CLUSTAL format seed alignment for MF_00107

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

ISPF_BUCAI      ------------------MRIGYGFDLHAFGST---KPLIIGGVLIP-CEK---------
ISPF_BUCAP      ------------------MRIGYGFDIHAFGSI---KPLIIGGVQIP-YNK---------
ISPF_WIGBR      ------------------MRVGHGFDIHKFGKI-Y-KPLILGGVHIP-YCK---------
ISPF_TREDE      ------------------MRTGLGYDLHRLVRG---KKLMMGGVHIP-FKK---------
ISPF_NOSS1      --------------MTMSIRIGNGYDIHRLV---SDRALILGGVHIP-HEL---------
ISPF_THEEB      ---------------MMKIRIGNGYDIHRLV---PERPLILGGIRLE-HAC---------
ISPF_SYNY3      ---------------MTALRIGNGYDIHRLV---GDRPLILGGVTIA-HHL---------
ISPF_GLOVI      -----------MAVGGFEMRIGNGYDFHRLV---EGRRLILGGVEIP-YRL---------
ISPF_NEIMB      ---------------MTNIRIGQGYDVHQLT---EGRKLILGGVEIP-FEK---------
ISPF_CHRVO      -----------------MFRIGQGYDVHQLV---EGRPLILGGVDIP-HDK---------
ISPF_RALSO      -------------MNWMDIRIGQGYDVHALV---EGRKLILGGVEIP-HTR---------
ISPF_BORPE      --------------MNIPFRVGQGFDVHALV---EGRPLIIGGVTIA-HTH---------
ISPF_NITEU      ---------------MKKIRIGQGFDIHPLV---VGRDLIIGGVTIP-YEK---------
ISPF_CHLTE      ------------------MRIGIGIDVHQFA---EGRKLIIGGVEVP-SPI---------
ISPF_ECOLI      ------------------MRIGHGFDVHAFG---GEGPIIIGGVRIP-YEK---------
ISPF_PASMU      -----------------MIRIGHGFDVHAFG---GEGPIIIGGVAIP-YEK---------
ISPF_HAEDU      -----------------MIRIGHGFDVHAFG---EKRPLIIGGVTIP-YHT---------
ISPF_PHOPR      ------------------MRIGHGFDVHKFG---GEGPVIIGGVAIP-YEQ---------
ISPF_VIBVY      -----------------MIRIGHGFDVHKFG---GEGPVIIGGVAVP-YEQ---------
ISPF_SHEON      ----------------MKIRIGHGFDVHKFG---EPRPLILCGVEVP-YET---------
ISPF_PSESM      ------------------MRIGHGYDVHRFA---EGDFITLGGVRIA-HGF---------
ISPF_XANCP      --------------MSFNFRIGQGYDVHAFG---PGDHLMLGGVRMA-HSH---------
ISPF_XYLFT      ----MSGLFRGRVMTGLNVRIGQGYDVHAFG---PSDHVMLGGVRVP-HRC---------
ISPF_ACIAD      --------------MVVQIRIGQGMDVHAFE---EGDHVTLAGIKIP-HTH---------
ISPF_BACTN      ----------------MKIRVGFGFDVHQLV---EGRELWLGGIRLE-HSK---------
ISPF_PORGI      --------------MKKPFRIGFGFDVHRLS---EGYPLWMGGVRLE-HSK---------
ISPF_BACHD      -----------------MIRVGQGFDVHQFA---EGRLLIIGGVEIP-YEK---------
ISPF_BACSU      -----------------MFRIGQGFDVHQLV---EGRPLIIGGIEIP-YEK---------
ISPF_BACHK      -----------------MFRIGQGFDVHEFA---EGRPLIIGGITIP-HEK---------
ISPF_LISMF      -----------------MIRIGQGYDVHKLA---YDRELIVGGIKIP-YEK---------
ISPF_ENTFA      -----------------MIRIGQGFDVHQLV---PQRPLIIGGVTLP-YEK---------
ISPF_CLOAB      ------------------MRVGIGYDVHKLV---ENRKLILGGVEIQ-YSK---------
ISPF_CLOTE      ------------------MRVGIGYDVHKLV---DGRDLIIGGEKIP-FEK---------
ISPF_CLOPE      ------------------MRIGMGYDVHKLV---ENRDLILGGVKIP-YEK---------
ISPF_LEPIN      -----------------MYRIGNGIDFHKLEIN-LNRPLILGGIECE-SEF---------
ISPF_THEMA      -------------MESDPMFIGFGYDRHPLV---EGRRLVLAGVEID-APL---------
ISPF_CALS4      ---------------MGKMRVGIGYDVHRFE---EGKKLMLGGIEIP-FEK---------
ISPF_FUSNN      -----------------MLRIGNGYDVHKLV---EGRKLMLGGVEVP-HTK---------
ISPF_DEIRA      -------------MTGLPFRIGYGEDAHRLA---PGLPLVLGGVAIPHAEL---------
ISPF_THET8      ------------------MRIGYGEDSHRLE---EGRPLYLCGLLIP-SPV---------
ISPF_RHOBA      ---------MMTQPQPLAFRIGLGYDSHRLG---PDGPLRIGGLDVA-GDF---------
ISPF_MYCTU      --------------MNQLPRVGLGTDVHPIEP---GRPCWLVGLLFPSAD----------
ISPF_MYCPA      --------------MNTTPRIGLGVDVHPIQP---GRPCRLLGLLFDDAD----------
ISPF_MYCLE      --------------MSELPRVGLGFDVHVFEP---GRPCWLVGLLFPDND----------
ISPF_CORDI      -----------MTNTPIIPRVGIATDAHQIEA---GKPCWIACLLFSGAD----------
ISPF_COREF      -MRQNRRFLRCQVTEQIIPRVGIASDAHQIEA---GKPCWIACLLFDGVD----------
ISPF_STRAW      MASEASDVRLPPGGPVVLPLVGIGTDIHAFED---GRELWCAGLKWEGEGP---------
ISPF_BIFLO      -------------MGSVGVLIGQGFDAHRFAPAGSGRELWIAGLYWPVPDSCSEADAAKY
ISPF_CHLCV      ---MDAENDSPLPKPQWIYRVGIGQDSHRFLSESSAKPCILAGVIFE-NSP---------
ISPF_CHLPN      ---MDRDNEVPLPKPKWIYRTGIGQDSHRFLPESSTKPCILGGIIFD-HCP---------
ISPF_CHLMU      --MSEPSSCFVLPDPEWIYRVGIGQDSHRFLPSDNPKPCVLGGIIFE-NTP---------
                                     * . * * :                              

ISPF_BUCAI      -GLIAHSNGDLLIHSLIDALLGATAMGDIGSFFPSN-NYIYKNIDSRILLKKIWNKIILL
ISPF_BUCAP      -GLIAHSNGDLLIHSLIDALLGATAMGDIGTFFPSE-DKKYKNINSRILLKYIWKRIYLK
ISPF_WIGBR      -GVVSHSDGDVIIHSIIDSLLGASSLGDIGILFPNN-DIKYKNINSCILLQVVWNCI-KK
ISPF_TREDE      -GEKAHSDGDVLLHAITDALLGACGMGDIGEFFPPS-DKKWKDANSSELLSTVWERISEA
ISPF_NOSS1      -GLLGHSDADVLTHAIMDAMLGALSLGDIGHYFPPT-DPQWAGADSLVLLSQVNELIRTQ
ISPF_THEEB      -GLLGHSDADVLTHAIMDALLGALSLGDIGHYFPPS-DPQWAGADSQVLLAKVAALIAER
ISPF_SYNY3      -GLDGHSDADVLTHALMDALLGALSLGDIGHYFPPS-DARWQGADSLKLLAQVHQLILER
ISPF_GLOVI      -GLLGHSDADLLTHAITDALLGAACLGDIGRHFPPG-DPQWQDVSSLLLLSKVLELVRGR
ISPF_NEIMB      -GLLGHSDADALLHAVTDALLGAAGLGDIGSHFPDT-AAEFKDADSRVLLRAAYQSVQAQ
ISPF_CHRVO      -GLLGHSDADALLHAITDALLGAAALGDIGRHFPDT-AAEFKGADSRALLREAAARVRAA
ISPF_RALSO      -GLLGHSDADALLHAITDALFGAAGLGDIGRHFPDT-DPAFAGADSRVLLREAVRRVREA
ISPF_BORPE      -GLLGHSDADVLLHAVTDALLGGAGLGDIGRHFPDT-DPAYRGADSRVLLRAAFDKVRAA
ISPF_NITEU      -GLLGHSDADVLLHALCDALLGAAALGDIGRHFSDT-DARYQGIDSRKLVREVHRLLTEA
ISPF_CHLTE      -GLLGHSDADVLLHAISDALLGAAALGDIGKHFPDT-SPDYKDADSMELLRHVCKLLEQE
ISPF_ECOLI      -GLLAHSDGDVALHALTDALLGAAALGDIGKLFPDT-DPAFKGADSRELLREAWRRIQAK
ISPF_PASMU      -GLLAHSDGDVALHALTDALLGAVALGDIGKLFPDT-DMQYKGADSRGLLREAYTQVQAK
ISPF_HAEDU      -GFIAHSDGDVALHALTDALLGAAALGDIGKLFPDT-DQQYKNIDSRKLLIEAYRQVQTK
ISPF_PHOPR      -GLIAHSDGDVALHAVCDALLGAIGAGDIGRHFPDT-DAEWKGADSRFLLRDVYSKVKDK
ISPF_VIBVY      -GLIAHSDGDVALHALSDALLGAIAAGDIGRHFPDT-DDKWKGADSRELLKDVYRRVKEQ
ISPF_SHEON      -GLVAHSDGDVVLHAISDAILGAMALGDIGKHFPDT-DAAYKGADSRVLLRHCYALAKAK
ISPF_PSESM      -GLLAHSDGDVLLHALSDALLGAAALGDIGKHFPDT-DPQFKGADSRVLLRHVLKQIHGK
ISPF_XANCP      -GVLAHSDGDVVLHALCDAMLGGLALGDIGVHFPPS-DARWKGADSAQFVQHCDQLLRDR
ISPF_XYLFT      -GVLAHSDGDVILHALCDAMLGALGLGDIGQHFPPS-DVRWKGADSGVFVRHCNLLLRER
ISPF_ACIAD      -GLKAHSDGDVVLHALSDALLGALALGDIGQHFPDT-DVQFKGADSRVLLKHVYQLILDR
ISPF_BACTN      -GLLGHSDADVLLHTVCDALLGAANMRDIGYHFPDT-AGEYKNIDSKILLKKTVELIATK
ISPF_PORGI      -GLEGHSDADVLIHAICDALLGAAALRDIGYHFPPS-DPQYKGIDSKILLARVMELVRSQ
ISPF_BACHD      -GLLGHSDADVLLHTIADAALGAIGEGDIGKHFPDT-DPHFKDADSAKLLSAVWELVKEK
ISPF_BACSU      -GLLGHSDADVLLHTVADACLGAVGEGDIGKHFPDT-DPEFKDADSFKLLQHVWGIVKQK
ISPF_BACHK      -GLIGHSDADVLLHTIADACLGAIAAGDIGKHFPDT-DPAFKDADSAVLLQKVWEFVREQ
ISPF_LISMF      -GLLGHSDADVLLHAITDAIIGAIGAGDIGHFFPDT-DMAFKDADSAELLEEIWQKVEAD
ISPF_ENTFA      -GLLGHSDADVLTHAIIDAILGAAGLGDIGQLFPET-DPQFKNANSVNLLKKVNEKVGRS
ISPF_CLOAB      -GLLGHSDADVLVHAIIDSILGAAGLGDIGKLFPDS-DNKYKGISSLKLLKEVNALIKDK
ISPF_CLOTE      -GLLGHSDADVLCHAIGDSILGAAALGDIGRHFPDT-DNRYKGYSSLKLLEEIKRIINEK
ISPF_CLOPE      -GLLGHSDADVLLHAIMDSLLGAAALGDIGKHFPDT-DPKYKGADSIKLLEFVGELLNKN
ISPF_LEPIN      -ALVGHSDADIILHAISDAILGALALGDIGQYFPDT-DPSLKNIDSKIILVKCLELMKEK
ISPF_THEMA      -GSLGHSDGDVLSHAIIDALLGAGCLGDIGTWFPET-K-EYKDANSLDLLKETVKILEER
ISPF_CALS4      -GLKGHSDGDVLIHALIDGILGAAGLGDIGEHFPDT-DVAYKEVDSKILLKRVLELVSEH
ISPF_FUSNN      -GVLGHSDGDVLLHAITDAIIGALGLGDIGLHFPDN-DENLKDIDSAILLKKINNIMKEK
ISPF_DEIRA      -GAVAHSDGDAVLHAVADALLSGLALGDIGQYFPDT-AAEWKGMDSRRILAKALELVEER
ISPF_THET8      -GALAHSDGDAALHALTDALLSAYGLGDIGLLFPDT-DPRWRGERSEVFLREALRLVEAR
ISPF_RHOBA      -HAIGHSDADVLLHAVTDALMGAIAGPDIGRLFPDD-ADENRGRDSRDFVEEALRRVNEA
ISPF_MYCTU      -GCAGHSDGDVAVHALCDAVLSAAGLGDIGEVFGVD-DPRWQGVSGADMLRHVVVLITQH
ISPF_MYCPA      -GCAGHSDGDVGAHALCDAVLSAAGLGDVGAVFGVD-DPRWAGVSGADMLRHVADLTARH
ISPF_MYCLE      -GCAGHSDGDVAVHALCDAVLSAAGQGDIGGLFAVG-DPRWERVSGADMLRHVVELLLRH
ISPF_CORDI      -GCEGHSDGDVVAHALVDALLSAANLGDLGSFVGVG-RKEYDGVSGTQLLTECRELLESH
ISPF_COREF      -GCEGHSDGDVVAHAIVDALLSASGLGDLGSFVGVG-RPEYDGVSGTQLLIEVRELLITR
ISPF_STRAW      -GLAGHSDADVVAHAACNALFSAAGLGDLGQHFGTG-RPEWSGASGVTLLTEAARIVRAA
ISPF_BIFLO      EGIEGDSDGDVAAHALIDALLAAARLGDIGSLFGVGADAHGAGMHGIDMLQEVVAHLASN
ISPF_CHLCV      -GFQANSDGDIVFHAICNAISSVTHRIILGEVADEL--FHTRGITDSSVYLSEAIKSLKS
ISPF_CHLPN      -GFQANSDGDIIFHAICNAISSVTNKIILGKVADEL--LQTRGITDSGIYLEEALKSLKP
ISPF_CHLMU      -GFEANSDGDVVFHAICNAFSSVTHQVILGALADEL--LKAKGISDSAVYLKEAVASLKP
                    ..*:.*   *:  :.  .      :*               .  .           

ISPF_BUCAI      NYDICNIDITIIAEYPKMLPYIFFMRSNLSLDLNTEIDNISIKSTTSKKIGCIGRKEAIA
ISPF_BUCAP      NYRISNIDITIITETPKILSYIFLMRSNIASDLNIKIEKISVKSTSSKMIGCIGRKEGIA
ISPF_WIGBR      KYKIGNIDVTLFLEYPKISSYTNKICLCISNCLKCKTDVINIKSKTMEGLGEIGKKKGIA
ISPF_TREDE      GWKIQNIDCVIIIEEPKILPFREEIRKSIAGILKIEKEQIFIKAKTGEGIGIIGRGKAVA
ISPF_NOSS1      GWRIGNIDSVVVAERPKLKPHIKTMRDKLADILQLEPNQIGVKATTNEKLGPVGREEGIC
ISPF_THEEB      GWRVGNIDAVVVAERPKLKPYLDPMRDRLATTLGIDRDQISIKATTNEKLGPVGREEGIA
ISPF_SYNY3      GWRINNLDNVIVAEQPKLKPHIQAMKENLAKVLTIDPDLIGIKATTNERLGPTGREEGIA
ISPF_GLOVI      GLRLSNVDAVVVAERPKLAPHIPAIRQSLAGALGLPLDRLSVKATTNEGLGPVGEGLAMA
ISPF_NEIMB      GWQAVNVDTTVIAQKPKLAPHIPQMRANIAADLGIDISCVNIKGKTNEKLGYLGRMEGIE
ISPF_CHRVO      GWRPVNVDSTLIAQRPKLAPHIDAMRANIAADLGLDVGAVNVKGKTNEKLGYLGRCEAIE
ISPF_RALSO      GYDVGNVDATVIAQKPKLAPHVPGMVANLAADLGIAPGRCNVKAKTNEKLGFEGREDGIV
ISPF_BORPE      GWAPVNVDATIHAQAPKIGPHAAAMVANIAADLALDAGAVNIKAKTNEGLGYLGRKEGIA
ISPF_NITEU      GYRVVNIDATIIAQVPKMAPHIPGMVTNIAQDLTLPAGDINIKAKTAEKLGVVGRGEGIV
ISPF_CHLTE      GYKPVNVDTMLLLEKPKIAPYIDQMRRNIARCLGLEINAVSVKATTNEKLGYVGRQEGAC
ISPF_ECOLI      GYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDLGCHMDDVNVKATTTEKLGFTGRGEGIA
ISPF_PASMU      GYKVGNVDVTIIAQAPKMRPHIDAMRAAIAEDLACDIEQVNVKATTSERLGFTGRGEGIA
ISPF_HAEDU      GYQISNIDITIIAQAPKMRPHIDNMRQLIANDLNCDIDQINIKATTTEKLGFTGRGEGIA
ISPF_PHOPR      GYRLGNLDVTIIAQAPKMAPYIDAMCQAIAEDLETDIGNVNVKATTSERLGFTGRKEGIA
ISPF_VIBVY      GYKLGNADVTIIAQAPKMAPYIDAMREAIAHDLETDIRNINVKATTTERLGFTGRKEGIA
ISPF_SHEON      GFELGNLDVTIIAQAPKMAPHIEDMRQVLAADLNADVADINVKATTTEKLGFTGRKEGIA
ISPF_PSESM      GWKVGNVDATIVAQAPKMAPHIDAMRALIAEDLLVELDQVNVKATTTEKLGFTGREEGIA
ISPF_XANCP      GWRVGNADITVICERPKVGPHALAMRERIAGLLAIELDAVSVKATTSEKLGFTGRSEGIA
ISPF_XYLFT      DWCVGNVDATAICESPKIAPYVNAMREGIARLLEVQPECVSVKATTSEGLGFIGRGEGLA
ISPF_ACIAD      GYALNNADITVACERPKLAKYNLEMRQSIADVLDVDVTQISVKATTTEKLGFTGRQEGIL
ISPF_BACTN      GYRVGNIDATICAERPKLKAHIPLMQETMAAVMGIDAEDISIKATTTEKLGFTGREEGIS
ISPF_PORGI      GYELGNIDATIAAEQPKLNPHIPDMQRVLAEVIQVEVSDISLKATTTEKLGFTGREEGIS
ISPF_BACHD      GYTLGNVDCTIIAQKPKMAPHIPAMRARIAELLEAEEAQVNVKATTTETLGFTGRGEGIA
ISPF_BACSU      GYVLGNIDCTIIAQKPKMLPYIEDMRKRIAEGLEADVSQVNVKATTTEKLGFTGRAEGIA
ISPF_BACHK      GYELGNLDCTIIAQKPKMAPHIESMRKRISELLETSIDNINVKATTTEKLGFTGREEGIA
ISPF_LISMF      GFRLGNLDATIIAEKPKMAPYVEQMKLRIAELLHADSAQVNVKATTTEKLGFTGREEGIA
ISPF_ENTFA      GFTIGNIDCTILAEEPKMSPYLAEMKKNLAASCHLAVTQVNIKATTMETMGFVGKKEGIG
ISPF_CLOAB      GYKIGNIDSTIIAQKPKISPYIEDIKKSLCNVLDIDLGSINIKATTEEGLGFTGRGEGIS
ISPF_CLOTE      GYYITNIDSTIIAQKPKMLAYINNMRKNISKVLDISIEDINIKATTEEELGFTGKQLGIK
ISPF_CLOPE      NYKISNIDATIIAQRPKMAPHIPTMRENIAKALNIDLDQINVKATTEEGLGFTGSGEGIS
ISPF_LEPIN      NFDLVNIDCTVIGERPKITPLKDRITKSLSNLLNLPLDCISVKATTTEKMGALGRQEGIG
ISPF_THEMA      GFSVVNVDATVVASIVKLSPYREKIVENLKSALETS--RVNVKFKSGNTLGFEGEERGIS
ISPF_CALS4      -YVVNNVDCIVVTERPKLSPYKDRIRTSLAELLGVSKERVNVKAKTEEGLGFTGREEGIK
ISPF_FUSNN      NYKIVNLDSIIVMQKPKLRPYIDSIRDNIAKILEINSELINVKAKTEEKLGFTGDETGVK
ISPF_DEIRA      GYRPVNVALVVTLDRPKLGPLRADIAASVAELLGLPAGEVGVSFKTSEGLAL----EHVQ
ISPF_THET8      GAKLLQASLVLTLDRPKLGPHRKALVDSLSRLLRLPQDRIGLTFKTSEGLAP----SHVQ
ISPF_RHOBA      GYEINNVDAVILAQKPKMAPHIDSMRAAVAEMLQTTIEQVGLKAKTGEGVDAVGRSEAIA
ISPF_MYCTU      GYRVGNAVVQVIGNRPKIGWRRLEAQAVLSRLLNAP---VSVSATTTDGLGLTGRGEGLA
ISPF_MYCPA      GFRVGNAAVQVIGNRPKVGPRRAEAQRVLSELLGAP---VSVAATTTDGLGLTGRGEGLA
ISPF_MYCLE      GYEVVNASVQVIGNRPKIGPRRTEAQRLLSALLRAP---VSVAATTTEGLGLTGRGEGLS
ISPF_CORDI      GFTIGNGAVQLVGQSPKMGPRREEAERVMSEILGAP---VSVSATTTDHLGFTGRSEGRA
ISPF_COREF      GFTIGNVAAQLVGQTPKFGPRREEAQQVISDILGAP---CFLSATTTDHMGFTGRGEGRA
ISPF_STRAW      GFTIGNVAVQVVGPRPKIGKRRDEAQKILSDAVGAP---VSVSGATTDGLGFPGRDEGLM
ISPF_BIFLO      GYTPASASVAIIGNRPKIGTRRAEAEAALSAAVGCP---VSVTATTTDHMGFTGHGEGIA
ISPF_CHLCV      NQMISHVAITIEGNRPKFLPKLSAMRQSIASALNIPLGSVGITATSGEGLSDFGCGDGVQ
ISPF_CHLPN      NQKISHVAITIEGSRPKFLCKLSALRQNIAQVMNLTPTDIGITATSGEGLSDFGCGDGVQ
ISPF_CHLMU      TQKISHLAITIEGQRPKLLPKISAMREKIAEILRISLDSVNITATSGEGLTSMGQGHGVQ
                                *.          :            :   : . :          

ISPF_BUCAI      CHSIVMLIKNK-----KCI-
ISPF_BUCAP      CQSLVMLVKSKNTDRKNNII
ISPF_WIGBR      SEAVSVLLEI----------
ISPF_TREDE      ALASCLIFCRHTQE------
ISPF_NOSS1      AYAVVLLVSSDEIS------
ISPF_THEEB      AYAVALLQSGM---------
ISPF_SYNY3      AYSVALLIKEG---------
ISPF_GLOVI      CHAVVLLEE-----------
ISPF_NEIMB      AQAAVLLVRI----------
ISPF_CHRVO      AQAVCLLAQA----------
ISPF_RALSO      AQAAVLIYRAEAAEQD----
ISPF_BORPE      ANVVVLLARAG---------
ISPF_NITEU      AEVVCLIADGDEV-------
ISPF_CHLTE      AHAVCLIENA----------
ISPF_ECOLI      CEAVALLIKATK--------
ISPF_PASMU      CEAVALVVKS----------
ISPF_HAEDU      CEAVALLSKKTV--------
ISPF_PHOPR      CEAVVLINAQ----------
ISPF_VIBVY      TEAVVLLIKQ----------
ISPF_SHEON      VEAVVLLSRQ----------
ISPF_PSESM      VHAVALLLRA----------
ISPF_XANCP      AQAAVLLGKIAA--------
ISPF_XYLFT      AQVVVLLYRLNGVVV-----
ISPF_ACIAD      ATATVLVSYQAK--------
ISPF_BACTN      AYATVLIEKD----------
ISPF_PORGI      AYAVALLIAAV---------
ISPF_BACHD      SQAVILLVK-----------
ISPF_BACSU      AQATVLIQKG----------
ISPF_BACHK      SQAVVLLQKK----------
ISPF_LISMF      SLAVVLLEK-----------
ISPF_ENTFA      AIAVALLEK-----------
ISPF_CLOAB      SQSICLLI------------
ISPF_CLOTE      AQSICLLNKNI---------
ISPF_CLOPE      SQSICLLVK-----------
ISPF_LEPIN      TFCSILLEKRS---------
ISPF_THEMA      AYAVCLVEEKGCTKST----
ISPF_CALS4      AYAVVLLEERY---------
ISPF_FUSNN      SYCVVLLEKKKC--------
ISPF_DEIRA      TRVTVLLGRVDD--------
ISPF_THET8      ARAVVLLDG-----------
ISPF_RHOBA      ARAVVMLSRR----------
ISPF_MYCTU      AIATALVVSLR---------
ISPF_MYCPA      AIATALVVPTG---------
ISPF_MYCLE      AIATALVVQV----------
ISPF_CORDI      AVATAVVWK-----------
ISPF_COREF      ALATAVVWTG----------
ISPF_STRAW      AVATALVVRAG---------
ISPF_BIFLO      AIANALVEKI----------
ISPF_CHLCV      CFCVLTVAEYCN--------
ISPF_CHLPN      CFCVLTVMEYCD--------
ISPF_CHLMU      CFCVLTVMEFCPR-------
                      :