CLUSTAL format seed alignment for MF_00105

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

GREA_RHILV        --------MVEKVPMTPGGFVKLQEELRWRQQEERPRIIEAIAEARAHGDLSENAEYHAA
GREA_RHIME        --------MVDKVPMTQGGFVNLQEELRWRQQEERPRIIEAIAEARAHGDLSENAEYHAA
GREA_AGRFC        --------MVEKVPMTQGGFVKLQEELRFRQQEERPRIIEAIAEARAHGDLSENAEYHAA
GREA_RHILO        ---------MNKVPMTGEGFASLKEELRWRQQEERPRIIEAISEARSHGDLSENAEYHAA
GREA_BRUME        ---------MEKFPMTPRGFEKLKEELRWRQQSERPRIIEAIAEARAHGDLSENAEYHAA
GREA_CAUVC        ---------MEKVPMTVAGYQTLDEELKRLKTVERPAVIAAIAEARSHGDLSENAEYHAA
GREA_RICCN        --------MNTKFPITAKGFEKLEHELKHLKHVERKKISADIAEAREHGDLSENAEYEAA
GREA_RICPR        --------MNTKFPITAKGFKKLEHELKHLKHVERKKISEDIAEAREHGDLSENAEYEAA
GREA_BUCAI        --------MINLIPMTVRGAEKLRRELKKLKSINRPRIIAAIAEAREHGDLKENAEYHSA
GREA_BUCAP        --------MINLIPMTVRGAEKLREELEQLKNVKRPRITVQIAEARKHGDLKENAEYHSA
GREA_ECOLI        ---------MQAIPMTLRGAEKLREELDFLKSVRRPEIIAAIAEAREHGDLKENAEYHAA
GREA_SALTY        ---------MQAIPMTLRGAEKLREELDFLKSVRRPEIIAAIAEAREHGDLKENAEYHAA
GREA_YERPE        ---------MKQIPMTVRGADKLREELDYLKGVRRPKIISDIADAREHGDLKENAEYHAA
GREA_HAEIN        ---------MQQIPMTVRGAEQLREELDFLKNVRRPEIIKAIAEAREHGDLKENAEYHAA
GREA_PASMU        ---------MKQIPMTIRGAEQLKQELDFLKNTRRPEIINAIAEAREHGDLKENAEYHAA
GREA_PSEAE        ---------MSKFPMTVQGARALEEEVKHLKGVLRPQISQAIAEARELGDLKENAEYHAA
GREA_VIBCH        ---------MEKVPMTARGEKLLREELDRLLK-LRPKITEAIAEARELGDLKENAEYHAA
GREA_NEIMA        ---------MQKIPLTVRGAELLKQELQQLKSVARPEVIEAIAEARSHGDLSENAEYEAA
GREA_NEIMB        ---------MQKIPLTVRGAELLKQELQQLKSVARPEVIEAIAEARSHGDLSENAEYEAA
GREA_RALSO        ---------MSTIPITKRGAEMLKDELQRLKTKERPAVVNAIAEARAQGDLSENADYDAA
GREA_XANAC        ----------MRAPMTSKGAQRLREELEHLKSVKRPEVINAIAEARAHGDLKENAEYHAA
GREA_XANCP        ----------MRAPMTSKGAQRLREELDHLKSVKRPAVITAIAEARAHGDLKENAEYHAA
GREA_XYLFA        ----------MRAPMTLKGVRRLRDELEHLKSVKRPEIINAIAEARAHGDLKENAEYHAA
GREA_ZYMMO        ------MAAQEKIPMLIEGQQMLMDELARLHA-ERPKIIDAIEEARAHGDLSENAEYHAA
GREA_CAMJE        ---------MQKEPMSQFGYDKLAAELKDLKDNQRPAVVIEIDTARSHGDLKENAEYHAA
GREA_HELPY        ---------MNKEPMSMHGYNKICAELKQLKEVERPNIVKEIDIARGHGDLKENAEYHAA
I0IAS9_PHYMF      -----------MEFITPEDQSRIQARLDELHHN-RTDIKERIAAAREQGDLKENAEYHAM
B0VIH5_CLOAI      --------MDLSQFITKTGMQRLQKRINELLAE-RPEVIKAVAIAREFGDLSENAEYKAA
Q01RT9_SOLUE      -----------MTDIKKKLQDEITALEYELHV----DLPKEILKARLHGDLKENAEYHAA
GREA_RHOBA        --------MVESVPMTREGYNKIKAEINRMENEEMPMIVQKIAEAREEGDLKENAEYHAQ
GREA_AMOA5        --------MEKVSYYTEEGLQRLKGELTQLKSEGRAKVAEQLSEARDKGDLSENAEYDAA
GREA_FLAPJ        --------MSTVSYYTAEGLKKLKDELEQLKAIERPKASADIAEARDKGDLSENAEYDAA
GREA_CHLTE        --------MSDRIYLTRDGYNRLKEELHLLMTETRKEVLEKIAEARSHGDLSENAEYDAA
GREA_DEHM1        --------MVEKIPMTASGYKKLEDELSTLKVK-RIDVIEEMRLAAMDKDMRENAPYHAA
GREB_ECOLI        ---------MKTPLVTREGYEKLKQELNYLWREERPEVTKKVTWAASLGDRSENADYQYN
GREB_ECOL6        ---------MKTPLVTREGYEKLKQELNYLWREERPEVTKKVTWAASLGDRSENADYQYN
GREB_SALTI        ---------MKTPLITREGYETLKQELNYLWREERPEVTKKVTWAASLGDRSENADYQYN
GREB_SALTY        ---------MKTPLITREGYETLKQELNYLWREERPEVTKKVTWAASLGDRSENADYQYN
GREB_PSEPK        ---------MSTNIITTEGHEALKKELDHLWRVYRPEITQKVAWAASLGDRSENADYQYN
GREB_VIBCH        ---------MKTKLITRAGYNKLKQELDYLWKEQRPEITQKVSWAASLGDRSENADYTYN
GREB_VIBVU        ---------MKTKMITREGYNKLKQELDYLWKEHRPEITQKVSWAASLGDRSENADYTYN
GREB_HAEIN        --------MAKSNYITRQGWLALDQELKFLWKEERPKVTQAVSDAAALGDRSENAEYIYG
GREB_PASMU        --------MAKSNYITRSGWNALDQELKFLWKDERPKVTQAVSDAAALGDRSENAEYIYG
GREB_YERPE        --------MAKSNYITREGWQALDRELHYLWREERPVVTQAVSEAAAMGDRSENAEYIYG
GREB_XANAC        MSRWRPPAEKSTALITPEGHARLKAELDDLWRVRRPEVVRALAAAAAEGDRSENAEYTYR
GREB_XANCP        MSRWRPPAEKSTALITPEGHARLKAELDELWRLRRPEVVRALAAAAAEGDRSENAEYTYR
GREB_PSEAE        MSRYRPPRTAGTPLITPEGAARLRAELHELWHVRRPQVTQAVSEAAALGDRSENAEYIYG
GREB_NEIMA        ------MSTETKNYITPAGWQALKDELYQLVNKERPEIVQIVNWAAGNGDRSENGDYLYG
GREA1_LACPL       -------MEPTFNKMTAAGYHAIEQEIEDLKQQ-RPERIRILAAAAALGDRSENAEYSSA
Q03CI7_LACP3      --------MVTYHEITPTGLANLKQEVEDLKTI-RPAKIKNLADAAALGDRSENAEYSAA
E4SKG7_LACAR      --------MVYFQKMTPEGYKQIEDEIARLKKG-RPRRIKILQAACALGDLSENTEYTEA
C4ZAT8_AGARV      ----------MHDELTANDIKKMEDEIEYRKLVVRKKALDDVKVARAQGDLSENFEYKAA
A6LRF4_CLOB8      ----------MNNILTEENIKKLREELDYRMTVKRAEIAKEKLVAAAHGDRSENAEYKEA
GREA_MYCLE        ------MTDTQVTWLTQESHDRLKAELDQLIA-NRPVIAAEINDRREEGDLRENGGYHAA
GREA_MYCTU        ------MTDTQVTWLTQESHDRLKAELDQLIA-NRPVIAAEINDRREEGDLRENGGYHAA
GREA_MYCA9        ------MTDTQVTWLTQESHDRLKAELDQLIA-NRPVIAAEINERREEGDLRENGGYHAA
GREA_MYCS2        ------MTDTQVTWLTQEAFDRLKAELDQLIA-NRPVIAAEINDRREEGDLRENGGYHAA
GREA_MYCVP        ------MTDTQVTWLTEESYDRLKAELDQLIA-NRPVIAAEINDRREEGDLRENGGYHAA
GREA_RHOE4        ------MTETQVTWLTQESHDRLKNELDQLIA-NRPVIAAEINERREEGDLKENGGYHAA
GREA_SACEN        ------MSETQVTWLTQDAFDRLKSELDELVG-NRPVIAAKINEAREEGDLKENGGYHAA
A8M3L1_SALAI      ---MSTGNEAPATWLSQEAYDRLQAELDGLIA-NRPVIAAEINARREEGDLRENGGYHAA
GREA_STRCO        ----MTQTSENVTWLTQEAYNKLKEELEYLTGPARTEISAKIAAAREEGDLRENGGYHAA
GREA_STRAW        ----MTQTSENVTWLTQEAYNQLKAELEYLSGPARTEIAAKIAAAREEGDLRENGGYHAA
C5C996_MICLC      ----MTTSQSDAPWLTQEAYDRLSKELEHISGPGRQEIIERIEAARDEGDLKENGGYHAA
E4V910_BIFBI      ------MGEEKSVLLTQEAFDTLKDELAHRQGQYREEITKRIAAARAEGDLSENGGYQAA
GREA_BACSU        ------MAQEKVFPMTAEGKQKLEQELEYLKTVKRKEVVERIKIARSFGDLSENSEYDSA
GREA_LISMO        ------MATEKVFPMTLDGKAKLENELQELKTVKRKEVVERIKIARSFGDLSENSEYDSA
GREA_ALKHC        ------MAEEKKHYMTLEGKKKLEEELEYLKTERRKEVVERIKIARSFGDLSENSEYDSA
GREA_STAAM        ------MENQKQYPMTQEGFEKLERELEELKTVKRPEVVEKIKVARSFGDLSENSEYDAA
GREA_STRPN        -------MAEKTYPMTLEEKEKLEKELEELKLVRRPEVVERIKIARSYGDLSENSEYEAA
GREA_STRP1        -------MAEKTYPMTLTEKEQLEKELEELKLVRRPEIVERIKIARSYGDLSENSEYDAA
GREA_LACLA        --------MEKTFPMTQEGLDKLKLELENLKLVKRPEVIDRIKVARSYGDLSENSEYEAA
GREA_CLOAB        ------MSQEKKYVITYKGVKKLEEELEYLKTTKRKEITEKIKVALSFGDLSENSEYDEA
GREA_CLOPE        ------MS-EKKHIMTYEGVKKLEDELEYLKTVKRKEITEKIKVALGYGDLSENSEYDEA
GREA_CALS4        ------MS--KPVILTYEGLKKLEEELEYLKTVKRAEVAEKIKQARAFGDLSENSEYDEA
GREA_ROSS1        -------MSDKPAYLTRDGRARLEAELEELVTKGRKEIAERINAAKELGDISESGEYEDA
GREA_ROSCS        -------MSDKPAYLTRDGRARLEAELEELVTKGRKEIAERINAAKELGDISESGEYEDA
GREA_CHLSY        -------MTEKPTYLTREGRARLEAELEYLTTVERKQIAERIAAAKELGDISESGEYEDA
GREA_THERP        -------MARERIPITREGLEALRQEYEYLVKHRRPEIARVIQEAREHGDIRENAAYDAA
GREA_THEMA        ---------MKKVRLTREGYEKLKKELEDLKRKFMYEISERIKEARELGDLSENSEYEAA
GREA_PETMO        -------MAEQVYQLTREGYEKLKREREELKKRLMGEVAERIKEARELGDLSENSEYEEA
GREA_MYCGE        -------MELNKNYLTQEGFKQLEKELENLIQVKRPEIIRLLQEARDQGDLSENADYDAA
GREA_MYCPN        -------MELNKNYLTEEGLKQLEAELEHLIQVKRPAIIKLLQEARDQGDLSENADYDAA
GREA_UREPA        ---------MAKYTISKHRLEELQLELREILDVKWPAITKQLQDAREQGDLSENADYDAA
GREA_MESFL        --------MAKEIILTQEGIEELKHELKHLLEVVRPQVIEELVEARNQGDLSENADYDAA
GREA_MYCCT        --------MSKEIILTQEGLEELKAELKNLLEVTRPKVIEELVEARNQGDLSENADYDAA
GREA_ACHLI        ------MASKKVYELTQSGLDQLKDELTHLKDVKRVENLEALKEAREQGDLSENADYDAA
GREA_MYCPU        -----MEEKN-KIYLTQETIKKYEEEKWHLINVERPAVILEIKEARQQGDLSENAEYDAA
GREA_MYCA5        -----MPNKEEKIYLTADSFKQYQERLQYLQEVLRPQVIEEIKEARNQGDLSENAEYDAA
GREA_TREPA        ------MVSGRGLVVTAKMLNAKKKELQDLLDVRIPENSREIGRALELGDLRENAEYKAA
GREA_BORBU        -------<MEIGFLTILSSLNKKQKELKYLKEVEIPENSKEIGKARELGDLKENAEYHSA
GREA_CHLTR        --------<ENILWTTSDSFTRMKNKLQSLVGKEMVENAKEIEDARALGDLRENSEYKIA
GREA_CHLMU        --------<ENILWTTSESFTRMKAKLQSLIGKEMVDNAKEIEDARALGDLRENSEYKFA
GREA_CHLPN        --------<ENVLWSTSESFSRMKAKLQSLVGKEMVDNAKEIEDARSLGDLRENSEYKFA
                                                                   *  *.  *   

GREA_RHILV        KEAQSHNEGRISELEDLTARAEVIDLTKMSGD-KIKFGAKVKLID-EDTEEEKTYQIVGD
GREA_RHIME        KEAQSHNEGRISELEDLIARAEVIDLSKMSGS-KIKFGARVKLVD-EDTEEEKTYQIVGD
GREA_AGRFC        KEAQSHNEGRITELEDLTARAEVIDLSKMSGS-KIKFGATVKLID-EDSDEEKTYQIVGD
GREA_RHILO        KEAQSLNEGRVNELEDLIARAEVIDVTKLSGD-KVKFGATVVLVD-EDTEEKKTYQIVGD
GREA_BRUME        KEAQSLNEGRINELEDLVARAEVIDVSKLTGD-RIKFGATVTMID-EDTEEEKIYQIVGD
GREA_CAUVC        KERQGWIEGQIAEIEDKIARAQVIDVTKLSGK-QVKFGATVSVVD-EDTEEEARYQIVGD
GREA_RICCN        REKQAFIEGRIKELEDMTARAEIIDIGKLSGD-NIKFGATVTLID-DDTEEEVTYIIVGE
GREA_RICPR        REKQAFIEGRIKELEDMTARAEIIDICKLSGD-NIKFGATVTLID-DDTEEEVTYIIVGE
GREA_BUCAI        REEQSFCEGRIKEIELKLSNSQIIDVTKISNNGRVIFGSTVSILN-IKNNEKFTYRIVGD
GREA_BUCAP        REEQSFCEGRIQEIESKLSNSQIIDITKISNDGRVVFGSTVTILN-IKNNAVFTYQIVGD
GREA_ECOLI        REQQGFCEGRIKDIEAKLSNAQVIDVTKMPNNGRVIFGATVTVLN-LDSDEEQTYRIVGD
GREA_SALTY        REQQGFCEGRIKDIEAKLSNAQVIDVTKMPNNGRVIFGATVTVLN-LDTDEEQTYRIVGD
GREA_YERPE        REQQGFCEGRIQEIEAKLSNAQVIDITKMPNNGRVIFGATVRVLN-LNTEEEQNYRIVGD
GREA_HAEIN        REQQGFCEGRIQEIEGKLGNAQIIDVSKMPNNGKVIFGATVVLVN-TNTDEEVTYRIVGD
GREA_PASMU        REQQGFCEGRIQEIEGKLANSQIIDVTKIPNNGKVIFGATILLLN-IDTEEEVSYQIVGD
GREA_PSEAE        REQQGMVEARIRDIEAKLSNAQVIDVTAIPHSGKVIFGTTVDIAN-VETDETVTYQIVGD
GREA_VIBCH        REEQGICEAQIRDIEYKLSVAQVIDVTKMENSGKVIFGATVTVID-VNSDEEKTYQIVGD
GREA_NEIMA        KERQGFIEGRISELEHKLSVAHIINPTEIHAEGKIVFGTTVTLED-LETEEHVTYQIVGE
GREA_NEIMB        KERQGFIEGRISELEHKLSVAHIINPTEIHAEGKIVFGTTVTLED-LETEEHVIYQIVGE
GREA_RALSO        KERQGFIEGRILEIESKLAAAQVIDPAGLDADGRIVFGATIDLED-LDSGKPVTYQIVGD
GREA_XANAC        REQQSFIEGRIKQLESELSHAEIIDITKLSAGTKIVFGATVTLAD-TETDEEKRYQIVGD
GREA_XANCP        REQQSFIEGRIKQLEGELSHAEIIDITKLAAGTKIVFGATVTLAD-TETDEEKRYQIVGD
GREA_XYLFA        REQQSFIEGRIKQLEGELSHAEVIDVAKLNAGTKIVFGATVTLVD-LETDEESRYQIVGD
GREA_ZYMMO        KERQGQVEAMIGDIEGKLSRALVIDPKTLSGD-KVIFGATVHLLD-ED-DKPVKYQIVGQ
GREA_CAMJE        REKQALIESRIAELSDLLARAQVIDPSSYEHD-SVKFGSSVVIMD-LDTEKESKYTLVGI
GREA_HELPY        KEKQRFIEARIVDLSEIVANAQVIDPSALAHN-KVSFGSTIKILN-LDNDKEFSYTIVGS
I0IAS9_PHYMF      RERQGMEEAEIKRLEEKLQNAQVTDNVEKPDD-MVFLGSVVVLKD-LSDDSSDLYKLVGT
B0VIH5_CLOAI      RERQRAIDNEIDYLRRRSANLKVIDTSEFPKD-MVRFGTYCVAED-INTKECICYHLVGP
Q01RT9_SOLUE      KDRQGFVSARLGQLKSRLGQLAMIDFTKIPRD-KAGLGSTVVVLD-VKSDQEITYHLVTS
GREA_RHOBA        RENQGMLMAKINELRDKIARASIIDVSSLPKD-EVVFGCTVTVED-VAYGDEEQFTLVGA
GREA_AMOA5        KEAQEILERRIAKLEELMINARVINKDNINTS-AVSILSKVKIKN-KKLGKVSTYTMVSE
GREA_FLAPJ        KEAQGLLELKIKKMEEVYSNARLIDESQLDVS-KALVLSHVKIKN-QSNGMEMSYHLVAE
GREA_CHLTE        REEQSQLEAKIGEIENKLASATILDPKQIKTD-RVYILTSVKLRNLDAEDEIIEYTLVSS
GREA_DEHM1        KEQRGQIEGRIKEIEHELKYADVSEYTDTNTS-KVNMGSTVKLRD-PKNGECCTYTLVSP
GREB_ECOLI        KKRLREIDRRVRYLTKCLENLKIVDYSPQ-QE-GKVFFGAWVEIENDD-GVTHRFRIVGY
GREB_ECOL6        KKRLREIDRRVRYLTKCMENLKIVDYSPQ-QE-GKVFFGAWVEIENDD-GVTHRFRIVGY
GREB_SALTI        KKRLREIDRRVRYLTKCMENLKIVDYSPQ-QE-GKVFFGAWVEIENDD-GDTLKFRIVGY
GREB_SALTY        KKRLREIDRRVRYLTKCMENLKIVDYSPQ-QE-GKVFFGAWVEIENDD-GDRLKFRIVGY
GREB_PSEPK        KKLLREIDRRVRYLRKRLEDVKVVAYSPE-QE-GKVFFGAWVEIENDE-GETMKFRIVGY
GREB_VIBCH        KRLLRQIDRRVRFLSKLLPELKIVDYSPQ-QE-GKVFFGAWVEIENEA-GEVKKFRIVGP
GREB_VIBVU        KRLLRQIDRRVRFLSKFLPEVKIVDYAPQ-QE-GKVFFGAWVEIENEA-GEVMKFRIVGP
GREB_HAEIN        KRRLREIDRRVRFLTKRLEVLQIVDYNPK-QE-GKVFFGAWVELENEE-GETKQYRIVGC
GREB_PASMU        KRRLREIDRRVRFLTKRLEVLQIVDYHPK-QE-GKVFFGAWVALENEA-GEEKHYRIVGC
GREB_YERPE        KKRLREIDRRVRFLAKRLEVLKIVDPDPR-QE-GKVFFGAWVRVENEQ-EEQRIFRLVGP
GREB_XANAC        KKQLGEIDRRVRYLSKRLEALRVVDTAPT-DA-NAVFFGAQVELEDAGSGELLRYRIVGP
GREB_XANCP        KKQLGEIDRRVRYLSKRLEALRVVDTAPT-DP-QAVFFGAQVELEDADSGELLRYRIVGP
GREB_PSEAE        KKMLREIDSRVRFLRKRLENLKVVGERPA-DP-NRVYFGAWVTLEDED-GEQARYRIVGP
GREB_NEIMA        KRRMREIDRRIRFLTKRLEAAVVVDPELR-EATDQVFFGATVGLLRGD-GREQTVKIVGI
GREA1_LACPL       KRDLGRLESRLRYLNKQLQYAQIVQPADN-DQ---LDIGKFVTIEFLDDHDQITYQLVGK
Q03CI7_LACP3      KRELRQLEGRLRYLDKLIRYAKVTHPAAS-DI---ADIGNRITLKFDDDEDHATYELVGP
E4SKG7_LACAR      KR----------YLGKQLKYTEIVETKDD-GK---VDLGKTVVLKFDDDEDTEEYKIVGR
C4ZAT8_AGARV      KQFKNQNESRIRYLEKMIKTAVVISDESK-DD-EV-GMFNTVDVYFEDDDETETYKIVTT
A6LRF4_CLOB8      CRNYRENDNRIQYLLTMISTATVIDDGSI-DK-SVLGINSKARIRFVEDDDEVVVTLVTT
GREA_MYCLE        REEQGQQEARIRQLQDLLNIAKVGEAPKQ-SG--VALPGSVVKVYYNDDKSDTETFLIAT
GREA_MYCTU        REEQGQQEARIRQLQDLLSNAKVGEAPKQ-SG--VALPGSVVKVYYNGDKSDSETFLIAT
GREA_MYCA9        REEQGQQEARIRQLQELLNNAKVGEAPTQ-SG--VALPGSVVKVYYDGDKGDTETFLIAT
GREA_MYCS2        REEQGQQEARIRQLQELLNNAKVGEAPKQ-SG--VALPGSVVKVYYDDDENDTETFLIAT
GREA_MYCVP        REQQGQEEARIRQLQELLNNAKVGEAPKQ-SG--IALPGSVVKVYYDDDEKDTETFLIGT
GREA_RHOE4        REEQGQQEARIRQLQELLNSAKVGEAPTQ-SG--VALPGSVVKVYYDGDESDTETFLIAT
GREA_SACEN        REEQGHLESRIRQLQELLRTAKVGDVPTE-AG--VAKPGSVLTVRYD-DEDETEKFLLAT
A8M3L1_SALAI      REEQGKAEGRILYLKELLRTAQVGEAPTA-DT--IA-PGMVVTIYFDDDKDDTERFLLGS
GREA_STRCO        KEEQGKQELRVRQLTQLLESAKVGEAPAA-DG--VVAPGMVVTIAFDGDEDDTLTFLLAS
GREA_STRAW        KEEQGKQELRVRQLTQLLENAKVGEAPAA-DG--AVAPGMVVTIAFDGDEDDTLDFLLAS
C5C996_MICLC      REEQSKNEGRIAELKHLLETARVGEAAEN-DG--AVHPGTVVTAVVAGDEMT---FLFGN
E4V910_BIFBI      REEQAKNEGRINELTVKLRNATIVEAPKA--G--KVGNGSLVTLELAGREMT---YALGS
GREA_BACSU        KEEQAFVEGRVTTLENMIRNAKIIEDDG--GSN-VVGLGKTVTFVELPDGDEESYTIVGS
GREA_LISMO        KDEQAFVEGRITTIENMIRNAQIIDAAE--AHNGLVTLGNTVTFIELPDGEEETYTIVGS
GREA_ALKHC        KEEQAFVEGRISQIEKMIRNAEIIEESE--GDANVVSLGKTVKFVEIPDGEEEEYTIVGS
GREA_STAAM        KDEQGFIEQDIQRIEHMLRNALIIEDTG--DNN-VVKIGKTVTFVELPGDEEESYQIVGS
GREA_STRPN        KDEQAFVEGQISSLETKIRYAEIVNSDA--VAQDEVAIGKTVTIQEIGEDEEEVYIIVGS
GREA_STRP1        KDEQAFVEGQISTLETKIRYAEIIDSDA--VAKDEVAIGKTVIVQEVGTTDKDTYHIVGA
GREA_LACLA        KDEQAFIEGRISTVETMIRYAEIVDNAK--IAKDEVALGKNVTFVEVGETDEESYQIVGT
GREA_CLOAB        KNDQAFVEGRIAQIENMLKNANVIDESE--LKNDVVSVGSKVMVKDYQFDEEIEFSIVGS
GREA_CLOPE        KNEQAFTEGRIIQLENMLKNAVVVDESE--ISTDIVTVGSIVKVMDFDFDEEVEYSIVGS
GREA_CALS4        KNEQAFIEGRIATLEAMLKNAKVIDEED--IKLDEVSIGCTVKVFDETYNEEVEYTIVGS
GREA_ROSS1        KNQQAHLEGRIREIKSILARAQIIDEEN--GDNHEVRIGSRVTVRIDGEDGEETWTIVGS
GREA_ROSCS        KNQQAHLEGRIREIKSILARAQIIDEEN--GSNHEVRIGSRVTVRIDGEHEEETWTIVGS
GREA_CHLSY        KKAQALLEGRIRELKHLLSRAEVIDEDQ--ASNGEVRVGSSVTVRFEDDGTEETWTIVGS
GREA_THERP        KHDQAFIEGRIREIEELLKRVELIEQPTD-GDRSVVRVGSTVTIEIDGE--IETYTIVGA
GREA_THEMA        KNEQGRVGSRIMEIEQILSNAEIIED--S-EESDEVTLGKWVVIKNLDTGEEHKFRIVTP
GREA_PETMO        KNEQGMIDSRIKEIDYILDNAEIIENGGN-HDNSTVSLGKKVKIKDYRLNREQEFVLVTP
GREA_MYCGE        KAQQGEIETRIAEIQDILANAKLISDHQAKTKVTKVSLGSTVEIYDYSSKSNEKYTIVGT
GREA_MYCPN        KAQQGEIETRIAEIQDILANVKLINESQTK-KANKVTLGSTVEIYDYSSKTHEKYTIVGA
GREA_UREPA        KNEQAALKKRKDEIEEILENYELIEDVLRS--TDEVSIGSTIEIYNYQKDCEEVITLVGS
GREA_MESFL        RNRQAEVEARIKELETMISKAKLI-EDS-STTDGAIKIGSKVKFIMLNTKQTREVKIVGA
GREA_MYCCT        RNRQAEVEARIKEVETLINRAKVI-DNSKTHSTGEVKIGSTVEFLSSLDHKTKEIKIVGA
GREA_ACHLI        RNEQARIEARILEIESILKNVKII-RTN--DDSTTVNIGKKVLLHFVEKNKDVEYHVVGT
GREA_MYCPU        REKQGQIEDRITELENILSNAISI-QESHSDKIG---LGSVVRILNQSTGKERTFKIVGS
GREA_MYCA5        RDKQATIENEITEIQHILDNYEII-KTQTNRQVSVVRIGSNVSVVSLKDDTVINFQIVGA
GREA_TREPA        REEQTRLNNMVTRLQEEIERAQVFDPTTVVAG--RVSFGTVISLKNHTSGEDETYTILGP
GREA_BORBU        KEKQQFLTKRLNSLMLEIENAKVIDTKDLQSS--VVGFGTKVVILNEVTGKDESYLILGP
GREA_CHLTR        LERRARLQEEIHVLSEEINRAKILTKDAVFTD--SVGVGCKVVLESDQ-GDKVCYTILGP
GREA_CHLMU        LERRARLQEEIRVLSEEINRAKILTKDAVFTN--SVGVGCKVVLEDEQ-GEEDCYTILGP
GREA_CHLPN        LEKRARLQEEIRVLSEEINRARILTKDLVFTD--KVGVGCKVTLKGDA-GEVVEYTILGP
                               :                                           .  

GREA_RHILV        QEADVKAGR----ISISSPIARALIGKEVGDSIEVNAPGG-SKAYEILQVSWG-------
GREA_RHIME        QEADVKQGR----ISISSPIARALIGKEVGDSIEVNAPGG-SKAYEILAVQWG-------
GREA_AGRFC        QEADVKAGR----ISISSPIARALIGKEVGDSIEVNAPGG-AKGYEILAVQWG-------
GREA_RHILO        QEADVKSGR----ISISSPIARALIGKEVGDAIEVNAPGG-ARGYEIVQVQFI-------
GREA_BRUME        QEADVKEGR----ISISSPIARALIGKGEGDTIEVNAPGG-SRSYEIIALKFV-------
GREA_CAUVC        HEADVKSGR----ISLSSPLSRAMIGKEVGEVVEVNTPGG-VKAYEILKVEWL-------
GREA_RICCN        YEADITRKR----VSIASPIAKALIGKSVGDFVEVTTPKG-SKSYEVVTVEYKELEL---
GREA_RICPR        YEADITKKR----VSIASPIAKALIGKSVGDFVEVTTPKG-LKSYEVVTVEYKELDL---
GREA_BUCAI        DESDFKKNL----ISINSPIARGLIGKEINDVVIICTPGG-DVEYKILKINYI-------
GREA_BUCAP        DESDFKKNL----ISINSPMSRGLIGKTVNTIAIIHTPSG-NVKYKILKIDYI-------
GREA_ECOLI        DEADFKQNL----ISVNSPIARGLIGKEEDDVVVIKTPGG-EVEFEVIKVEYL-------
GREA_SALTY        DEADFKQNL----ISVNSPIARGLIGKEQDDVVVIKTPGG-DVEYEVLKVEYL-------
GREA_YERPE        DEADFKQNL----ISVNSPIARGLIGKEVDDVVVIHTPGG-EVEYEILSVEYV-------
GREA_HAEIN        DEADIKSGL----ISVNSPIARGLIGKELDDTVNITTPGG-VVEFDIIEVNYI-------
GREA_PASMU        DEANIKAGL----ISVNSPIARGLIGKEVDDVVVIQTPGG-KVEFEILEVEYK-------
GREA_PSEAE        DEADIKGGK----ISVNSPIARALIGKTEGDAVLVRTPGG-DVEYEIVEVRHI-------
GREA_VIBCH        DEADIKSGR----ISVNSPIARGLIGKFEGDEVSIATPGG-NKVFEIDRVEYL-------
GREA_NEIMA        DEADIKQGK----IYVGSPIARALIGKEEGDTAEVQAPGG-VREYDIIEVRYI-------
GREA_NEIMB        DEADIKQGK----IYVGSPIARALIGKEEGDTAEVQAPGG-VREYDIIEVRYI-------
GREA_RALSO        DEADLDSGK----ISISSPIARALIGKYEGDVATVVAPGG-EREYEVRAVKYL-------
GREA_XANAC        LEADIKMGL----IAISSPLARALIGKLEGDSVTIDAPAG-QREYEVVSVAYLD------
GREA_XANCP        LEADIKLGL----IAISSPLARALIGKLEGDSVTIDAPAG-QREYEVVSVAYLD------
GREA_XYLFA        LEADIKQGL----VAISSPVARALIGKQEGDTIVIEAPAG-RREYEVVAVEYIS------
GREA_ZYMMO        TEANAKGGR----ISYNSPLGRALIGRKVDDEIEVSVPSG-DRYYLISKIEFI-------
GREA_CAMJE        CEGNLDKGY----ISIASPIAKAMLGKKEGDDFKVRLPKG-ESEFEILSINYEPLKF---
GREA_HELPY        VESDPAKGL----ISFGSPIAKSLIGKSKGDAVSIQLPNG-ESDFEILDIYYKEICFDEN
I0IAS9_PHYMF      ASGSFDADE--IEVTASSPMGEALMKARVGETVKVDLPKG-VKRFEIVEMRG--------
B0VIH5_CLOAI      EELNYYNEEGIQEVSIVSPIGKALLSKKIGEIAIVKAPIG-ERKLKIREIK---------
Q01RT9_SOLUE      EEADAPNGK----VSTTSPIGRALLGKTVGDEVKVMSPGG-VKELEILKLTTIHDIVETE
GREA_RHOBA        GDEDYDSGK----ILVTSPFGQGLVGKKVGETAEVDVPAG-KLKFKILKIEFNL------
GREA_AMOA5        EEADLKEGK----ISIESPIGKGLLGKKAGEVAIVEAPAG-KIEFEILDISF--------
GREA_FLAPJ        SEADLKTGK----ISVTSPIGKGLLGKSVGEIAEITVPNG-ILKFEVLEITRD-------
GREA_CHLTE        EEADSDLGK----ISVRSPVGRSLIGKSVGDKVTISVPKG-ELHYEILDIFVK-------
GREA_DEHM1        KEIEPLKGK----ISASSPIGKAVFNRNKGEQIEIEVPSG-TLQYIIEDISF--------
GREB_ECOLI        DEIFG---R-KDYISIDSPMARALLKKEVGDLAVVNTPAG-EASWYVNAIEYVKP-----
GREB_ECOL6        DEIFG---R-KDYISIDSPMARALLKKEVGDLAVVNTPAG-EASWYVNAIEYVKP-----
GREB_SALTI        DEIFG---R-KDYISIDSPMARALLKKEVGDLAVVNTPVG-EANWYVNAIEYVK------
GREB_SALTY        DEIFG---R-KDYISIDSPMARALLKKEVGDLAVVNTPVG-EANWYVNAIEYVK------
GREB_PSEPK        DEIYG---R-NDYISIDSPMARALLKKEEGDEVVVHTPTG-EATWYVSSIRYGQGVSTD-
GREB_VIBCH        EEIYGD--A-KDYISIDSPMARALLKKQVDEEFQVHTPTG-IKEWFINSIEYEKGEL---
GREB_VIBVU        EEIYGD--A-KGYISIDSPMARALLKKEVDDEVQVPTPSG-IKEWFINSIEYDKGE----
GREB_HAEIN        DEFAP---A-KNWISIDSPVARALIGKTLDDEVRVETPSG-FITLYVNKIWYEK------
GREB_PASMU        DEFDP---A-KNWISIDSPVARALIGKSIDDEIKVETPSG-LVILYINQIWYEK------
GREB_YERPE        DEFDP---A-KKWISIDSPVARALIGKQVDDEVTVQTPNG-EATYWILEIRYRPFDEDRP
GREB_XANAC        DETDA---G-RGWISIDSPLARALLKKRVDDEFDAHLPAG-KHTFVVVSVDYASL-----
GREB_XANCP        DETDA---G-RGWISIDSPLARALLKKRVDDEFEAQLPSG-KHTFVVVVVEYAAT-----
GREB_PSEAE        DELDL---R-NNQISIDSPLARALVGKELDAEVLVRTPAG-EKLWFVVEIEYPPAP----
GREB_NEIMA        DEIDT---A-QNKISWISPLARCLIKAREGDEVVLNTPEG-REEIEILSVEYIKID----
GREA1_LACPL       QEANL---E-QQKISFTSPIGQALANHTVDDVVTVNAPNG-AYQVKVIAVKRA-------
Q03CI7_LACP3      AEAGM---G-QDKLAINSPLGAAIRQHHAGDTVTVTAPSG-SYQVTLMNIASA-------
E4SKG7_LACAR      MEADL---A-DGKISFGSPLGQAIMKKEAGTTSTVGAPAG-EYKVTIVEVK---------
C4ZAT8_AGARV      VRGNS---L-KNLISKESPLGAAIFGHKVGDRCEVKVNDDYSYFVKIMKIQNTVDDGSDD
A6LRF4_CLOB8      MDLDP---E-NMIISIESDLGKALSGNKAGDIVEVNAPGE-KYSVEILEVL---------
GREA_MYCLE        RQEGVNEGK-LEVYSPNSPLGGALIDAKVGETRSYTVPNGNTVQVTLISAEPYHS-----
GREA_MYCTU        RQEGVSDGK-LEVYSPNSPLGGALIDAKVGETRSYTVPNGSTVSVTLVSAEPYHS-----
GREA_MYCA9        RQEGVKDGK-LEVYSPSSPLGGALIDAKVGETRSYTVPNGTEVQVTLVSAEPYHE-----
GREA_MYCS2        RQEGISDGK-LEVYSPNSPLGGALLDAKVGESRTYTVPSGNVVKVTLVSAEPYQG-----
GREA_MYCVP        REQGVSDGK-LEVYSPNSPLGGALIDAKVGESRSYTVPSGNTVKVTLVSAEPYHG-----
GREA_RHOE4        REEGARDAK-LEVYSPNSPLGGALLEAKVGDTREYNLPNGSTMKVTLLSAEPYHS-----
GREA_SACEN        REEGAH-GD-LEVYSPSSPLGQALLDAKEGETREYELPNGGTMKVTLVKAEPFTG-----
A8M3L1_SALAI      R-EIASTTD-LTVYSPESAIGQAILGCRSGQTCTYTAPSGADIKVTVVAFEPFSG-----
GREA_STRCO        REYASS--D-IETYSPQSPLGSGVLGHKVGDDAQYELPNGKPASVRILKAEPYNG-----
GREA_STRAW        REYASA--D-IETYSPQSPLGSGVNGKKVGEDAQYELPNGKLASVKILKAEPYQG-----
C5C996_MICLC      REIAADDES-LEVYSERSPLGEAINGAKQGDKVSYTAPNGKDIKVEIKDVQPYSG-----
E4V910_BIFBI      RDIKVA-TK-YDVISPESPIGAAILGANEGDTVSYKAPNGREISVVIKEAKPLS------
GREA_BACSU        AEADPF----EGKISNDSPIAKSLLGKKVDEEVTVQTP-GGEMLVKIVKIS---------
GREA_LISMO        AEADPF----EGKISNDSPIAKGLLGHKEGEEVTIQTP-AGDMSVKIEKITAS-------
GREA_ALKHC        AESDPF----EGKISNDSPMAQSLLGHTIDDVVIVNTP-GGEMEVKILEIR---------
GREA_STAAM        AESDAF----NGKISNESPMAKALIGKGLDDEVRVPLPNGGEMNVKIVNIQ---------
GREA_STRPN        AGADAF----VGKVSNESPIGQALIGKKTGDTATIETP-VGSYDVKILKVEKTA------
GREA_STRP1        AGADIF----SGKISNESPIAQALIGKKTGDKVRIESP-AATYDVEIISVEKTN------
GREA_LACLA        AEADPF----SGKISNESPIARVLIGKKVGDIVNVPLP-VGEMTVKIVKVD---------
GREA_CLOAB        AEADPI----ENKISNESPVGSALIGKKVGDEIEVNVP-DGVDKYKILAIK---------
GREA_CLOPE        AEADPM----NFKISNESPVGEGLMGKKVGDVVEIEVP-GGTTKFEVLGIRR--------
GREA_CALS4        AEADPM----NNKISDESPIGKALLGKKVGETISVEVP-AGVIKLKILEIRR--------
GREA_ROSS1        TEAKPS----EGKISNESPIGSALLGKRPRQKVTVETP-SGTMKLTIVDIQ---------
GREA_ROSCS        TEAKPS----EGKISNESPIGAALLGKRPSQQVTVETP-SGTMKLTILNIQ---------
GREA_CHLSY        AEANPR----QGRISNESPLGAALLGKRARNKVTVHTP-SGVMKLTILKVR---------
GREA_THERP        IEAKPS----AGRISNESPVGRALLGHRAGEIVPIETP-NGTLMARIIEVQ---------
GREA_THEMA        QEADFF----AQKLSSDSPLGKSLLGRKVGDVVKVKAPSGVQRYQVIAVMNK--------
GREA_PETMO        QEANIE----ENKISIESPIGRSLLGRKKGEVINIKTARGSSKKIEIKEIS---------
GREA_MYCGE        LEANPE----EHKISNESPLALAIYGRLIGDECDVVGIE-VPYRVKILKISNR-------
GREA_MYCPN        LEANPE----EHRISNESPLAHAIYGRLVDDECDVVGIE-VPYRVKIVKIINW-------
GREA_UREPA        MDSDPF----ANKISIDTPLGKALVKQKKGTEVTVHTLA-SPYKVKIIKIID--------
GREA_MESFL        VEADPF----KGLISNESPIAKAILGKKVGESVEVKDIN-APYSIEIKEVN---------
GREA_MYCCT        IEADPF----SRLISNESPIAKAILGKKIGDTVEIKDIL-KPYKITIKSIK---------
GREA_ACHLI        IEADPK----NFKISIESPLGRAIKGKEVGDLVQIKSATNKQSNVEIKAIS---------
GREA_MYCPU        FDTDPT----QNKISYESPLAKSIIGFSKGDVVEIDAPD--KYTTKILSVNDK-------
GREA_MYCA5        LDTDPF----NGKISNTSPLAKAVIGRKAGEVVEVEAPN--KYQVKIVHVG---------
GREA_TREPA        WESAPE----RGIISYMSPLGSNLLNRKTGEQLAFTVGEHEKVYEILSISAAEI------
GREA_BORBU        WESNPD----EGIISYKSPFGENLLDSREGDSLNFVINNTNFKYFVKKIEPIKFS-----
GREA_CHLTR        WDANPD----EKILSLKSKLAQEMVGKAVGETVLFQGKKHKIKEISSIWD----------
GREA_CHLMU        WDANPE----EKILSLKSKLAQEMVGKTVGESVLFQGKKHKIKQISSIWD----------
GREA_CHLPN        WDADPD----SCILSLQSKLAQNMLGKKLNDVVILQGKEYKISRIQSIWEEHGA------
                                   : ..  :                                    

GREA_RHILV        -------
GREA_RHIME        -------
GREA_AGRFC        -------
GREA_RHILO        -------
GREA_BRUME        -------
GREA_CAUVC        -------
GREA_RICCN        -------
GREA_RICPR        -------
GREA_BUCAI        -------
GREA_BUCAP        -------
GREA_ECOLI        -------
GREA_SALTY        -------
GREA_YERPE        -------
GREA_HAEIN        -------
GREA_PASMU        -------
GREA_PSEAE        -------
GREA_VIBCH        -------
GREA_NEIMA        -------
GREA_NEIMB        -------
GREA_RALSO        -------
GREA_XANAC        -------
GREA_XANCP        -------
GREA_XYLFA        -------
GREA_ZYMMO        -------
GREA_CAMJE        -------
GREA_HELPY        -------
I0IAS9_PHYMF      -------
B0VIH5_CLOAI      -------
Q01RT9_SOLUE      VEKEVE-
GREA_RHOBA        -------
GREA_AMOA5        -------
GREA_FLAPJ        -------
GREA_CHLTE        -------
GREA_DEHM1        -------
GREB_ECOLI        -------
GREB_ECOL6        -------
GREB_SALTI        -------
GREB_SALTY        -------
GREB_PSEPK        -------
GREB_VIBCH        -------
GREB_VIBVU        -------
GREB_HAEIN        -------
GREB_PASMU        -------
GREB_YERPE        FNEDIDN
GREB_XANAC        -------
GREB_XANCP        -------
GREB_PSEAE        -------
GREB_NEIMA        -------
GREA1_LACPL       -------
Q03CI7_LACP3      -------
E4SKG7_LACAR      -------
C4ZAT8_AGARV      LRKF---
A6LRF4_CLOB8      -------
GREA_MYCLE        -------
GREA_MYCTU        -------
GREA_MYCA9        -------
GREA_MYCS2        -------
GREA_MYCVP        -------
GREA_RHOE4        -------
GREA_SACEN        -------
A8M3L1_SALAI      -------
GREA_STRCO        -------
GREA_STRAW        -------
C5C996_MICLC      -------
E4V910_BIFBI      -------
GREA_BACSU        -------
GREA_LISMO        -------
GREA_ALKHC        -------
GREA_STAAM        -------
GREA_STRPN        -------
GREA_STRP1        -------
GREA_LACLA        -------
GREA_CLOAB        -------
GREA_CLOPE        -------
GREA_CALS4        -------
GREA_ROSS1        -------
GREA_ROSCS        -------
GREA_CHLSY        -------
GREA_THERP        -------
GREA_THEMA        -------
GREA_PETMO        -------
GREA_MYCGE        -------
GREA_MYCPN        -------
GREA_UREPA        -------
GREA_MESFL        -------
GREA_MYCCT        -------
GREA_ACHLI        -------
GREA_MYCPU        -------
GREA_MYCA5        -------
GREA_TREPA        -------
GREA_BORBU        -------
GREA_CHLTR        -------
GREA_CHLMU        -------
GREA_CHLPN        -------