RHOPA         KETCADVARSL---DLVEGIKLGTV--------------------GAGAGAKLRKSVLGD
RNC_DINSH         KETCAEVAREI---GLGDVLRLGRS--------------------EMLTGGRRKDALLGD
RNC_SPHAL         GATCAAIAQRL---DLPALIRFGAQ--------------------ARSDGGRHSDNIAAD
RNC_ZYMMO         GASCASIARIV---GLPQWLRLGKQ--------------------ARDDGAAASDNVLGD
RNC_CAUSK         RETCARVARGA---EMGPALRLSAS--------------------SSKIGGRETDSILAG
RNC_PHEZH         YHACARAAKRA---GLQEALRLSAS--------------------ATKVGARKSDAVLGD
RNC_ANAMF         GSEVVEIARSI---GLGELILMSGG--------------------ERTCGGSDNPGTLEN
RNC_ANAPZ         GSKVVEIAQSL---NLGNILLMSKG--------------------ELTSGGISNNSNLEN
RNC_EHRRG         GTKLVEIAQSI---NLGIFIIMSDG--------------------ERSCGGANNSNNLEN
RNC_WOLTR         GNTIANVAKEI---KLGNFIIMNNS--------------------ERCNGGKRNLKNLEN
RNC_RICAE         KETICMVGAKL---TLKNYIIMTHG--------------------EEVAGGRDNLNNIEN
RNC_AQUAE         EEFFNLLAQKL---ELHKFIRIKRG--------------------K------INETIIGD
RNC_HYDS0         EEFLASLAKSL---NFEKYILISKG--------------------EELKGSNKNPSILCD
RNC_PELUB         KKKCLEIAKKI---ELEKYILVLNP--------------------KNKK-IEIEDKIVAD
RNC_CARHZ         AESLYELAFKI---NLDKFLRLGKG--------------------EFKAGGNQRMSNLAN
RNC_DEHM1         RESLVRVALGI---NLGKYLYLGRG--------------------EDASKGRFKPANLAG
RNC_BDEBA         EEVLSELALEM---GLNKLMQLGKG--------------------EALTGGAQKPRLIAS
RNC_CAMFF         EKSFASISSQI---RLGDFLYLSAA--------------------EDNNNGRNKPSLVSD
RNC_CAMJD         EKSFAKIANSL---NLGDFIFMSVA--------------------EENNGGKEKPSILSD
RNC_HELHP         EKGFMKLAQSL---DLGAYLYISQS--------------------EENNNGRQKASILSN
RNC_WOLSU         EKGFAKLAERV---SLGRHIFISNA--------------------EENNKGREKPSLLSN
RNC_HELPY         AHGFTKLAKAI---ALQDYLRVSSS--------------------EEISNGREKPSILSS
RNC_SYNFM         ERELTRIAVEL---NLGEYLLLGKG--------------------EEMTGGRRKASLLAD
RNC_GEOMG         EETLAALASAR---GLGRHLLLGRG--------------------EERSGGRERRSLLAN
RNC_GEOSL         EETLADLAAAV---ELGSYLRLGRG--------------------EERSGGRHRRSLLAN
RNC_PELCD         EKGLTVIGKAI---CLGDYMRLGKG--------------------EERSGGRQKSSLLAN
RNC_MAGMM         TRSLSEVAKDL---ELGRYLRMGRG--------------------EAKSGGREKYSILGN
RNC_MYXXD         EDGLARVARTI---PLGDLLLLGRG--------------------ELMSGGREKNSVLAD
RNC_BORBU         EDSLSNIAREI---NLGSYILLGRG--------------------EESNDGRNKKGILAD
RNC_LEPBJ         TPILNSIAEKL---NLGEYLLLGKG--------------------EKNSQGKGRRKIAAN
RNC_TREDE         EDALSKTASKL---NISNYLVLGRG--------------------EEMSGGREKKAILAD
RNC_TREPA         TDTLSDIALSL---RIDHYLLLGKG--------------------EELSGGRHKKAILAD
RNC_FUSNN         EPILAKISRQI---GVGKFLMLSRG--------------------EVMSGGRNRESILAD
RNC_SOLUE         AAHLHGVARRL---DLGSYLELGRS--------------------EEMSGGRTKKTLLVD
RNC_PSELT         EEALAQIARDI---NLGRYMFLGRG--------------------EEVSSGRERDSLLAD
RNC_THEMA         EEVLAMVSRKM---NLGKFLFLGKG--------------------EEKTGGRDRDSILAD
RNC_DESPS         EGHLATMARKI---NLGYFLCLGKG--------------------EDNSKGREKSSILSC
RNC_DESVH         KPSLEGVAREL---RLDMSLRLGKG--------------------EESQGGRERGSLLSD
RNC_BACHD         EPSLAQLAEEL---HFGELVLLGKG--------------------EEMTGGRKRPALLAD
RNC_LISIN         EPSLVEFAEAV---HFSKYVRLGKG--------------------EEKAGGRTRPALLAD
RNC_LACRD         EDSFSKFAKEC---HFDQYIRLGHG--------------------EEMAGARERPGLLCD
RNC_LACSS         TKSFSSFSKEA---HFDRYIRLGKG--------------------EEKNGARARATLLED
RNC_ENTFA         EDSLAKFAKEC---HFDNYILLGKG--------------------EEASGGRTRASLLCD
RNC_STAES         EPSLVIFANKI---KLNELILLGKG--------------------EEKTGGRTRPSLISD
RNC_LACAC         TEGFSEFAIEC---GFQKEIHLGNG--------------------EEKAGARNRKTLLED
RNC_LEUMM         TRSFAHFSRMV---HLNEGIRLGKG--------------------EEMSGARDRDSLLED
RNC_LACLM         TESLANFSRSC---GFGEFLRLGHG--------------------EEKMGGRDRETTLEN
RNC_STRT2         EESLAGFTKAC---GFEQYIRLGKG--------------------EEKSGGRERATILGD
RNC_MESFL         QETLSEIAKMI---DLGKIIRLGQG--------------------EIKSKGYEKPSILSD
RNC_MYCCT         EESLSRIAKDI---NLGQLIRLGHG--------------------ELMTKGYEKQSILAD
RNC_SPICI         EGTLAELVRRM---NWAPFLLLGKG--------------------EIKTKGYEKNRILAD
RNC_CLOK5         ENSLYEVAKKW---NIGKYIKMSKG--------------------EEITGGRERTSILAN
RNC_CLOPE         ENSLHKVSKNL---SLGKYIRMSKG--------------------EELTGGRERTSIQAD
RNC_CLOAB         GMSLHSIGERW---QLGKYIRMSHG--------------------EELTGGRTRVSIIAD
RNC_CALS4         EPSLARCARKI---ELGSFLRMGKG--------------------EEISGGRDRDSILAD
E6UF22_RUMA7      EKALFEFSHKI---ELGKYIFLGKG--------------------EELTGGRERASIVSD
RNC_NATTJ         ELSLVKIAEKL---DLGKYLRLGKG--------------------EDSTGGRDRRSTLAD
RNC_DESRM         EPSLAKVARGL---DLGRCLRMGRG--------------------EERSGGRERPSILAD
RNC_PELTS         EPSLARVAREL---ELGTCLYMGKG--------------------EERSGGRDRPSILAD
RNC_HELMI         EANLADGARRL---QLGAWLKLGRG--------------------EEASGGREKPSILAD
RNC_MOOTA         EASLVKVARRL---RVGDLLRLGQG--------------------EEHSGGRERPSNLAD
RNC_SYNWW         EDALAIFARNI---NLGQYLLLGRG--------------------EEMSGGRKRKSILAD
RNC_RHOBA         RRSCGKVACKL---GLDQCLIVGRG--------------------VTRN-RSYPKSLVSD
RNC_SYMTH         EPSLAERARVL---GIGRHMRFGRG--------------------EAVS-GRDRDSTLSD
RNC1_NOSS1        EKQLAKFAIEV---GLDFKMRLGKG--------------------AIRDGGYQNPNLLSS
RNC1_SYNY3        QNQLAYLARFL---HIAPEIRLSQS--------------------LARDDGQSSPSILAD
RNC_CHLSY         TKGLAECAAQF---NLGQYAYLSRG--------------------EDNPGGRSRQKLLAD
RNC_ROSS1         TETLAGFAQRY---NLGAYVLLARG--------------------EESSGARQRQALLAD
RNC_CORDI         RYGLADIAREI---NLGQHILLGKG--------------------EQLHDGRSKDSILAD
RNC_CORJK         MYALADVARRL---GMGDYILLGRG--------------------EMLTGGKDKHSILAD
RNC_MYCBO         TQALADVARRLCAEGLGVHVLLGRG--------------------EANTGGADKSSILAD
RNC_STRAW         SRALAEVGRGL---ELGSFIRLGRG--------------------EEGTGGRDKASILAD
RNC_LEIXX         SVALAEVARGI---GLGEYLLLGRG--------------------ENQSGGREKASILAD
RNC_BIFLO         EDALSAIAKTKL--KVGPYILLGHG--------------------EAEQGGAEKNSILCD
RNC_TROW8         GTSIAQIAKEL---NLGQFMLLGKG--------------------EKLAGGMDKTSLLAD
RNC_CHLPN         AKACCRYTTML---GIGDYLLIGKG--------------------EKIQSERGRLSAYAN
RNC_PARUW         ASSCVHYIQSL---DLSGYLLLGKG--------------------ERMNDGRGRESILAD
RNC_CHLTE         RKSLAAFALEL---QLGEHLIIGES--------------------ADKQKIRTSESALAD
RNC_PELLD         GKSLAGFARNL---DLGIHLIIGES--------------------ADQQRIRTSTSTLAD
RNC_CHLCH         SKSLACFARSI---GLGEHLLLGES--------------------AAHYNIRDSESALAD
RNC2_SYNY3        DRTLAGWGELY---GLDRFLWITPA---------------------VLADKNGRVSLMAD
RNC2_NOSS1        DRILAQLAREY---GLELHLLVAGS---------------------ATSDKIGQESRLAD
RNC_GLOVI         DVALAELAEGY---DLGEFLVVGRS---------------------ASGDERGRITRLAD
RNC_PROMA         DRWLAKVGYKI---GIKTTMLIANK---------------------ALKDEAATDTICAE
A9BD45_PROM4      DEWLTKVGQEI---NIKQFMLIGPK---------------------AHKDKAASATLQAE
Q7V4K2_PROMM      DRWLAEVGQRI---GIESVLIIGPM---------------------AAGDASAKPTLQAE
Q46IK9_PROMT      DLWLEEVGKKI---EINSVLVIGNK---------------------ALRDKSANATIQAE
A4CTC0_SYNPV      DRWLTQLGEAI---TIEEWWRIGPK---------------------ASGDPTAAATIRAE
Q0IDN5_SYNS3      DRWLAELGTTI---GIEVLLQVGSK---------------------ASGDQAARSTLRAE
Q3ANA7_SYNSC      DRWLADVGEAL---GIEEHLLLGRH---------------------AQGDRSARSRLRAD
A5GQ81_SYNR3      DRWLAELAAEL---QLDGLIKQGSA---------------------TAADTTARATVRAE
RNC_ONYPE         ERSLTIYAHNI---ELQNYLLLGKG---------------------EKNKDFNAKSIIAD
Q1AW81_RUBXD      KSFLASVGRSE---GLEEMIESSVI----------------------------NDSVIAD
B3PN90_MYCA5      NENLAKIAHKI---GLVEIARFGKKV-------------------FEEIKNIPNSKVFSD
D1J8Q7_MYCHP      KNALGFLSKYY---GFPNCLRTGKS----------------------AFANGKGIKSDSD
E8ZGH5_MYCHL      GSSLAYVGRKL---DFHNYIRVGNS------------------------CCVISDSIIED
RNC_MYCPN         GENLNRIGKEL---NFGNFIKLGKG-------------------------MPYTETLFGD
RNC_TRES6         KESLARCMYNI---GFSKFLYLGKS--------------------DEKNEVYKSKSVNED
RNC_ROSHA         KNTLADAIDNL---GIAYYLIMGKG--------------------DVEKNIQDSLSVKED
                                                                              

RNC_BACTN         AFEAFIGAIYLDQGYERCKQFMEQRIINRYI--DLDKISRKEV----------------N
D9RT83_PREMB      AFEALVGALYLDHGYNACMKFMKQQVLGKLI--NIDKVAYKEV----------------N
RNC_AZOPC         TLEAFIGAIYLDKGYLKTKEFVEKRIINPYI--DIDTLVREEV----------------N
E4T6E6_PALPW      ALEALLGAIYLDYGYKKCKKFVEQRLFKSFV--NLDKVAENEV----------------N
E4TVQ3_MARTH      MMEAFIGAVYIDRGYKYCQKFIINKLLIPHF--DLDEIIENNT----------------N
B3ETI2_AMOA5      ALEAFIGAVYLDQGYALCAQFIVDRLLKIHV--DLETIVLTDN----------------N
C7PEN8_CHIPD      TLEALVGAVYLDKGYNRTKQFVHQRLIVPYI--DLEQLENVEM----------------N
E4TC94_RIEAD      LLEALVGAIYMDFGYEKCQKVVLSKILTHSE---MLKLENKII----------------S
C6X2R2_FLAB3      LLEALIGALYLDVDYETCKKVVLERLLTPSE---INKLENKIV----------------S
A3XQM1_LEEBM      LFEALVGAIYQDRGYRYARKFINKRVIDPYV--DIEKLEGRVI----------------S
RNC_FLAPJ         LFEAFVGAIYLDRGFVYCEKFIHKKVIKPYV--DIDKLEGKVI----------------S
F0P289_WEEVC      LLEAFVGAIYVDQGLLITEKFITRYVIAPYIT-DLEKLEQRIA----------------S
D0J9Y6_BLASP      TLEALIGFIYLEIGYQGCKNFVYKKILHYHV--NITQLQNEIS----------------S
C5J6D4_MYCCR      VFESFCAAIYLDQGNEVLDLFLEKYLYDFVIQNAKHNNKDPKS----------------E
E0TKT7_MYCHH      ILESLTAAIYLDQDKKTFEDFVKKILHSLVKKQSKKVIKDPKS----------------E
E4QT51_MYCH1      IFESFCAAILLDQGFEKLNEFLSEYLYKDVNFDTEKQYKDPKS----------------I
RNC_MYCMO         LFESFVAAIYLDLGDEKLEEFLKEIFYPYISTTNLESIKDPKS----------------S
Q98R47_MYCPU      LFESLCAAIYITKGNDVLEVFLQKYLYPKMQDLEYKTLKNAKG----------------R
RNC_UREPA         IFEAFIGAVAQDQGIKKVSLILEKTLIKYFREGQINYQKDYKT----------------I
Q8EW40_MYCPE      LFEAFAGAIFIDKGEDEVWKYLEKTILKYYENNELVNPIDYKS----------------R
RNC_MYCS5         VVEALIAAIYLDQGMQSAKDFIKSHFYEIANKAQNKPNKDPKS----------------E
D5E4P5_MYCCM      VFEAIVGAIYVDQGLDIAYNFVFKFIKQYINGARQVENKDPKS----------------R
RNC_ACIBT         TVEAIIGAIYLDSSDL---NLLKDIVLKWYTPYLDHIE--PTD-------------QLKD
RNC_PSYA2         AVESLIGAIYLDSQDM---NITRECVLSWYGDLIDNVN--DQK-------------ALKD
RNC_FRAP2         VFEAIIGAIYLDS-DF---ATVKKVIVNWYKPVISTLNL-DDV-------------KVKD
RNC_AZOVD         ALEALIGAIYLDA-GL---NTVRERVLGWLAGELDSLTLVD---------------TNKD
RNC_MARMS         TVEGIIGAMYLDA-GM---DVCRQHILAWYKERLDATSLKI---------------VTKD
RNC_ALCBS         ALESIIGAMLLDG-GE---PRCREVVLAWFAPRLDAISPQS---------------AQKD
RNC_LEGPC         ALEAILAAIYLDG-GM---TAAKQIILMLYSSRLDDPDLNH---------------CLKD
RNC_COXBU         ALEAIVGAIYIDA-GL---ETCRRCVLNWYGERVDDLSKLS---------------PKKD
RNC_BUCAI         TVEALIGSIYLDS-NI---KTVEELILKWYEKRLEKISPGD---------------TQKD
RNC_ECOLI         TVEALIGGVFLDS-DI---QTVEKLILNWYQTRLDEISPGD---------------KQKD
RNC_BLOFL         TVEAIIGGIFLDS-NI---KTIEMLIAFWYQFRLNKIDLED---------------KQKD
RNC_WIGBR         AMEAIIGGIFLDS-NI---NKTHEIVISWYKNRLYSMSLKN---------------LKKD
RNC_COLP3         AIEAIIGAVYLDS-NI---ECCKALILSWFERRLMVIKPGN---------------EQKD
RNC_PSYIN         GVEAIIGAAFLDS-DI---DTVKKLILKWFDSRLNTIEPGI---------------SQKD
RNC_IDILO         AVEAIIGAIYLDS-DM---DTIRQVILNWFEPQLTLIEPGT---------------SQKD
RNC_HAEIN         CVEAIIGAMSLDQ-GL---AVTTQVIRNWYQQLLAEIKPGD---------------NQKD
RNC_ALKEH         AVEALFGAIYLDG-GF---DPSRETILRLYRDRLASLPTEA---------------ELKD
RNC_NITOC         AFEAVIGAVYLDG-GL---EACRKLVSSLYRDRLETLTNEALL-------------NLKD
RNC_METCA         ALEAILGAVLRDQ-GI---DACRALILTLFERPLSALSLDD---------------WKKD
RNC_XYLFA         AVEAVIAAIYLDA-DL---ATCRTVVLPWFETALTALPVGK---------------PEKD
RNC_AROAE         ALEAVFAATFLDQ-GF---AAAKAVIDRLYDPMIAAIDPGV---------------AAKD
RNC_BORBR         TVEALFGAVFLDA-GF---EAARRVIVRQYQPVMAHVDPKT---------------LGKD
RNC_THIDA         ALESLFGAVFLDA-GF---DEAQRVVRRLFDPLVAQIDPKA---------------SGKD
RNC_DECAR         ALEALFGAIYLDA-GF---EASRAVIEKLFAPLLDDLKPGQ---------------FQKD
RNC_NITEU         AVEAIIGAIYLES-GF---AVVEQVIVALYEPLIRQLDPDT---------------SGKD
RNC_RHOFT         ALEAVIGAVYLDA-GF---AVAQGLVRRLFQAVEIKSDMEA---------------IGKD
RNC_VEREI         ALEALIGAVYLDA-GY---ASAQALVQRLFQDVEISPRMQA---------------AARD
RNC_NEIG1         AMEAMFAAVSFDA-DF---NTAEKVVRHLFAERVRRADFQN---------------QAKD
RNC_AGRRK         VVESLIAALYLDGGL-----EVARKFILRYWEGRAVRP-DGAR-------------R--D
RNC_BRUAB         VVEALIATIYLDGGL-----EAARSFIQRYWKKRSLET-GAAR-------------R--D
RNC_METSB         VCESIIGAVFLDGGF-----APAQRVVTQAFEPRMRSP-RRPL-------------R--D
RNC_RHOPA         ICEAVIGAIYLDGGY-----EAASDFVRRNWTERMRKP-ARSL-------------R--D
RNC_DINSH         GMEAVIAAVYRDAGF-----EAAKALILRLWGKRIGAV-EADA-------------R--D
RNC_SPHAL         AIEALIGALFLERGI-----EAARTFILAQWGALIDGQ-QAAP-------------K--H
RNC_ZYMMO         VMEAMIGAIFLESGI-----EAAGKLIHKYWAPLVTGQ-ESAP-------------K--H
RNC_CAUSK         AAEALMAALYRDGGL-----ELARRVFLDLWAGEFDLANQGKP-------------R--D
RNC_PHEZH         ACEALIAALYIDGGL-----ETARAFFLKFWDEEFARLDEPRA-------------K--D
RNC_ANAMF         ALEALIGAMYMDGGP-----EAYRSFIHKHWLARAQHMSYTPP---------------QD
RNC_ANAPZ         ALEALIGAIYVDGGL-----ESVRHFILQHWKPLATNLADTPL---------------QD
RNC_EHRRG         ALEALIGAIYLDGGL-----KAAKDFIFLFWKNSATHMKVPP----------------QD
RNC_WOLTR         ALEALIGAIYIDGGF-----ANVKKFVTKHWEERAKGMLSLP----------------QD
RNC_RICAE         ATEALIAAIYLDSNI-----ETTHDIIEKLWAEFIKVQNLTD----------------YD
RNC_AQUAE         VFEALWAAVYIDSGRD---ANFTRELFYKLFKEDILSAIKEGR-------------VKKD
RNC_HYDS0         VFEAFWAAIYIDSGYD---CKLTKSLFEHHFKSQILEMVNSNS-------------LKQD
RNC_PELUB         CLEALIGAIYLDKGL-----NFTERFILNLWSEHITASVITQI----------------D
RNC_CARHZ         AVEAVIGAVYFDCG-----IEAAFSFITRLY--GEKLKPE------------NLEQLPKD
RNC_DEHM1         AFEAVLAAIYLDKG-----IDATREVIFRLF--KTEMERV------------QTLSSNID
RNC_BDEBA         SFEAIVGALYLDGG-----FEVARSFIRQEF--VPLADRVC-----------GHEDFERD
RNC_CAMFF         ALEALMGAIYLESG-----LEAVKKIFINLL--ESQYNNID------------LQSLGKD
RNC_CAMJD         ALEAIIGAIHLEAG-----FEFAKTIALRLM--EKNFPQID------------AKILIKD
RNC_HELHP         AFEALIGAIYLESS-----LTYVQSIIYDLL--EYNYIKID------------LDSLFMD
RNC_WOLSU         AFEATMGAIYLETG-----LSVVREVVHRLL--DEVYPKID------------LGSLFRD
RNC_HELPY         AFEALMAGVYLEAG-----LAKVQKIMQNLL--NRAYKRLD------------LEHLFMD
RNC_SYNFM         SLEALLASIYLDGG-----LDAVLGVIKKLF--DVYLRFEKRE--------HVLKALDKD
RNC_GEOMG         TYEALLAAVYLDGG-----LGPVERIVEQDF--SPLLAGIA------------SGATGRD
RNC_GEOSL         ALEALLAAMYLDGG-----MAPVERLVDAWF--GPRLAGVA------------AGIKGRD
RNC_PELCD         TMEALLGAVFCDGG-----FDSVRRVIEALF--IPHIQRAA------------RRKTGVD
RNC_MAGMM         ALEALLGAIYLDGG-----FEAAERVVDRLF--AHQVAGIE------------PEQQGKD
RNC_MYXXD         ALEAVFGAVFLTSG-----LDAAVTLVDRYF--ADLLDEVS------------SGQGRLD
RNC_BORBU         AIEAFVGAIYLDSG-----FSRATEFVVGLF--DMYIRLMFNR--------GD----FKD
RNC_LEPBJ         LFESLVGAIYLDRG-----FEVAEKFIVQHL--LEFAENPDME--------ES----VRD
RNC_TREDE         ALEAVIGAYYIDSG-----FKAAQKFVLRLL--ESTIHSVLEK--------KF----ISD
RNC_TREPA         ATEAVIGALFLDSG-----FKAAERFVLRLL--LPRVRPIREK--------NL----HHD
RNC_FUSNN         SFEAILGAVYIDSN-----LDEARVFALSHI--KQYIDHIEEN--------ED----ILD
RNC_SOLUE         GLEAIMAAIYLDGG-----VDAARAFVATHVLDAPFFGDEEAG--------TDIQPAITN
RNC_PSELT         MLEAVVAAVYIDGG-----LTAVKKVFLSYF--AKYAKEVVEG--------KI----VFD
RNC_THEMA         AFEALLAAIYLDQG-----YEKIKELFEQEF--EFYIEKIMKG--------EM----LFD
RNC_DESPS         AYEAVIGAIFQDGG-----YDAVAALVERFF--LPVIDRRKED--------LL----LAD
RNC_DESVH         ALEAMLGAVFLDAG-----YIAAKGVVMRIL--GPHFPEALVP--------VR----TKD
RNC_BACHD         VFESFVGALYLDQG-----MDAVYLFLERTI--YPKISE-G------------AFSHMMD
RNC_LISIN         VFESFIGALYLDNG-----IDKVVKFLERVI--FPKIDA-G------------AYLQTVD
RNC_LACRD         IFESFIGALYLDQG-----RPAVEKFVQRVI--FPKLDM-G------------WFDHAVD
RNC_LACSS         LFEAFNGALFLDQG-----RDAVVDFVSQVI--FPKIEA-G------------EFSDQTD
RNC_ENTFA         LFEAFLGALYLDQK-----VGAAKKFIEDVI--FPKIDA-G------------AFSHEMD
RNC_STAES         AFEAFVGALYLDQG-----LDSVWTFAEKVI--FPYVED-D------------ELVGVVD
RNC_LACAC         VFEAFNGALFLDQG-----MPAVERFLHLTV--YPLIAK-G------------EFDDSRD
RNC_LEUMM         IWEAFIGALYLDQG-----ADVVRQFLNQTL--FAAIDT-D------------FFDRFID
RNC_LACLM         LFEAFLGALFIDQG-----MDEVRKFIQHVV--IPHVKN-D------------DYVKVID
RNC_STRT2         LWEAFLGALYLDQG-----LPAVEKFLNQVM--IPQVEK-G------------NFDRVID
RNC_MESFL         VYEAVTAAIYLDQT-----EEVLISWIKSTI--FKYIEKND------------YKELNHD
RNC_MYCCT         IFEALTAAVYIDQN-----EDGLLIWLEQTL--FKYMKDPT------------FINVTKD
RNC_SPICI         IYESMIAALYLDLG-----EDVVRTFINNTL--IRMVSNPG------------FFDKIRD
RNC_CLOK5         CVEAIIAAIYIDSG-----YKKTKQFIIDNF--KDIIEKAI------------KNQIVLD
RNC_CLOPE         ALEAVIAAVYLDKG-----IEVANDFILRNF--KDVIDKAI------------NEEIILD
RNC_CLOAB         CVEAVIAAIYLDKG-----FDTAKNFILREF--EGTIQNAV------------ENKIILD
RNC_CALS4         AMEALLAAVYLDGG-----LEAVRRVILDLF--KEIIDEVL------------KGIIYRD
E6UF22_RUMA7      AMEAVIAAIYLDGG-----LEAARKHIMNFL--PKDLNPAH------------TDT-FHD
RNC_NATTJ         TVEALIGAVYLQTN-----YDQTKQLILDLF--KDQLSHID------------NQR-IGD
RNC_DESRM         AFEALLGAIYLDQG-----LEISRHFVLNCL--SSIIDDVV------------AGRLDRD
RNC_PELTS         AFEALLGAVYLDQG-----LEKAAGLAIKYL--APLIGDVL------------EGRLERD
RNC_HELMI         ALEAVIGAIFLSGG-----IEAARRFIVDLF--GDALANA-------------QNLVSGD
RNC_MOOTA         AMEAIIGSVYLSGG-----YELARDFVLQIF--TPALEILS------------DTSFI-D
RNC_SYNWW         AVEAVIGAIYLDQG-----LETVQRFIIRQL--EELISETA------------SGDYY-D
RNC_RHOBA         VFEAVIAALYIDGG-----PEIVRDRLKLWLAEEVNLAVDTQ--------------GSGN
RNC_SYMTH         AFEAVVGALYLDGG-----LEAAQRFVLRELGQLVEAARQGL--------------VRVD
RNC1_NOSS1        TFEAVIGAYYLDNNSN---IEAVRAIIEPLFESVPEQIVVVRS--------------NVD
RNC1_SYNY3        VFESLLGAALLDRG-----LTAVEDFIQELFVPILEQWEKSQDG------RSPKLVPTMD
RNC_CHLSY         LFEALVGAIYLDQG-----LETARAFIVPFWQARIEQIIH----------------IDLD
RNC_ROSS1         TFEAVIAALFLDQG-----LNAVRTFLLPLFEAELASLPDR--------------TLPVD
RNC_CORDI         TTEALLGAIYLAHG-----FEIARDTVLRLFKHKIDTASA--------------TGLHQD
RNC_CORJK         SVESMLGAIYLHHG-----FEVARATVLRLFAEKITEAPT--------------TGLTMD
RNC_MYCBO         GMESLLGAIYLQHG-----MEKAREVILRLFGPLLDAAPT--------------LGAGLD
RNC_STRAW         TLEAVIGAVYLDQG-----LEAAGELVHRLFDPLIEKSSN--------------LGAGLD
RNC_LEIXX         TVEAVIGAVYLDAG-----GDEATALVLRLIGPLLADPDR--------------FGAAMD
RNC_BIFLO         IVESLIGATFLEHG-----IDEARKVIHRLIDDTLAEVAT--------------EGPALD
RNC_TROW8         LLESLIGAVMVDQG-----FESARDFVLALVGEKLRQVGE--------------FSVD-D
RNC_CHLPN         LFESILGAVYLDGG-----LSPARKLTVPLLPPREEILPLMS----------------GN
RNC_PARUW         LFEAIIGAIYLDGG-----LQAAKDFLFKNFHQHIEIILATPL---------------RN
RNC_CHLTE         ALEALVGAIYLDQG-----LAGAERFITNHVIAKVDLHKLVEA--------------EYN
RNC_PELLD         AFEALTGAIYLDRG-----LDAVREFIEEQIIDSPAFEAMVST--------------ENN
RNC_CHLCH         AFESLIGAIYLDKG-----LDAAYGFVDKHIIHHQSFSAIVAS--------------EQN
RNC2_SYNY3        SFEALLGALYLSVGD----LSLIRPWLSEHLLAKATEIRQDP--------------ALHN
RNC2_NOSS1        AFEAVLGALYLSTSN----LELIRPWLDHHFRQLAAEIRLDP--------------ARLN
RNC_GLOVI         GFEAVIGALYLSTGD----LGLIRPWLLPHLAHLAESVMADP--------------TRGN
RNC_PROMA         GTEALIGALYECLRN----IDAIQNWLEPYWNIESEEVLADP--------------HKQN
A9BD45_PROM4      ATEAMIGALYECLKD----IKSIKVWLKPYWDKTSKSVLEDP--------------HRLN
Q7V4K2_PROMM      ATEALIGALYECWQS----LEPIHRWLTPHWQEASSAVLTDP--------------HRLN
Q46IK9_PROMT      ATEALIGALYESLTI----VEPIKDWLIPFWEEKSKEVLADP--------------HKKN
A4CTC0_SYNPV      LSEALIGAMYRIAG-----LQAVQTWLTPHWQRSAEAVLADP--------------HRGN
Q0IDN5_SYNS3      HCEALIGAIYRISGK----VSPVQCWLTPYWRETSRDVLADP--------------HRGN
Q3ANA7_SYNSC      ATEALIGALYTALGN----LKAIHRWLTPHWSATTQAVLATP--------------HQFG
A5GQ81_SYNR3      CCEALVGAVYLAWGGADGGLHAVRQWLDPQWQRSCLELAEDP--------------HRHN
RNC_ONYPE         TFEALFGAIYLDLGY----LTAKKVFHNIVLPHLAKTIYII------------------D
Q1AW81_RUBXD      TVEAIIGAAYLIDK------NLVLRTIDEIFNPAEVDTDEL-----------------RD
B3PN90_MYCA5      MFESFIGALYFGLG-----IGPTFQYLDSVLLDSVLNVIDS-----------------KD
D1J8Q7_MYCHP      LIESFIGACYKACG-----LKFTKEIIYHFIDKILKKFHNSIN---------------EH
E8ZGH5_MYCHL      VYEAFIGAVYCEFG-----FETARKIVLSSLWNYFLMGELDFY---------------FD
RNC_MYCPN         VLEALVAAIYEDLGIEKANQFVEEHIFKKTYSEILKYNFFSLFQ------------EQKL
RNC_TRES6         LFEAIIGAVAADCDWNYEKLEKVCRTMLDMETTNGYLALLVKEKSHRLGFGEPCYRPFAW
RNC_ROSHA         LFEAILGAIALDSNWDIEALQDSMNVMLNPGELMFDEDVNYVAE--------IQAWSSAN
                    *.  .                                                     

RNC_BACTN         FKSKLIEWSQKNKMEVSFELIEQFLDH----DSNPVFQTEVRIE---------GLPAGTG
D9RT83_PREMB      FKSKLIEWSQKNKVNMEFKLIENQKDK----QGSPTFHFQVIME---------GIPCGEG
RNC_AZOPC         FKSKLFEWCQKHKILLQFQTLENFTDN----NRNVVFQIQALLN---------NHIAGIG
E4T6E6_PALPW      FKSKLIEWCQKNKLETEFILLSETMSG----SNKHVFLSGLMIQ---------GQKICEA
E4TVQ3_MARTH      YKSILIEWSQKENKSIRFDIEDQKQEG----SKK-EFRAAIFVN---------SEKISKG
B3ETI2_AMOA5      YKSKIIAWAQKNRKHIQFILITEKRIK----GVR-EFVVQLLLE---------GEVYGEG
C7PEN8_CHIPD      HKNKLYGWANKHGKTLEFDLLEEQMDN----GRR-IFTVGAVVD---------GELICSG
E4TC94_RIEAD      YKSLLLEWSQKNKIKIDYKTEEEFLPS-----KVKMFKTYIFVG---------GSKVASA
C6X2R2_FLAB3      YKSLLLEWSQKKKEHIRYDTEQEMQAG-----KNVVFRSVIWIN---------DRKVANA
A3XQM1_LEEBM      YKSLLIEWCQKEKRLFDFDTYEDSGQD-----VVRHFSVRLSID---------GKQVAKA
RNC_FLAPJ         YKSLLIEWCQKEKRVFHYDIYEDEDAG-----KLKYFGVKLSID---------GKVVAKA
F0P289_WEEVC      HKSLILEWSQKTKNSLRFNTFEEQNAE-----DIQVFVSVVRLN---------EKVISKG
D0J9Y6_BLASP      YKVWVIEWSQKNKFIINFNTFRETKEEIENKHVITYFSEFTISR---------CGIKTEG
C5J6D4_MYCCR      FQEKIQSFSTE-----KITYQSTKQSDG-------SFQSELIWD---------NQIFGVG
E0TKT7_MYCHH      FQEIIQSFSKS-----SIKYI-TKKTDK-------FFESELIWD---------NKIYGHG
E4QT51_MYCH1      FQEKIQTFSTSN----KIHYLHTKLADG-------TFRVDLIWE---------KKKYGIG
RNC_MYCMO         FQEYIQSYSNEII-EYKITQLENELRSE-------LFKAELMHN---------GITYGVG
Q98R47_MYCPU      FQEIFQATTKSA----GKYVISFDEEKK-------IYEAKLIHS---------ETIYGIG
RNC_UREPA         FQEQ-----AQRINKKPIMYKLVRNEGD-------KKEVHLVWN---------DLIYGIG
Q8EW40_MYCPE      IQELFQYNIAKKHKKAHFYYQTVEIENN-------MFKSSLIYD---------EIIYGVG
RNC_MYCS5         LQEYFQTISAET-----VKYETIEIPNKR------SFESKAWHL---------NKIYGTG
D5E4P5_MYCCM      LQEYFQNFSKEN-----IKYNVNQLPNK-------IFQARAIHE---------GSVYGMG
RNC_ACIBT         PKSRLQEYLQARKK-PLPVYEVVDIQ---GDAPHQHFKVECLVD-------GLS--KIHG
RNC_PSYA2         AKSRLQEWLQSKQF-DLPHYELMETR---GNAPHQLFVVRCQVN-------IINCPDITE
RNC_FRAP2         SKSKLQEILLQNGL-SLPEYSIETID---GKDHEQEFTVKALSN-------DLNI-EVRA
RNC_AZOVD         PKTRLQEFLQSRAC-ELPRYEVVDIQ---GEPHCRTFFVECRV--------ALLNDKTYG
RNC_MARMS         AKTRLQEFLQARKH-ALPQYDVVNIV---GEPHDQTFYVHCHI--------ELCEEFIEG
RNC_ALCBS         AKTRLQEWLQARKF-ELPTYEVTQVE---GLAPKQTFDVQCSL--------DNVQQIFIA
RNC_LEGPC         AKTQLQEFLQASKF-ALPEYVLTKIE---GDEHAQIFHVTCTI--------EGVSQVAYG
RNC_COXBU         AKSLLQEWLQARRL-PLPTYEV-KIT---GEAHAQTFTVNCYV--------KGLPHKTEG
RNC_BUCAI         PKTRLQEYLQSKHL-SLPLYFIVEVY---GEAHNQLFTIHCKI--------STISEYLIG
RNC_ECOLI         PKTRLQEYLQGRHL-PLPTYLVVQVR---GEAHDQEFTIHCQV--------SGLSEPVVG
RNC_BLOFL         PKTRLQEYLQHHHL-PLPIYCINQVQ---GQAHDQIFIMNCQV--------SSLKYSVMG
RNC_WIGBR         PKTRLQEYLQGNKF-SLPQYYIKNIT---GESHNQEFTICCFI--------DDLKKSVIG
RNC_COLP3         PKTRLQEFLQGRKI-PLPTYEVIDTT---GQSHNQEFTVRCQT--------SVISEVVIA
RNC_PSYIN         PKTRLQEHLQSRKQ-PLPIYEVLEIK---GEAHNQRFTMSCSI--------DGLKSVQ-G
RNC_IDILO         PKTRLQELLQARQK-PLPEYDVVATQ---GQAHNQQFTVNCSV--------EGIESPFKG
RNC_HAEIN         AKTRLQEYLQGKHL-PLPTYEVVNIQ---GEAHCQIFTVKCKVKSA-----EKIDRTFVA
RNC_ALKEH         PKTRLQEHLQAGRR-PLPRYEVLEVS---GQSHDQTFRVACRL--------QDAAVTAEG
RNC_NITOC         PKTRLQEYLQARQF-PLPDYRVSAVS---GEAHDQVFQVECTL--------NNTFPSVIG
RNC_METCA         PKTRLQELMQGRGL-PLPVYTLIDQS---GLPHDQHFRVRCEV--------PLAVEPCVG
RNC_XYLFA         PKTRLQEWLQARQW-SLPVYELIFES---GDPHTKHFRVSCTL--------GELKLRTEG
RNC_AROAE         PKTALQELLQGRKL-PLPTYVMAKVH---GEAHAQEFEVVCEV--------NALNLRTTG
RNC_BORBR         AKTLLQEFLQGRKL-ALPQYTVVATH---GAAHSQQFEVECAI--------PALEIKIVA
RNC_THIDA         PKTRLQEILQSRRL-PLPEYRLVGTE---GEAHDQSFIVECLL--------AKPVLSTRG
RNC_DECAR         AKTRLQEWLQGRKK-ALPRYHLLEAT---GAAHEQRFEIACEI--------ESPALRTVG
RNC_NITEU         SKTLLQEYLQSRKI-ALPEYSVLLAQ---GDPHAQVFHVECVI--------PGFGIRTRG
RNC_RHOFT         PKTELQEWLQGRKM-NLPLYRVVATL---GAAHKQTFDVECEI--------VELNFLERG
RNC_VEREI         AKTALQEWLASRKM-KPPQYQVVARV---GAAHCPTFEVACGI--------PALGLTERG
RNC_NEIG1         GKTALQEALQARRF-ALPKYRIEEQI---GHADDSMFVISCDL--------GELGFVCRA
RNC_AGRRK         AKTELQEWAHAKFG-VTPVYRVDDRS---GPDHDPRFTVTVEV---------AGAAPETG
RNC_BRUAB         AKTELQEWAHQQGN-VHPVYAILSRS---GPDHDPLFLVEVTV---------KGFAPEKG
RNC_METSB         PKTTLQEWAQARGL-PPPSYRETART---GPDHAPEFTISVEI---------AGFQQAEA
RNC_RHOPA         PKTVLQEWAQARGL-PTPVYREVERT---GPHHDPQFRVAVIL---------PGLEPAEG
RNC_DINSH         PKTALQEWAQARGL-PPPAYIESARS---GPDHAPVFTISARL---------ETGACAEA
RNC_SPHAL         PKAALQEWALARGR-RPPEYEIVSRE---GPDHAPRFRIAVSI---------GKLARAEA
RNC_ZYMMO         PKSALQEWAAAHNR-RPPVYEIVSRT---GPQHNPCFTIQVSI---------AGVGEASA
RNC_CAUSK         PKTALQEWAQSQGK-PLPTYAVKDRK---GPDHAPMFTVQVTV---------VGLDPVFA
RNC_PHEZH         PKTQLQEWVQGMGL-PLPTYEIVSQE---GPPHAPSFTVEVQV---------AGFGAERG
RNC_ANAMF         PKTALQEWVQGRGW-AMPLYKLVSKS---GPEHKPVFAVEVSI---------QEHGNVLG
RNC_ANAPZ         AKTALQEWAQGHNF-AIPSYRLINKS---GLEHAPVFTVEVTV---------NGQ-RVHA
RNC_EHRRG         AKTILQEWAQSKGF-PAPSYHIINKS---GPDHNPCFTVEVRI---------NSHETLHA
RNC_WOLTR         PKTSLQEWTQKNKL-PLPEYELMKQT---GPAHSPEFTISICI---------ENYGKVFA
RNC_RICAE         PKTALQEWAQASDH-HLPIYRLIKRE---GASHSSTFTVLVKV---------KDY-EQTG
RNC_AQUAE         YKTILQEITQKRWK-ERPEYRLISVE---GPHHKKKFIVEAKI---------KEY-RTLG
RNC_HYDS0         YKTALQEITQKKWK-ERPIYNVISVE---GPEHRKTFTVECLF---------KDL-RTTG
RNC_PELUB         AKTKLQEYSLKIFK-VLPIYKLISNT---GPRHKPLFKVAVKL---------KNTKFFTA
RNC_CARHZ         EKTTLQELLQKEKN-NVLRYEILLEE---GPPHQKIFTAGVII---------NDKLIATG
RNC_DEHM1         YKSRLQELVQAQFQ-LTPRYRIIDFS---GPEHNHLFIAEVYT---------EDKVLAEG
RNC_BDEBA         YKTRLQELVQKSSK-ETPRYEVLAEE---GPPHDREFLVCVKV---------KEDVWAQG
RNC_CAMFF         YKTTLQEITQARFG-VTPRYELVSSS---GPDHKKSFEMAVFL---------NDKELARA
RNC_CAMJD         YKTKLQEITQGKIG-QTPQYETVRAF---GPDHLKQFEIALML---------DGKELARA
RNC_HELHP         YKTALQEITQAFYG-EIPTYTLISES---GPDHKKSFEIALSV---------QGKEYARA
RNC_WOLSU         YKTALQELTQAKFG-ETPEYVILGSS---GPDHKKEFEVAVCV---------LGSEYARA
RNC_HELPY         YKTALQELTQAQFC-VIPTYQLLKEK---GPDHHKEFEMALYI---------QDKMYATA
RNC_SYNFM         YKTQLQELTQARYK-LTPVYVLDREE---GPDHDKTFHMNVVL---------EGQVLAGG
RNC_GEOMG         FKTEFQEMVQTRFG-TAPTYELIATD---GPPHDRRFTVIAMV---------AGKRMGEG
RNC_GEOSL         FKTDFQELAQAQYG-GLPRYVLVDTS---GPAHDLRFTVAAYV---------GERLLGQG
RNC_PELCD         YKTRLQERLQARFG-DVPQYVLIHAD---GPPHQRSYSVEAHF---------RGSCIGQG
RNC_MAGMM         YKTLLQEYLQARGE-ALPIYAVLSAE---GPPHERVFVVSCHP---------REQLCGHG
RNC_MYXXD         YKTLLQEMAHERLK-LQPRYRVVSES---GPEHSKVFEVELML---------GETAFARA
RNC_BORBU         YKSLLQEYVQKKYK-ISPSYKLDKEI---GPDHDKVFCVELYV---------GENFISNG
RNC_LEPBJ         YKTQLQEYSQKHFK-TLPVYRMKGES---GPDHSKTFQVSVRI---------RDQWEASG
RNC_TREDE         YKSLLQELVQKKFK-TVPKYELKKAS---GPDHDRTFWFSVSI---------NGKVYGPL
RNC_TREPA         YKSTLQVLAHQRYR-SKPEYTVVKRT---GPDHSVRFWVDVTV---------GDARFGPG
RNC_FUSNN         FKSILQEYVQKEFK-TVPTYELVAER---GPDHMKEFEIQVIV---------GN-YKEKA
RNC_SOLUE         FKSALQELAQTRRL-PQPRYSVVRER---GPEHSKTFTVEVRV---------GKEWTAQA
RNC_PSELT         YKTSLQEITQARYR-KLPEYVLVNEK---GPSHMKKFTVELRL---------SGKLIAVG
RNC_THEMA         YKTALQEIVQSEHK-VPPEYILVRTE---KNDGDRIFVVEVRV---------NGKTIATG
RNC_DESPS         AKSRLQEILQEKHN-EGPSYRLDNEE---GPSHKKRFTISVLF---------RDEVLGTG
RNC_DESVH         YKSQLQELTQKLFR-DRPVYTLLGSS---GPEHDKQFDVRVVL---------PDGTVFEA
RNC_BACHD         FKSQLQEFIQRDNL-GHIHYEIVQER---GPAHNREFVSEVVL---------NNETLGVG
RNC_LISIN         YKTQLQEIVQRDRD-VLIEYDILGET---GPAHNKAFDAQVIV---------NGQVLGKG
RNC_LACRD         AKTSLQEFLQRDGD-IAIEYHLVEES---GTENDPEFKVNVTA---------NGDVIGEG
RNC_LACSS         YKTNLQEFLQQDGE-IEIDYQLLAEV---GPSHDRQFEVDVLV---------GDRVLGSG
RNC_ENTFA         HKTQLQEVLQRKGD-VSIEYRLIKEE---GPAHDRTFFTEVYM---------NGELIGLG
RNC_STAES         FKTQFQEYVHSQNK-GDVTYQLIKEE---GPAHHRLFTSEVIL---------ENKAVAEG
RNC_LACAC         YKTDLQELLQQNGP-VNIEYSVISESQ--LPSH---FVVELKI---------NDQVQTQG
RNC_LEUMM         FKSRLQERLQTKGS-VDIDYQTEKEEQ--LSDNTQLFEASVSA---------NDKELARG
RNC_LACLM         YKTELQEVLQIGGE-TTISYKILKEE---GPAHDRSFVAAVFN---------NGKELGRG
RNC_STRT2         YKTALQERLQVNGK-VDITYTVIDES---GPAHAKEFTMQVAV---------DGKELSTG
RNC_MESFL         YKSELQEIIQAEIR-SDLEYRVESQKHI-EKDNKIEYTVSVNL---------DGKKYGIG
RNC_MYCCT         FKSELQELLQSEKR-SDLKYIIENEEFF-VNENKTLYTVSVNL---------DGQKFGVG
RNC_SPICI         YKTELQEFLQAGDA-RTLEYKLIKESQP-LEGNRVLYTVVAEI---------GGIRYGEG
RNC_CLOK5         YKTNLQEIVQQDGD-IHIEYMLIKYE---GPPHRRKFYTKVCV---------ANNVMGSG
RNC_CLOPE         FKTRLQEVLQKNGE-VNIVYNLVKHE---GPPHRRKFFTDLLI---------NNEIMGQG
RNC_CLOAB         YKTRLQEILQSKGK-TDIKYTLVRHE---GPPHRRKFFVNLNF---------DNDVKSTG
RNC_CALS4         YKTRLQEVVQSMEV-GKITYELVEEI---GPDHNKTFVTQVKI---------GDVVLGIG
E6UF22_RUMA7      YKTVLQEIIQRNPE-EKVEYFLKGED---GPDHDKRFTVQVKL---------NNNVIGEG
RNC_NATTJ         YKTMIQELVQDRYG-DPPKYQIVKES---GPDHDKSFVAEVQI---------NNEVVGRG
RNC_DESRM         YKTELQEILQQSSP-DPLTYTIMDES---GPDHDKTFTAGVIY---------KGKVIGKG
RNC_PELTS         YKTELQELVQQRGG-EQVQYVILKEE---GPDHHKSFTAGVLY---------RGVLVGQG
RNC_HELMI         NKTAFQEWVQRTGP-ADIRYCIVDES---GPDHDKRFVAAVMV---------NGTVIADG
RNC_MOOTA         SKSALQEFVQSQGT-ENVVYKILEEW---GPDHAKGYKAGVFL---------KNRLLATG
RNC_SYNWW         YKSKLQELVQARDK-ENVSYAIIEES---GPAHAKVFVAGVYY---------REQLLATG
RNC_RHOBA         HKSVLQQFAQRELS-ATPVYKLIRET---GPDHRKMFLMGAMV---------DDRRFAPA
RNC_SYMTH         YKTQLQEQLQRQGA-AAPQYRLLVEE---GPAHLRRFQVGVYF---------EGRLLGTG
RNC1_NOSS1        SKNRFQEWVQRNIG-PTPPKYLTEQIGGFSHAPEFKATVLVG-----------EKEYGEG
RNC1_SYNY3        VKSMLQQWALAKTK-QLPEYELINTSGP-PHAQEFTFTVKVA-----------GKIHGQG
RNC_CHLSY         PTTRLQELMQARFK-QLPDYSIEEERGP-EHQREYVMAVTVA-----------GRKF-TG
RNC_ROSS1         YKSRLQARIQAERR-VTPRYHEIDRSGP-EHRPEFTVEVRAG-----------EERLGTG
RNC_CORDI         WKTTLQERLAERNL-EMPTYTSTV-TGP-EHEQTFTAEVAVH-----------GTVLGTG
RNC_CORJK         WKTVLLEKLSDMKL-PLPTYEVRG-EGP-EHDKTFYATVTIE-----------DLVT-HG
RNC_MYCBO         WKTSLQELTAARGL-GAPSYLVTS-TGP-DHDKEFTAVVVVM-----------DSEYGSG
RNC_STRAW         WKTSLQELTATEGL-GVPEYLVTE-TGP-DHEKTFTAAARVG-----------GVSYGTG
RNC_LEIXX         PKTSLQEAAAHHGA-GQPVYTVIN-TGP-DHSKTFHATVDVG-----------GLVTASG
RNC_BIFLO         WKTSLTVKAHGLGK-EEPVYHMEV-SGP-EYAQIFTARVSLGE---------NGDIIGIG
RNC_TROW8         PKTKLQKLTRTQ-----LVYEVVT-EGP-PHSRTFKASVIVN------------EKRFFG
RNC_CHLPN         PKNLLQQFTQKQFR-VLPVYQSTAVT---DAQGNVSYQIQVLV---------NQEVWGEG
RNC_PARUW         WKALLQDYCQKNYQ-QTPLYQVLHES---GPDHSKVFQISVWI---------QDRELGRG
RNC_CHLTE         YKSRLIEYTQSRQL-PPPLYTVITEE---GAEHEKTFVVEVSC---------NGQPLGRG
RNC_PELLD         HKSRLIEHTQSHQL-PPPVYTVLSEE---GAEHEKTFTIEVSC---------NGRRLGRG
RNC_CHLCH         YKSCLIEYSQAHHV-AAPVYTVIAEH---GAEHDKEFTVEVSC---------NNI-KGCG
RNC2_SYNY3        YKEALQAWTQAHYK-CLPEYRVEPLDQNLPQQSGFQATVWLGDQ-----------PLGSG
RNC2_NOSS1        YKAALQEWTQAQFK-VLPEYRVVEINQANRTQERFAAEVWLHGN-----------KLGEG
RNC_GLOVI         HKSALQELTQKLAAGELPEYRLVD------PGPPFRYEVWALGR-----------LWGSG
RNC_PROMA         EKSALQEWSQGQGL-NKPIYTIKEISKQHGDLKRFYCTVHIQND-----------FRGEG
A9BD45_PROM4      SKSALQEWSQGNGL-DIPIYKNEELSQKHGDPRRFFCKVLINKK-----------ILGEG
Q7V4K2_PROMM      SKSALQEWSQARGL-GLPRYECAERSKQHGDPQRYVCQVHLDDR-----------PIGEG
Q46IK9_PROMT      YKSALQELTQSKGL-SIPIYKTIEIDKKHDNPKRFFCNVYVKNR-----------SIAEG
A4CTC0_SYNPV      SKSALQEWSQGRGL-GLPRYACSEVSQRHGDPKRFQASVTLPPD-----------LAADG
Q0IDN5_SYNS3      SKSALQEWTQAQGL-GLPIYECHEVNKRHGDPRRFHCQVFIQDQN---------SPTAEA
Q3ANA7_SYNSC      GKTTLQEWSQGQGL-GLPRYATEECSRQHGDPERFRCQVSIQGR-----------NLAEA
A5GQ81_SYNR3      WKSALQELTQAQQA-GLPSYSTTEENSNHGDQRRFRSVVSVNAK-----------EKGCG
RNC_ONYPE         FKTQLQEIVQSEKK--TIQYKIVQEQ---GPAHSKNFVAEVYL---------EKNLLGTG
Q1AW81_RUBXD      WKTLLQETLQAEGL--RPTYRVISKQ---GPPHRPVFISGVSVD---------GEEVATG
B3PN90_MYCA5      PKSYFQEIIQANGNLSRLRYVTVAQN-------NGEFKSELLVD---------QKVFGVG
D1J8Q7_MYCHP      PKTKLQELVQSNWG-CRPRYEDQALN-------NGKFESKVFIN---------NNLYGEG
E8ZGH5_MYCHL      YKTKLNTLVGQKYK-GKVTYTLIDSFP--SKDGSTTFKVSASWN---------NDSLSIG
RNC_MYCPN         PEPRVRVSLTSNNLVLSIIELNGDIIWSQAVPNSKHYDDKSVLEHNAMSAFTQFLKSGKG
RNC_TRES6         QTDNPEDWQSDNLFNMGIGFGGFGSTSKNPKTGKHEYGIQVGEN--------KFTGIGDG
RNC_ROSHA         SGNIPLHCFYPTSMQGTWYMPRHHMCIYGKAEQDTHFACEVLIP--------GIDYHFVG
                                                                              

RNC_BACTN         TGYSKKESQQNAAQMAIKKVK-DQTFMDTVNEAKSQHSKPSE---VETESVEPELTESET
D9RT83_PREMB      HGYSKKESQQEASKLTLQRLRREPQFIDEVFAAKANRTKMEEEPVLNVPETSQDMNFIEG
RNC_AZOPC         IGYSKRESQQHASQMTWRKIRTDKIFLREVFAGVKKTNSEDK------------------
E4T6E6_PALPW      SGMSKKESQQNASRIAFEIIESNPDILKELKSDQNQVPQENMS------PPDQAIEFIDI
E4TVQ3_MARTH      AGLNKKKAEQNAAFKACRKLNLI-------------------------------------
B3ETI2_AMOA5      VGKTKKQAEQMAAQESLKRIM---------------------------------------
C7PEN8_CHIPD      KAFNKKDASQIAAQQAIELLGLGEK-----------------------------------
E4TC94_RIEAD      TETSKKKSEEKAAQRAFYTLNKKEKIIERQ------------------------------
C6X2R2_FLAB3      TETSKKKAEEKAAQRAFYILNKKQSILENSKDSA--------------------------
A3XQM1_LEEBM      RATSKKKAEEKAAKRAYYVFQNKIDVHRFN------------------------------
RNC_FLAPJ         RATSKKKAEEIASKRGYFVFQSEIDGK---------------------------------
F0P289_WEEVC      RGTSKKKAEENAAKRAYYSLQKKIVNHDRYPS----------------------------
D0J9Y6_BLASP      RGPSKKKSEEMAAKAAYFLIQKKCKENT--------------------------------
C5J6D4_MYCCR      SGKSMKEAEFNAARQALERMPKNQD-----------------------------------
E0TKT7_MYCHH      KGNSIKEAELEAAKKSLKKLKKEFDLEK--------------------------------
E4QT51_MYCH1      YGRSIKEAEFAAATNALNIFAETEEK----------------------------------
RNC_MYCMO         FGKTKKVAEEEAATRALETLKAPSKQTIKKAIKAEKKE----------------------
Q98R47_MYCPU      YGKNKKEAEQNAAEDALKKLVI--------------------------------------
RNC_UREPA         IASTRKEAEILAAKNAILKLDDYTKKA---------------------------------
Q8EW40_MYCPE      VGKTKKEAQKSAAKIAYEKYAFDKNMLKKSK-----------------------------
RNC_MYCS5         VGLSKKDAEKNAAANALSKLKT--------------------------------------
D5E4P5_MYCCM      QGYSKKEAEIEAAIDALKKLK---------------------------------------
RNC_ACIBT         EGSSRRFAEQAAAAEIL----------------------KLLEQ----------------
RNC_PSYA2         SGESRRIAEQKAAELMI----------------------NQLHKLPGVPKKRR-------
RNC_FRAP2         KGTSRKKAEQKAAEKMI----------------------QILSQQGLHEKK---------
RNC_AZOVD         QGASRRIAEQVAAAAAL----------------------VALGVENGND-----------
RNC_MARMS         KGNSRRIAEQNAAAKAL----------------------KKLEKKDV-------------
RNC_ALCBS         QGASRRKAEQEAASLAL----------------------EWLEQQYD-------------
RNC_LEGPC         TGPNRRKAEQLAAKAML----------------------EQLQG----------------
RNC_COXBU         VNTTRRRAEQIAAKRFL----------------------ELLDDGKGDGITERDQ-----
RNC_BUCAI         TGSSRRKAEQDAAQKAL----------------------IKLGVE---------------
RNC_ECOLI         TGSSRRKAEQAAAEQAL----------------------KKLELE---------------
RNC_BLOFL         RGSSRRKAEQDAAENAL----------------------KFLIEINND------------
RNC_WIGBR         YGKTRRKAEQSAAKQAL----------------------LLFNIL---------------
RNC_COLP3         KGTSRRKAEQEAAQQIL----------------------ALIEKEREQEKEVKIKPTKQA
RNC_PSYIN         QGTSRRKAEQIAANKML----------------------DSLSGAK--------------
RNC_IDILO         TGTSRRKAEQAAATAAL----------------------EHLQESA--------------
RNC_HAEIN         KGSSRRKAEQAAAEQIL----------------------KELDIK---------------
RNC_ALKEH         EAGSRRKAEQQAAEQML----------------------KRLEDKHER------------
RNC_NITOC         IGRSRRKAEQDAATRAL----------------------ALLLAENEDMNV---------
RNC_METCA         EGSSRKKAEQQAAENML----------------------SRLSDQS-RFRV---------
RNC_XYLFA         EGSSRRLAEQDAASHAI----------------------DQLDSNK--------------
RNC_AROAE         RGTNRRAAEQQAAELAL----------------------AQLRKP---------------
RNC_BORBR         PGASRRAAEQSAAKVALEAAQAVLPAARAARKSGKARKTAQLSLPVAVAQEVK-------
RNC_THIDA         TGKSRRAAEQEAARQAC----------------------AELQR----------------
RNC_DECAR         HGSSRRIAEQVAAEKAL----------------------KELLA----------------
RNC_NITEU         EGTSRRRAEQEAARQAY-----------------------ELAIVRH-------------
RNC_RHOFT         IGGSRRAGEQAAAAAML----------------------QTLKAKAAQ------------
RNC_VEREI         SAGSRQAGEQAAAAAML----------------------ATLKARNL-------------
RNC_NEIG1         KGTSRKAAEQEAAKEALKWLE------------------EKLPLKKKKK-----------
RNC_AGRRK         IERSKRAAEQVAATRILER----------------------EGIWQPQSAQK--------
RNC_BRUAB         EGRSKRIAEQSAAEAMLYR----------------------EGVWKRDGSA---------
RNC_METSB         RGFAKRLAEQAAAAAFLTR----------------------EKIVEPGDRKGAA------
RNC_RHOPA         LGGSKRAAEKVAASAMLAR----------------------EGVGTGGN-DG--------
RNC_DINSH         QAGSKRQAEQAAAKALLAQ----------------------VESNHD-------------
RNC_SPHAL         QGASKQAAEKAAAAALLAE----------------------LEGQEK-------------
RNC_ZYMMO         EGSSKQEAQTAAAQALLDI----------------------LAQ----------------
RNC_CAUSK         EGRSRQEAEKAAAKALLE-----------------------REG--AGI-----------
RNC_PHEZH         EGRSRQAAEKAAAQCMLLK----------------------REGPEPGKVGE--------
RNC_ANAMF         TGSSKKLAEQEAAKLMLKK----------------------ITELP--------------
RNC_ANAPZ         TGCKKKYAEIAAAKLMLEK----------------------VTKQNDP------------
RNC_EHRRG         TGHNKKLAEQKAASLMLAK----------------------INYKIK-------------
RNC_WOLTR         CASSKKVAEQKAAELMLEK----------------------INNSEKTI-----------
RNC_RICAE         TGHAIKEAEKNAARSLLHR----------------------LKND---------------
RNC_AQUAE         EGKSKKEAEQRAAEELIKL----------------------LEESE--------------
RNC_HYDS0         KGNSKKYAEQEAAKNMLQI----------------------IQDNEKKKT----------
RNC_PELUB         EGTSKKDAEQNAASLCLQD----------------------IFKK---------------
RNC_CARHZ         RGKSKKEAEQEAAKKALELLKNEKEV----------------------------------
RNC_DEHM1         SGRSKKEAETSAAKEALQQFENSFTAEDNI------------------------------
RNC_BDEBA         RGRSKKNAEQMAAKNALEMKYKETN-----------------------------------
RNC_CAMFF         IGNSKKEAEQSAAWKVLQGMNI--------------------------------------
RNC_CAMJD         IAGSKKEAQQMAAKIALEKLGSLQ------------------------------------
RNC_HELHP         SGNSKKEAQQKSAQIAYKKLYSKMNKTHHKGEK---------------------------
RNC_WOLSU         CGSSKKEAQQEAARIALEIFHRKEKEAKESALKGKSE-----------------------
RNC_HELPY         KGKSKKEAEQQCAYQALQKLKEAK------------------------------------
RNC_SYNFM         SGKSKKDAQQAAAEKALQIIAADSWSLD--------------------------------
RNC_GEOMG         AGRSKKEAEQAAARQVLARFAAEGEG----------------------------------
RNC_GEOSL         TGRSKKEAEQAAARQCLERLETGRCSAAP-------------------------------
RNC_PELCD         QGRSKKSAEQAAAKQALEYLEE--------------------------------------
RNC_MAGMM         QGRSKREAEQHAAQQALELLIESENEHHD-------------------------------
RNC_MYXXD         TGRSKKEAEQSAAQATLEKLREDAACPTSPPPGTPRHDTPA-------------------
RNC_BORBU         KGKSKKEAEMRAAEVALKAMENINL-----------------------------------
RNC_LEPBJ         YGASKKIAEQNAAKELYIRIRRGF------------------------------------
RNC_TREDE         SGKTKKEAEQSVAKVAYENLCSESTVSK--------------------------------
RNC_TREPA         YGTSKKSAEQCAARLAWEQLSGTLRE----------------------------------
RNC_FUSNN         VARNKKKAEQLSAKALCIKLGVKYNEAL--------------------------------
RNC_SOLUE         EGRTKKIAAQRAARGLYERLMGDPIVPLPDDSPGDSPDDSGDAAESGVISAT--------
RNC_PSELT         EGPSIKEAEKEAARRAIEKLKGD-------------------------------------
RNC_THEMA         KGRTKKEAEKEAARIAYEKLLKERS-----------------------------------
RNC_DESPS         EAGSKKEAEQRGAALAIKKIESM-------------------------------------
RNC_DESVH         TGPSMKRAEQMAAARAVATLDK--------------------------------------
RNC_BACHD         TGRSKKEAEQHAAQQALITLSQKKEQ----------------------------------
RNC_LISIN         SGRTKKQAEQSAAQFAINQLTHR-------------------------------------
RNC_LACRD         KGSSKKHAEMQAAQQALDNMRNKNK-----------------------------------
RNC_LACSS         VGRNKKAAEQAAAKKALEQLKA--------------------------------------
RNC_ENTFA         QGKSKKLAEQDAAERALKSIPQ--------------------------------------
RNC_STAES         KGKTKKESEQKAAEQAYKLMKNKKSL----------------------------------
RNC_LACAC         EGHNKKAAEQQAAKAALQKFE---------------------------------------
RNC_LEUMM         TGKSIKDAEKAAARAALKILEDNVNL----------------------------------
RNC_LACLM         LGKSKKVAEQKAAENAIKGQNHVS------------------------------------
RNC_STRT2         LGKSKKLAEQAAAKSALEQLGN--------------------------------------
RNC_MESFL         TGFSKQEASQNAAKDCLNKLKKSAK-----------------------------------
RNC_MYCCT         KGYSKQEAEQNAASDCLSKLKKPLTN----------------------------------
RNC_SPICI         CGYTHKEAEQLAARDALQKLATKSKYHFEK------------------------------
RNC_CLOK5         VGYTKKESEQNAAQDALKKLKSEDKWNKEGIDTNEK------------------------
RNC_CLOPE         VGFSKKESEQNAAKAALQRL-GEIKWEKDTI-----------------------------
RNC_CLOAB         EGYTKKDAEQDAACKALKGLDN--------------------------------------
RNC_CALS4         QGKSKKESEQAAAMEALSKLGILK------------------------------------
E6UF22_RUMA7      IGRSKKNAEQNAAKEALALMGVKV------------------------------------
RNC_NATTJ         SGKSKKEAEQNAAHFAFQKLSK--------------------------------------
RNC_DESRM         SGHSKKEAEQQAAKDAFQHLEGMGKSGHKSAGPIR-------------------------
RNC_PELTS         TGRSKKEAEQQAAKKALMKSDLGSACNHKK------------------------------
RNC_HELMI         QGRTKKEAEQQAAGRAMREWAGRKG-----------------------------------
RNC_MOOTA         LGHSKKEAEREAARAALALLKVQG------------------------------------
RNC_SYNWW         EGKSKKEAEQKAAQKVLQDNLVPGT-----------------------------------
RNC_RHOBA         WGNNKKDAEQRAAANALAELHNAKVPYDSEQPPA--------------------------
RNC_SYMTH         WGRNKKEAEQEAARQALMPEHHSG------------------------------------
RNC1_NOSS1        IGKNKKDAEKAAAENALANLNKQELLP---------------------------------
RNC1_SYNY3        SGPSKQIATKQAALEALKSLGLLQ------------------------------------
RNC_CHLSY         SGSSKKEAKRAAARKALAAWDKHGFTATAIDAQDERN-----------------------
RNC_ROSS1         KGPSKQAAEQAAARAALDALE---------GGTDGR------------------------
RNC_CORDI         VGTNKKLAEQAAAHKAVGFLQ----------DNPAFV-----------------------
RNC_CORJK         EGHTKKVAEHAAAKQAVQKLN----------ERA--------------------------
RNC_MYCBO         VGRSKKEAEQKAAAAAWKALEVLDN------AMPGKTSA---------------------
RNC_STRAW         TGRSKKEAEQQAAESAWRAIRSAADERAKAAAQAAQTAAEAAERAQGNADASSASA----
RNC_LEIXX         EGTSKKQAEMAAALSAWTALT----------NHRARTPRG--------------------
RNC_BIFLO         KGSSKRKAQLAAAEAGWKSLD----------SFKTRTK----------------------
RNC_TROW8         QGSSKKQAQVAAAMSALASLE----------NKSS-------------------------
RNC_CHLPN         NASSKKEAEKIAAQQALDTYGNKNQNTMDV------------------------------
RNC_PARUW         KGTSKKEAQQAAAADALSRVELP-------------------------------------
RNC_CHLTE         TAPRKKDAEQLAAKEAMKRLESGDLGNLNE--PSPQNS----------------------
RNC_PELLD         TALRKKDAEQLAAEEAMGALERALTGDVAEDTPAPEETGRG-------------------
RNC_CHLCH         TARRKKDAEQLAAKEAMERIIA--LQPLPHEPKDEENSTTT-------------------
RNC2_SYNY3        SGSSKKSAEQAAAQQAYQDFIAKEILPMPKIN----------------------------
RNC2_NOSS1        KGRSIKAAEQAAAKVAFLAITPPEEIANQ-------------------------------
RNC_GLOVI         EGPSKKLAQQRAARGAYAALRSAFDTALQ-------------------------------
RNC_PROMA         WGSSRKKAQKEAAKEALKKLTN--------------------------------------
A9BD45_PROM4      WGSSRKQAEKEAALKALNKLENP-------------------------------------
Q7V4K2_PROMM      WGGSRRNAEQEAARRSLQALTQSANDNSSRTEQKAMLLKDGDQSPC--------------
Q46IK9_PROMT      SGKSIKQAEKNAASKALKYFENNVIDQ---------------------------------
A4CTC0_SYNPV      WGGSRREAEQQAAEALMAQLKDSSSGRA--------------------------------
Q0IDN5_SYNS3      WGGSRRQAEQQAAKAAMQQTTFASVPSSSQTQNS--------------------------
Q3ANA7_SYNSC      KGRSRKEAEQNAATAALQALEGSDAPQKSQ------------------------------
A5GQ81_SYNR3      WGPSRRLAEQEAARAALEQLKPRSGS----------------------------------
RNC_ONYPE         EGSTKKAAEQKAAQQALSKVAKPKDLLNNKGGKEKELQ----------------------
Q1AW81_RUBXD      RGSSIKQSEQAAARAALEILGVRPLPRSPVEVHVGA------------------------
B3PN90_MYCA5      YGHSKKQAEKAAAISALKKMETSNF-----------------------------------
D1J8Q7_MYCHP      IGQSKKESQTKAASDALKKMAKI-------------------------------------
E8ZGH5_MYCHL      LGTTLKKAEQAAAQDALNTYFPKYK-----------------------------------
RNC_MYCPN         INFFSDIKNKLDSQKPMRALTVRPKKINWKARKPKLKALKNKVKADS-------------
RNC_TRES6         IAQAKLNAEQKAYHFLIQEEIKQQFQNLDYTNPASTLHELFQKKVIMEVRYEFNEYHDEN
RNC_ROSHA         YGRSKNLARMDASRLAYEYLKDEDMLFSIRDEIDDPNYNDSIGQLEILARRGYFSIPQYD
                                                                              

RNC_BACTN         MEPDTLETEAP-------EAETTADKVETTVNEVEATETEKE------------------
D9RT83_PREMB      SEPKVEKHENPFQTEVFDEKSSAADEVKEELTDSSVEEEKKANNEDFDLSDISHSKSIDR
RNC_AZOPC         ------------------------------------------------------------
E4T6E6_PALPW      QQ----------------------------------------------------------
E4TVQ3_MARTH      ------------------------------------------------------------
B3ETI2_AMOA5      ------------------------------------------------------------
C7PEN8_CHIPD      ------------------------------------------------------------
E4TC94_RIEAD      ------------------------------------------------------------
C6X2R2_FLAB3      ------------------------------------------------------------
A3XQM1_LEEBM      ------------------------------------------------------------
RNC_FLAPJ         ------------------------------------------------------------
F0P289_WEEVC      ------------------------------------------------------------
D0J9Y6_BLASP      ------------------------------------------------------------
C5J6D4_MYCCR      ------------------------------------------------------------
E0TKT7_MYCHH      ------------------------------------------------------------
E4QT51_MYCH1      ------------------------------------------------------------
RNC_MYCMO         ------------------------------------------------------------
Q98R47_MYCPU      ------------------------------------------------------------
RNC_UREPA         ------------------------------------------------------------
Q8EW40_MYCPE      ------------------------------------------------------------
RNC_MYCS5         ------------------------------------------------------------
D5E4P5_MYCCM      ------------------------------------------------------------
RNC_ACIBT         ------------------------------------------------------------
RNC_PSYA2         ------------------------------------------------------------
RNC_FRAP2         ------------------------------------------------------------
RNC_AZOVD         ------------------------------------------------------------
RNC_MARMS         ------------------------------------------------------------
RNC_ALCBS         ------------------------------------------------------------
RNC_LEGPC         ------------------------------------------------------------
RNC_COXBU         ------------------------------------------------------------
RNC_BUCAI         ------------------------------------------------------------
RNC_ECOLI         ------------------------------------------------------------
RNC_BLOFL         ------------------------------------------------------------
RNC_WIGBR         ------------------------------------------------------------
RNC_COLP3         KLANPRHTKSNPSSSSKKSSTRK-------------------------------------
RNC_PSYIN         ------------------------------------------------------------
RNC_IDILO         ------------------------------------------------------------
RNC_HAEIN         ------------------------------------------------------------
RNC_ALKEH         ------------------------------------------------------------
RNC_NITOC         ------------------------------------------------------------
RNC_METCA         ------------------------------------------------------------
RNC_XYLFA         ------------------------------------------------------------
RNC_AROAE         ------------------------------------------------------------
RNC_BORBR         ------------------------------------------------------------
RNC_THIDA         ------------------------------------------------------------
RNC_DECAR         ------------------------------------------------------------
RNC_NITEU         ------------------------------------------------------------
RNC_RHOFT         ------------------------------------------------------------
RNC_VEREI         ------------------------------------------------------------
RNC_NEIG1         ------------------------------------------------------------
RNC_AGRRK         ------------------------------------------------------------
RNC_BRUAB         ------------------------------------------------------------
RNC_METSB         ------------------------------------------------------------
RNC_RHOPA         ------------------------------------------------------------
RNC_DINSH         ------------------------------------------------------------
RNC_SPHAL         ------------------------------------------------------------
RNC_ZYMMO         ------------------------------------------------------------
RNC_CAUSK         ------------------------------------------------------------
RNC_PHEZH         ------------------------------------------------------------
RNC_ANAMF         ------------------------------------------------------------
RNC_ANAPZ         ------------------------------------------------------------
RNC_EHRRG         ------------------------------------------------------------
RNC_WOLTR         ------------------------------------------------------------
RNC_RICAE         ------------------------------------------------------------
RNC_AQUAE         ------------------------------------------------------------
RNC_HYDS0         ------------------------------------------------------------
RNC_PELUB         ------------------------------------------------------------
RNC_CARHZ         ------------------------------------------------------------
RNC_DEHM1         ------------------------------------------------------------
RNC_BDEBA         ------------------------------------------------------------
RNC_CAMFF         ------------------------------------------------------------
RNC_CAMJD         ------------------------------------------------------------
RNC_HELHP         ------------------------------------------------------------
RNC_WOLSU         ------------------------------------------------------------
RNC_HELPY         ------------------------------------------------------------
RNC_SYNFM         ------------------------------------------------------------
RNC_GEOMG         ------------------------------------------------------------
RNC_GEOSL         ------------------------------------------------------------
RNC_PELCD         ------------------------------------------------------------
RNC_MAGMM         ------------------------------------------------------------
RNC_MYXXD         ------------------------------------------------------------
RNC_BORBU         ------------------------------------------------------------
RNC_LEPBJ         ------------------------------------------------------------
RNC_TREDE         ------------------------------------------------------------
RNC_TREPA         ------------------------------------------------------------
RNC_FUSNN         ------------------------------------------------------------
RNC_SOLUE         ------------------------------------------------------------
RNC_PSELT         ------------------------------------------------------------
RNC_THEMA         ------------------------------------------------------------
RNC_DESPS         ------------------------------------------------------------
RNC_DESVH         ------------------------------------------------------------
RNC_BACHD         ------------------------------------------------------------
RNC_LISIN         ------------------------------------------------------------
RNC_LACRD         ------------------------------------------------------------
RNC_LACSS         ------------------------------------------------------------
RNC_ENTFA         ------------------------------------------------------------
RNC_STAES         ------------------------------------------------------------
RNC_LACAC         ------------------------------------------------------------
RNC_LEUMM         ------------------------------------------------------------
RNC_LACLM         ------------------------------------------------------------
RNC_STRT2         ------------------------------------------------------------
RNC_MESFL         ------------------------------------------------------------
RNC_MYCCT         ------------------------------------------------------------
RNC_SPICI         ------------------------------------------------------------
RNC_CLOK5         ------------------------------------------------------------
RNC_CLOPE         ------------------------------------------------------------
RNC_CLOAB         ------------------------------------------------------------
RNC_CALS4         ------------------------------------------------------------
E6UF22_RUMA7      ------------------------------------------------------------
RNC_NATTJ         ------------------------------------------------------------
RNC_DESRM         ------------------------------------------------------------
RNC_PELTS         ------------------------------------------------------------
RNC_HELMI         ------------------------------------------------------------
RNC_MOOTA         ------------------------------------------------------------
RNC_SYNWW         ------------------------------------------------------------
RNC_RHOBA         ------------------------------------------------------------
RNC_SYMTH         ------------------------------------------------------------
RNC1_NOSS1        ------------------------------------------------------------
RNC1_SYNY3        ------------------------------------------------------------
RNC_CHLSY         ------------------------------------------------------------
RNC_ROSS1         ------------------------------------------------------------
RNC_CORDI         ------------------------------------------------------------
RNC_CORJK         ------------------------------------------------------------
RNC_MYCBO         ------------------------------------------------------------
RNC_STRAW         ------------------------------------------------------------
RNC_LEIXX         ------------------------------------------------------------
RNC_BIFLO         ------------------------------------------------------------
RNC_TROW8         ------------------------------------------------------------
RNC_CHLPN         ------------------------------------------------------------
RNC_PARUW         ------------------------------------------------------------
RNC_CHLTE         ------------------------------------------------------------
RNC_PELLD         ------------------------------------------------------------
RNC_CHLCH         ------------------------------------------------------------
RNC2_SYNY3        ------------------------------------------------------------
RNC2_NOSS1        ------------------------------------------------------------
RNC_GLOVI         ------------------------------------------------------------
RNC_PROMA         ------------------------------------------------------------
A9BD45_PROM4      ------------------------------------------------------------
Q7V4K2_PROMM      ------------------------------------------------------------
Q46IK9_PROMT      ------------------------------------------------------------
A4CTC0_SYNPV      ------------------------------------------------------------
Q0IDN5_SYNS3      ------------------------------------------------------------
Q3ANA7_SYNSC      ------------------------------------------------------------
A5GQ81_SYNR3      ------------------------------------------------------------
RNC_ONYPE         ------------------------------------------------------------
Q1AW81_RUBXD      ------------------------------------------------------------
B3PN90_MYCA5      ------------------------------------------------------------
D1J8Q7_MYCHP      ------------------------------------------------------------
E8ZGH5_MYCHL      ------------------------------------------------------------
RNC_MYCPN         ------------------------------------------------------------
RNC_TRES6         GNPIWNCKAILEGYGTFEADNASKKQVKQDASLKLLKFIAKTKIEQTEKWEIPTFYHGMA
RNC_ROSHA         FKETHDEDGNPVWNCKCSIKEKDTVTNGRSSSKKDAKKQAAYDMLTFVLEEE--------
                                                                              

RNC_BACTN         --------------
D9RT83_PREMB      EAIIAAAEAEAFEN
RNC_AZOPC         --------------
E4T6E6_PALPW      --------------
E4TVQ3_MARTH      --------------
B3ETI2_AMOA5      --------------
C7PEN8_CHIPD      --------------
E4TC94_RIEAD      --------------
C6X2R2_FLAB3      --------------
A3XQM1_LEEBM      --------------
RNC_FLAPJ         --------------
F0P289_WEEVC      --------------
D0J9Y6_BLASP      --------------
C5J6D4_MYCCR      --------------
E0TKT7_MYCHH      --------------
E4QT51_MYCH1      --------------
RNC_MYCMO         --------------
Q98R47_MYCPU      --------------
RNC_UREPA         --------------
Q8EW40_MYCPE      --------------
RNC_MYCS5         --------------
D5E4P5_MYCCM      --------------
RNC_ACIBT         --------------
RNC_PSYA2         --------------
RNC_FRAP2         --------------
RNC_AZOVD         --------------
RNC_MARMS         --------------
RNC_ALCBS         --------------
RNC_LEGPC         --------------
RNC_COXBU         --------------
RNC_BUCAI         --------------
RNC_ECOLI         --------------
RNC_BLOFL         --------------
RNC_WIGBR         --------------
RNC_COLP3         --------------
RNC_PSYIN         --------------
RNC_IDILO         --------------
RNC_HAEIN         --------------
RNC_ALKEH         --------------
RNC_NITOC         --------------
RNC_METCA         --------------
RNC_XYLFA         --------------
RNC_AROAE         --------------
RNC_BORBR         --------------
RNC_THIDA         --------------
RNC_DECAR         --------------
RNC_NITEU         --------------
RNC_RHOFT         --------------
RNC_VEREI         --------------
RNC_NEIG1         --------------
RNC_AGRRK         --------------
RNC_BRUAB         --------------
RNC_METSB         --------------
RNC_RHOPA         --------------
RNC_DINSH         --------------
RNC_SPHAL         --------------
RNC_ZYMMO         --------------
RNC_CAUSK         --------------
RNC_PHEZH         --------------
RNC_ANAMF         --------------
RNC_ANAPZ         --------------
RNC_EHRRG         --------------
RNC_WOLTR         --------------
RNC_RICAE         --------------
RNC_AQUAE         --------------
RNC_HYDS0         --------------
RNC_PELUB         --------------
RNC_CARHZ         --------------
RNC_DEHM1         --------------
RNC_BDEBA         --------------
RNC_CAMFF         --------------
RNC_CAMJD         --------------
RNC_HELHP         --------------
RNC_WOLSU         --------------
RNC_HELPY         --------------
RNC_SYNFM         --------------
RNC_GEOMG         --------------
RNC_GEOSL         --------------
RNC_PELCD         --------------
RNC_MAGMM         --------------
RNC_MYXXD         --------------
RNC_BORBU         --------------
RNC_LEPBJ         --------------
RNC_TREDE         --------------
RNC_TREPA         --------------
RNC_FUSNN         --------------
RNC_SOLUE         --------------
RNC_PSELT         --------------
RNC_THEMA         --------------
RNC_DESPS         --------------
RNC_DESVH         --------------
RNC_BACHD         --------------
RNC_LISIN         --------------
RNC_LACRD         --------------
RNC_LACSS         --------------
RNC_ENTFA         --------------
RNC_STAES         --------------
RNC_LACAC         --------------
RNC_LEUMM         --------------
RNC_LACLM         --------------
RNC_STRT2         --------------
RNC_MESFL         --------------
RNC_MYCCT         --------------
RNC_SPICI         --------------
RNC_CLOK5         --------------
RNC_CLOPE         --------------
RNC_CLOAB         --------------
RNC_CALS4         --------------
E6UF22_RUMA7      --------------
RNC_NATTJ         --------------
RNC_DESRM         --------------
RNC_PELTS         --------------
RNC_HELMI         --------------
RNC_MOOTA         --------------
RNC_SYNWW         --------------
RNC_RHOBA         --------------
RNC_SYMTH         --------------
RNC1_NOSS1        --------------
RNC1_SYNY3        --------------
RNC_CHLSY         --------------
RNC_ROSS1         --------------
RNC_CORDI         --------------
RNC_CORJK         --------------
RNC_MYCBO         --------------
RNC_STRAW         --------------
RNC_LEIXX         --------------
RNC_BIFLO         --------------
RNC_TROW8         --------------
RNC_CHLPN         --------------
RNC_PARUW         --------------
RNC_CHLTE         --------------
RNC_PELLD         --------------
RNC_CHLCH         --------------
RNC2_SYNY3        --------------
RNC2_NOSS1        --------------
RNC_GLOVI         --------------
RNC_PROMA         --------------
A9BD45_PROM4      --------------
Q7V4K2_PROMM      --------------
Q46IK9_PROMT      --------------
A4CTC0_SYNPV      --------------
Q0IDN5_SYNS3      --------------
Q3ANA7_SYNSC      --------------
A5GQ81_SYNR3      --------------
RNC_ONYPE         --------------
Q1AW81_RUBXD      --------------
B3PN90_MYCA5      --------------
D1J8Q7_MYCHP      --------------
E8ZGH5_MYCHL      --------------
RNC_MYCPN         --------------
RNC_TRES6         RIWHDEGKI-----
RNC_ROSHA         --------------