CLUSTAL format seed alignment for MF_00109

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

AROK_ALKOO       --------------------------------------MVKNIVLVGFMAVGKTTLGKLL
AROK_FUSNN       --------------------------------------MKDNIALIGFMGSGKTTVGKLL
AROK_BACFR       ---------------------------------------MIRIFLTGYMGAGKTTLGKAL
AROK_BACFN       ---------------------------------------MIRIFLTGYMGAGKTTLGKAL
AROK_BACTN       ---------------------------------------MVRIFLTGYMGAGKTTLGKAF
AROK_BACV8       ---------------------------------------MTRIFLIGYMGAGKTTLGKAF
AROK_PARD8       ---------------------------------------MKRVFLVGYMGAGKTTVGKEL
AROK_AZOPC       ---------------------------------------MRRIFLIGYMGAGKTTIGKIL
AROK_FLAJ1       ---------------------------------------MEKIVLLGYMGCGKSTIAQNL
AROK_METI4       --------------------------------------MLRHIVLVGMMGAGKTTVGLWL
AROK_BACLD       ---------------------------------MNAAIRDKNIVLIGFMGVGKTTIGQLV
AROK_BACP2       -----------------------------MKINREIPVRQRNIVLIGFMGVGKTTIGQLV
AROK_BACSU       -----------------------------MNAKRAIPVRERNIVLIGFMGVGKTTIGQLV
AROK_GEOKA       -----------------------------MSRQTTIPLRERNIILIGFMGAGKTTIGQLV
AROK_GEOTN       -----------------------------MEKQTAIPLRERNIILIGFMGAGKTTIGQLV
AROK_OCEIH       --------------------------------MGKFPLREQSIVLIGFMGVGKTTIGKTV
AROK_BACHD       -------------------------------MKRIPSIRERNIVLIGFMGVGKTSVGEQL
AROK_CLOB1       ---------------------------------------MENIVLIGMPLSGKSTLGREL
AROK_CLOBH       ---------------------------------------MENIVLIGMPLSGKSTLGREL
AROK_CLOBL       ---------------------------------------MENIVLIGMPLSGKSTLGREL
AROK_CLOBK       ---------------------------------------MENIVLIGMPLSGKSTLGREL
AROK_CLOBM       ---------------------------------------MENIILIGMPLSGKSTLGREL
AROK_HELPY       ---------------------------------------MQHLVLIGFMGSGKSSLAQEL
AROK_HELPJ       ---------------------------------------MQHLVLIGFMGSGKSSLAQEL
AROK_HELPG       ---------------------------------------MQHLVLIGFMGSGKSSLAQEL
AROK_HELP2       ---------------------------------------MQHLVLIGFMGSGKSSLAQEL
AROK_HELPH       ---------------------------------------MRHLVLIGFMGSGKSSLAQEL
AROK_HELAH       ---------------------------------------MQHLVLIGFMGSGKSSLAQEL
AROK_HELHP       ---------------------------------------MENIVLIGFMGSGKTTIGREI
AROK_CLOBA       --------------------------------------MKNKVFLIGMPGCGKSTIGELI
AROK_CLOBB       --------------------------------------MKNKIFLIGMPGCGKSTIGEII
AROK_CLOB8       --------------------------------------MKNKVVFIGMPGCGKSTIGRLV
AROK_DICTD       --------------------------------------MRSSLSFVGFMGSGKTSIGKRI
AROK_BACC7       ---------------------------------------MKSIYITGYMGAGKTTIGKAL
AROK_BACC0       ---------------------------------------MKSIYITGYMGAGKTTIGKAL
AROK_BACMK       ---------------------------------------MKSIYITGYMGAGKTTIGKVL
AROK_BACC2       ---------------------------------------MKSIYITGYMGAGKTTIGKAL
AROK_BACCN       ---------------------------------------MRAIYITGYMGAGKTTIGKAL
AROK_STAAC       -----------------------------------MNHDKSPIILIGFMGTGKSTIGKYV
AROK_STAA8       -----------------------------------MNHDKSPIILIGFMGTGKSTIGKYV
AROK_STAAE       -----------------------------------MNHDKSPIILIGFMGTGKSTIGKYV
AROK_STAAT       -----------------------------------MNHDKSPIILIGFMGTGKSTIGKYV
AROK_STAAS       -----------------------------------MNHDKSPIILIGFMGTGKSTIGKYV
AROK_STAAW       -----------------------------------MNHDKSPIILIGFMGTGKSTIGKYV
AROK_STAA1       -----------------------------------MNHDKSPIILIGFMGTGKSTIGKYV
AROK_STAAM       -----------------------------------MNHDKSPIILIGFMGTGKSTIGKYV
AROK_STAAN       -----------------------------------MNHDKSPIILIGFMGTGKSTIGKYV
AROK_STAA2       -----------------------------------MNHDKSPIILIGFMGTGKSTIGKYV
AROK_STAA9       -----------------------------------MNHDKSPIILIGFMGTGKSTIGKYV
AROK_STAAR       -----------------------------------MNHDKSPIILIGFMGTGKSTIGKYV
AROK_STAES       -----------------------------------MKSIQVPIILVGFMGTGKTTVGKYL
AROK_STAEQ       -----------------------------------MKSIQVPIILVGFMGTGKTTVGKYL
AROK_STAS1       -----------------------------------MNNKIEPLILIGFMGTGKTTLGQFL
AROK_STAHJ       ---------------------------------MLLNKKNSPIILIGFMGTGKSTIGEYL
AROK_LACLM       ----------------------------------------MSIILIGFMGAGKST----V
AROK_LACLS       ----------------------------------------MSIILIGFMGAGKST----V
AROK_LACLA       ----------------------------------------MSIILIGFMGAGKST----V
AROK_STRPB       ----------------------------------------MTKVLLGFMGVGKTT----V
AROK_STRPC       ----------------------------------------MTKVLLGFMGVGKTT----V
AROK_STRPD       ----------------------------------------MTKVLLGFMGVGKTT----V
AROK_STRPZ       ----------------------------------------MTKVLLGFMGVGKTT----V
AROK_STRPG       ----------------------------------------MTKVLLGFMGVGKTT----V
AROK_STRPF       ----------------------------------------MTKVLLGFMGVGKTT----V
AROK_STREM       ----------------------------------------MTKLLLGFMGVGKTT----V
AROK_STRTD       ----------------------------------------MAKVLLGFMGVGKSS----V
AROK_STRSY       ----------------------------------------MPIVLLGFMGVGKTT----T
AROK_STRS2       ----------------------------------------MPIVLLGFMGVGKTT----T
AROK_STRGC       ----------------------------------------MSKILLGFMGAGKTT----V
AROK_ENTFA       ---------------------------------------MESIVLIGFMGAGKTTIGQSL
AROK_SALAI       --------------------------------------MAPVCVLVGPPGSGKTTVGQAL
AROK_SALTO       --------------------------------------MAPVCVLVGAPGSGKTTVGRAL
AROK_ACIC1       --------------------------------------MPPVVVLIGPPGAGKSTVGRAL
AROK_THEFY       ------------------------------------MSSRPLAVLIGSPGAGKTTVGRAL
AROK_STRAW       -------------------------------------MTVPRVVLVGPMGVGKSTVGALV
AROK_STRCO       -------------------------------------MSAPLIVLVGPMGVGKSTVGQLL
AROK_FRACC       -----------------------MGEPATDAWTGPMAWTGPMVVLVGAPGAGKTTVGTQL
AROK_SACEN       --------------------------------------MSPCAVVVGPPGAGKTTVGRLL
AROK_MYCA1       --------------------------------------MAPKAVLIGLPGSGKSTIGRRL
AROK_MYCPA       --------------------------------------MAPKAVLIGLPGSGKSTIGRRL
AROK_MYCBO       --------------------------------------MAPKAVLVGLPGSGKSTIGRRL
AROK_MYCBP       --------------------------------------MAPKAVLVGLPGSGKSTIGRRL
AROK_MYCTU       --------------------------------------MAPKAVLVGLPGSGKSTIGRRL
AROK_MYCTA       --------------------------------------MAPKAVLVGLPGSGKSTIGRRL
AROK_MYCMM       --------------------------------------MAPKAVLVGLPGSGKSTIGRRL
AROK_MYCUA       --------------------------------------MAPKAVLVGLPGSGKSTIGRRL
AROK_MYCLE       --------------------------------------MAPKAVLVGLPGAGKSTIGRRL
AROK_RHOJR       --------------------------------------MAPKAVLVGPPGAGKSTIGRRL
AROK_COREF       -------------------------------------MARPIVVLVGPPGAGKSTIGRRL
AROK_CORGL       -------------------------------------MLLPIVVLVGLPGAGKSTIGRRL
AROK_CORDI       ----------------------------------MSGRVRPIVVLVGPPGSGKTTIGRRL
AROK_CORJK       --------------------------------------MSPRAVLVGLPGSGKTTIGKRL
AROK_ECO8A       ------------------------------------MAEKRNIFLVGPMGAGKSTIGRQL
AROK_ECOHS       ------------------------------------MAEKRNIFLVGPMGAGKSTIGRQL
AROK_ECO7I       ------------------------------------MAEKRNIFLVGPMGAGKSTIGRQL
AROK_ECOL6       ------------------------------------MAEKRNIFLVGPMGAGKSTIGRQL
AROK_ECO45       ------------------------------------MAEKRNIFLVGPMGAGKSTIGRQL
AROK_ECOLU       ------------------------------------MAEKRNIFLVGPMGAGKSTIGRQL
AROK_ECO57       ------------------------------------MAEKRNIFLVGPMGAGKSTIGRQL
AROK_ECO24       ------------------------------------MAEKRNIFLVGPMGAGKSTIGRQL
AROK_ECOLI       ------------------------------------MAEKRNIFLVGPMGAGKSTIGRQL
AROK_ECODH       ------------------------------------MAEKRNIFLVGPMGAGKSTIGRQL
AROK_ECOLC       ------------------------------------MAEKRNIFLVGPMGAGKSTIGRQL
AROK_SHISS       ------------------------------------MAEKRNIFLVGPMGAGKSTIGRQL
AROK_SHIFL       ------------------------------------MAEKRNIFLVGPMGAGKSTIGRQL
AROK_SHIDS       ------------------------------------MAEKRNIFLVGPMGAGKSTIGRQL
AROK_SHIBS       ------------------------------------MAEKRNIFLVGPMGAGKSTIGRQL
AROK_SHIB3       ------------------------------------MAEKRNIFLVGPMGAGKSTIGRQL
AROK_ENT38       ------------------------------------MAEKRNIFLVGPMGAGKSTIGRQL
AROK_SALA4       ------------------------------------MAEKRNIFLVGPMGAGKSTIGRQL
AROK_SALCH       ------------------------------------MAEKRNIFLVGPMGAGKSTIGRQL
AROK_SALDC       ------------------------------------MAEKRNIFLVGPMGAGKSTIGRQL
AROK_SALEP       ------------------------------------MAEKRNIFLVGPMGAGKSTIGRQL
AROK_SALG2       ------------------------------------MAEKRNIFLVGPMGAGKSTIGRQL
AROK_SALHS       ------------------------------------MAEKRNIFLVGPMGAGKSTIGRQL
AROK_SALNS       ------------------------------------MAEKRNIFLVGPMGAGKSTIGRQL
AROK_SALPA       ------------------------------------MAEKRNIFLVGPMGAGKSTIGRQL
AROK_SALPK       ------------------------------------MAEKRNIFLVGPMGAGKSTIGRQL
AROK_SALSV       ------------------------------------MAEKRNIFLVGPMGAGKSTIGRQL
AROK_SALTI       ------------------------------------MAEKRNIFLVGPMGAGKSTIGRQL
AROK_SALTY       ------------------------------------MAEKRNIFLVGPMGAGKSTIGRQL
AROK_CITK8       ------------------------------------MAEKRNIFLVGPMGAGKSTIGRQL
AROK_ESCF3       ------------------------------------MAEKRNIFLVGPMGAGKSTIGRQL
AROK_SERP5       ------------------------------------MAEKRNIFLVGPMGAGKSTIGRQL
AROK_YERE8       ------------------------------------MAEKRNIFLVGPMGAGKSTIGRQL
AROK_YERPE       ------------------------------------MAEKRNIFLVGPMGAGKSTIGRQL
AROK_YERPP       ------------------------------------MAEKRNIFLVGPMGAGKSTIGRQL
AROK_YERPG       ------------------------------------MAEKRNIFLVGPMGAGKSTIGRQL
AROK_YERPA       ------------------------------------MAEKRNIFLVGPMGAGKSTIGRQL
AROK_YERPN       ------------------------------------MAEKRNIFLVGPMGAGKSTIGRQL
AROK_YERPS       ------------------------------------MAEKRNIFLVGPMGAGKSTIGRQL
AROK_YERPB       ------------------------------------MAEKRNIFLVGPMGAGKSTIGRQL
AROK_YERP3       ------------------------------------MAEKRNIFLVGPMGAGKSTIGRQL
AROK_YERPY       ------------------------------------MAEKRNIFLVGPMGAGKSTIGRQL
AROK_PECAS       ------------------------------------MAEKRNIFLVGPMGAGKSTIGRQL
AROK_ERWT9       ------------------------------------MAEKRNIFLVGPMGAGKSTIGRQL
AROK_SODGM       ------------------------------------MAEKRNIFLVGPMGAGKSTIGRQL
AROK_PHOLL       ------------------------------------MAEKRNIFLVGPMGAGKSTIGRQL
AROK_BAUCH       ------------------------------------MVEKRNIFLIGPMGAGKSTIGRQL
AROK_AERHH       ------------------------------------MAEKRNIFLIGPMGAGKSTIGRHL
AROK_AERS4       ------------------------------------MAEKRNIFLIGPMGAGKSTIGRHL
AROK_ALTMD       ------------------------------------MAEKRNIFLVGPMGAGKSTIGRHL
AROK_PSEA6       ------------------------------------MAEKRNIFLIGPMGAGKSTIGRHL
AROK_SHEB5       ------------------------------------MAEKRNIFLVGPMGAGKSTIGRHL
AROK_SHEB8       ------------------------------------MAEKRNIFLVGPMGAGKSTIGRHL
AROK_SHEB9       ------------------------------------MAEKRNIFLVGPMGAGKSTIGRHL
AROK_SHESA       ------------------------------------MAEKRNIFLVGPMGAGKSTIGRHL
AROK_SHESM       ------------------------------------MAEKRNIFLVGPMGAGKSTIGRHL
AROK_SHESR       ------------------------------------MAEKRNIFLVGPMGAGKSTIGRHL
AROK_SHEPC       ------------------------------------MAEKRNIFLVGPMGAGKSTIGRHL
AROK_SHESW       ------------------------------------MAEKRNIFLVGPMGAGKSTIGRHL
AROK_SHEON       ------------------------------------MAEKRNIFLVGPMGAGKSTIGRHL
AROK_SHEDO       ------------------------------------MAEKRNIFLVGPMGAGKSTIGRHL
AROK_SHEFN       ------------------------------------MAEKRNIFLVGPMGAGKSTIGRHL
AROK_SHEAM       ------------------------------------MAEKRNIFLVGPMGAGKSTIGRHL
AROK_SHEHH       ------------------------------------MAEKRNIFLVGPMGAGKSTIGRHL
AROK_SHEPA       ------------------------------------MAEKRNIFLVGPMGAGKSTIGRHL
AROK_SHESH       ------------------------------------MAEKRNIFLVGPMGAGKSTIGRHL
AROK_SHEWM       ------------------------------------MAEKRNIFLVGPMGAGKSTIGRHL
AROK_SHELP       ------------------------------------MAEKRNIFLVGPMGAGKSTIGRHL
AROK_COLP3       ------------------------------------MAEKRNIFLIGPMGAGKSTIGREI
AROK_PSET1       ------------------------------------MAEKRNIFLVGPMGAGKSTIGRHI
AROK_IDILO       ------------------------------------MAEKRNIFLVGPMGAGKSTIGRQI
AROK_ALIF1       ------------------------------------MAEKRNIFLVGPMGAGKSTIGRHL
AROK_ALIFM       ------------------------------------MAEKRNIFLVGPMGAGKSTIGRHL
AROK_ALISL       ------------------------------------MAEKRNIFLVGPMGAGKSTIGRHL
AROK_PHOPR       ---------------------------------MLTMAEKRNIFLVGPMGAGKSTIGRHL
AROK_VIBCH       ------------------------------------MAEKRNIFLVGPMGAGKSTIGRHL
AROK_VIBC3       ------------------------------------MAEKRNIFLVGPMGAGKSTIGRHL
AROK_VIBCB       ------------------------------------MAEKRNIFLVGPMGAGKSTIGRHL
AROK_VIBPA       ------------------------------------MAEKRNIFLVGPMGAGKSTIGRHL
AROK_VIBVU       ------------------------------------MAEKRNIFLVGPMGAGKSTIGRYL
AROK_VIBVY       ------------------------------------MAEKRNIFLVGPMGAGKSTIGRYL
AROK_BUCAI       ------------------------------------MAEKRNIFLVGPMGAGKSTIGRQL
AROK_BUCAP       ------------------------------------MAEKRNIFLIGPMGAGKSTIGRQL
AROK_WIGBR       ------------------------------------MVEKRNIFLIGPMGAGKSTIGRQI
AROK_BLOFL       -----------------------------------MLTDNRKIFLIGPMGAGKSTIGRQL
AROK_BLOPB       --------------------------MKKSFSYNNMLKKN-NIFLIGPMGAGKSTIGRQL
AROK_ACTPJ       ------------------------------------MAEKRNIFLIGPMGAGKSTIGRQL
AROK_ACTP2       ------------------------------------MAEKRNIFLIGPMGAGKSTIGRQL
AROK_HAEDU       ------------------------------------MAEKRNIFLVGPMGAGKSTIGRQL
AROK_ACTSZ       ------------------------------------MAEKRNIFLVGPMGAGKSTIGRQL
AROK_MANSM       ------------------------------------MAEKRNIFLVGPMGAGKSTIGRQL
AROK_HAEIN       ------------------------------------MAEKRNIFLVGPMGAGKSTIGRQL
AROK_HAEIG       ------------------------------------MAEKRNIFLVGPMGAGKSTIGRQL
AROK_HAEIE       ------------------------------------MAEKRNIFLVGPMGAGKSTIGRQL
AROK_HAEI8       ------------------------------------MAEKRNIFLVGPMGAGKSTIGRQL
AROK_PASMU       ------------------------------------MAEKRNIFLIGPMGAGKSTIGRQL
AROK_HISS2       ------------------------------------MAEKRNIFLVGPMGAGKSTIGRQL
AROK_BUCBP       ------------------------------------MTEKRNIFLIGPMGAGKSTIGRHL
AROK_PSYIN       ------------------------------------MAEQRNIFLIGPMGAGKSTIGRHL
AROK_FRATF       ------------------------------------MIRTKNIFLIGPVGAGKSTIGKQL
AROK_FRATH       ------------------------------------MIRTKNIFLIGPVGAGKSTIGKQL
AROK_FRATO       ------------------------------------MIRTKNIFLIGPVGAGKSTIGKQL
AROK_FRATM       ------------------------------------MIRTKNIFLIGPVGAGKSTIGKQL
AROK_FRATN       ------------------------------------MIRTKNIFLIGPVGAGKSTIGKQL
AROK_FRATT       ------------------------------------MIRTKNIFLIGPVGAGKSTIGKQL
AROK_FRAT1       ------------------------------------MIRTKNIFLIGPVGAGKSTIGKQL
AROK_FRATW       ------------------------------------MIRTKNIFLIGPVGAGKSTIGKQL
AROK_FRAP2       ------------------------------------MIRTKNIFLIGPVGAGKSTIGKQL
AROK_LEGPC       ----------------------------------MSIVKVRNIFLIGPMGAGKSTIGRAL
AROK_LEGPL       ----------------------------------MSIVKVRNIFLIGPMGAGKSTIGRAL
AROK_LEGPA       ----------------------------------MSIVKVRNIFLIGPMGAGKSTIGRAL
AROK_LEGPH       ----------------------------------MSIVKVRNIFLIGPMGAGKSTIGRAL
AROK_METCA       ------------------------------------MRNRRNIFLIGPMGAGKTTVGRLL
AROK_PSEAE       ---------------------------------------MVNLILVGPMGAGKSTIGRLL
AROK_PSEA8       ---------------------------------------MVNLILVGPMGAGKSTIGRLL
AROK_PSEAB       ---------------------------------------MVNLILVGPMGAGKSTIGRLL
AROK_PSEA7       ---------------------------------------MVNLILVGPMGAGKSTIGRLL
AROK_PSEP1       ---------------------------------------MRNLILVGPMGAGKSTIGRLL
AROK_PSEPK       ---------------------------------------MRNLILVGPMGAGKSTIGRLL
AROK_PSEE4       ---------------------------------------MRNLILVGPMGAGKSTIGRLL
AROK_PSEF5       ---------------------------------------MRNLILVGPMGAGKSTIGRLL
AROK_PSEPF       ---------------------------------------MRNLILVGPMGAGKSTIGRLL
AROK_PSE14       ---------------------------------------MRNLILVGPMGAGKSTIGRLL
AROK_PSESM       ---------------------------------------MRNLILVGPMGAGKSTIGRLL
AROK_PSEU2       ---------------------------------------MRNLILVGPMGAGKSTIGRLL
AROK_HAHCH       -----------------------MLRYRGVSIWTVRVKAKKNVVLVGPMGTGKTTIGKLL
AROK_ACIBY       -------------------------------MPSKAFETLPNIYLVGPMGAGKTTVGRHL
AROK_ACIBS       -------------------------------MPSKAFETLPNIYLVGPMGAGKTTVGRHL
AROK_ACIAD       -------------------------------MPSKEFDTLPNIYLVGPMGAGKTTVGRHL
AROK_PSYA2       -----------------------------------MVEELPSVFLVGPMGAGKTTIGRLL
AROK_PSYCK       -----------------------------------MVEELPSVFLVGPMGAGKTTIGRLL
AROK_PSYWF       -----------------------------------MQSTLPSLFIVGPMGAGKTTVGKLL
AROK_COXBU       -----------------------------------MKKNLTNIYLIGLMGAGKTSVGSQL
AROK_COXB2       -----------------------------------MKKNLTNIYLIGLMGAGKTSVGSQL
AROK_COXBR       -----------------------------------MKKDLTNIYLIGLMGAGKTSVGSQL
AROK_COXBN       -----------------------------------MKKNLTNIYLIGPMGAGKTSVGSQL
AROK_COXB1       -----------------------------------MKKNLTNIYLIGPMGAGKTSVGSQL
AROK_AROAE       ----------------------------------------MLVVLVGMMGAGKTTVGREY
AROK_DECAR       -------------------------MSTQDSAKITTVEHRRNIYLVGLMGAGKTTVGRQL
AROK_NEIMA       -----------------------------------MKNFNGKLILIGLMGAGKTTLGRQM
AROK_NEIMB       -----------------------------------MKNFNGKLILIGLMGAGKTTLGRQM
AROK_NEIM0       -----------------------------------MKNFNGKLILIGLMGAGKTTLGRQM
AROK_NEIG1       -----------------------------------MKNFNGKLILIGLMGAGKTTLGRQM
AROK_THIDA       ------------------------------------MSKRDNLYLVGLMGAGKTTVGRLL
AROK_NITEU       --------------MHFRYNYRMQRSKTPNTKNSDTGSIPGNIILIGMMGSGKTTVGKLL
AROK_NITMU       -----------------MISTDAVAPAVDVKGEAGDRAATGNIFLVGMMGAGKTTVGRLL
AROK_BURMA       ---------------------------------MQARDPHVNVIFVGLMGAGKTTVGRAV
AROK_BURPS       ---------------------------------MQARDPHVNVIFVGLMGAGKTTVGRAV
AROK_BURP1       ---------------------------------MQARDPHVNVIFVGLMGAGKTTVGRAV
AROK_BURTA       ---------------------------------MQARDPHVNVIFVGLMGAGKTTVGRAV
AROK_BURL3       ---------------------------------MQARDPHANVFFVGLMGAGKTTVGRAV
AROK_RALSO       -------------------------------------MSVSNVFFVGLMGAGKTTVGRAV
AROK_CUPPJ       -----------------------------------METGRPNLFFVGLMGAGKTTVGRTV
AROK_BORPA       MNASANLCAASANDPQPGDQEAAHPVACAGDEPAAFLPHDLPIFLVGMMGAGKTTIGRGL
AROK_BORPE       MNASANLCAASANDPQPGDQEAAHPVACAGDEPAAFLPHDLPIFLVGMMGAGKTTIGRGL
AROK_BORBR       MNASANLCAASDNDPQPGDQEAAHPVACAGDEPAAFLPHDLPIFLVGMMGAGKTTIGRGL
AROK_BORA1       MTLSVNLCSGA--EALPTEQEAA-SLAVECIEPLAQLPHDLPIFLVGMMGAGKTTIGRGL
AROK_CHRVO       --------------------------------MPAMEKLAGNFFLVGLMGAGKTTVGRAL
AROK_NITOC       -------------------------------------MLNFNIFLVGPMGSGKTTIGRYL
AROK_HYDCU       -------------------------------------MHRESIFLVGPMGAGKSTVGRFL
AROK_ACIAC       -----------------------------------MRGPQLSIHLIGLPGSGKSTVGRHL
AROK_STRMK       ------------------------------------MNPAPNLILIGPMGAGKTCIGRRL
AROK_STRM5       ------------------------------------MNPAPNLILIGPMGAGKTCIGRRL
AROK_XANAC       ------------------------------------MNPAPNLVMVGPMGAGKSCIGRRL
AROK_XANC5       ------------------------------------MNPAPNLVMVGPMGAGKSCIGRRL
AROK_XANOR       ------------------------------------MNPAPNLVMVGPMGAGKSCIGRRL
AROK_XANOM       ------------------------------------MNPAPNLVMVGPMGAGKSCIGRRL
AROK_XANOP       ------------------------------------MNPAPNLVMVGPMGAGKSCIGRRL
AROK_XANCP       ------------------------------------MNPAPNLVMIGPMGAGKSCIGRRL
AROK_XANC8       ------------------------------------MNPAPNLVMIGPMGAGKSCIGRRL
AROK_XYLF2       ------------------------------------MNPAPNLVMIGPMGAGKSSIGRRI
AROK_XYLFT       ------------------------------------MNPAPNLVMIGPMGAGKSSIGRRI
AROK_XYLFM       ------------------------------------MNPAPNLVMIGPMGAGKSSIGRRI
AROK_XYLFA       ------------------------------------MNPAPNLVMIGPMGAGKSSIGRRI
AROK_BARHE       --------MKSNRPKHIPITKI--------KNQLLSSLDNRALVLIGLMGVGKSVIGKRI
AROK_BARQU       --------MKTNHPKHIPITQI--------KKQLLSSLDKRALVLVGLMGAGKSVIGKRI
AROK_BRUAB       ---------MSGTNKQTNLHRQ--------TETIRQLLGSKVVVLVGLMGAGKSTIGRKV
AROK_BRUA2       ---------MSGTNKQTNLHRQ--------TETIRQLLGSKVVVLVGLMGAGKSTIGRKV
AROK_BRUSU       ---------MSGTNKQTNLHRQ--------TETIRQLLGSKVVVLVGLMGAGKSTIGRKV
AROK_RHILO       ----------MNAHQANPPGES--------LAALLGRLGSRSIVFVGLMGAGKTAIGRKV
AROK_RHIME       ----------MNDVTEPVSATL--------AERAKRTLGKRNLVFIGLMGAGKSAIGRLT
AROK_BRADU       -----------MSDAALPIQA--SP-----EADILSALGARSIVLVGMMGVGKSTIGRRM
AROK_RHOPA       --------MPRMSETVPTAAAGRSPQ----EAEIVAALGDRPVVLIGMMGAGKSTVGRRL
AROK_NITWN       ----------MTSETVSPSSFGASP-----ETAVVAALAGRSLALVGMMGAGKSTIGRRL
AROK_CAUVC       ---------MTETDQTPDTAPEAAPEVAPIVSDDLAPLRAKTIVLVGLMGVGKSSVGRRL
AROK_ZYMMO       ---------MLQSPSSP---------------------YPRTITLIGMMGVGKSTIGRRL
AROK_NOVAD       ----------MEHDAALLSSSE---------IDRIGRRIGRPLVLVGMMGVGKTTVGRKL
AROK_MAGSA       ----------MDQGMADELARL---------APLLSGRIGRTIVLVGLMGAGKSCVGRRL
AROK_RHORT       ----------MIEAEENTLA------------------LPRTLVLVGLMGAGKTCIGRRL
AROK_RHOS4       ----------------MKVGAEVRRRGNREDGRQVMARLKKTVVMVGMMGAGKTAVGSAL
AROK_RUEPO       -----------MSKIEHNSAKT---------IDGGAAALHKTVVMVGMMGAGKTAVGRAL
AROK_NOSS1       ---------------------------------MSSLLQGVNLYLIGMMGAGKTTVGHLL
AROK_TRIV2       ---------------------------------MSSLLQGVNLYLIGMMGAGKTTVGHLL
AROK_NOSP7       ---------------------------------MSSLLQGVNLYLIGMMGVGKTTVGPLL
AROK_RIPO1       -------------------------------MKTQKLLQGINIYLIGMMGSGKSTIGKIL
AROK_MICAN       ----------------------------MDNSTDFNSLRGLSVFLLGMMGSGKSTLGELL
AROK_SYNY3       ----------------------------MAQDLIKEQLQGVNLFLIGMMGSGKSTVGPLL
AROK_SYNE7       -------------------------------MSLVTALNGLDLFLVGLMGSGKTTIGKLL
AROK_SYNP6       -------------------------------MSLVTALNGLDLFLVGLMGSGKTTIGKLL
AROK_THEEB       -------------------------------MKLQERLGGANIYLVGMMGAGKTTTGRLL
AROK_SYNJB       ----------------------------MIHPEEVERLRGVNVYLIGMMGSGKSTVGSEL
AROK_SYNJA       ----------------------------MIQPEEAERLRGVTVYLIGMMASGKSTLGAEL
AROK_GLOVI       ------------------------------------MLKGVSLYLVGMMGSGKSTVGRLL
AROK_PROMA       ------------------------MTYKLRPNQVIKKLGGRIIYLVGMMGSGKSTTGPHL
AROK_PROMT       ------------------------MAVQSTPKTLKEKLGGRNIFLIGMMGSGKSQTGPVL
AROK_SYNSC       ------------------MSYSGFRVMADSTPTLKKRLSGRSLYLVGMMGSGKTSTGRPL
AROK_SYNPX       --------------------------MSDATLSLKQRLGGRSLYLVGMMGSGKTSTGRPL
AROK_SYNS9       --------------------------MTDPILSLKERLSGRSIYLIGMMGSGKTSTGRPL
AROK_PROMM       ------------------------MNESPAPHPLKQRLGGRNLYLVGMMASGKSSTGRPL
AROK_LACF3       ----------------------------------------MNLILVGFMGSGKTTVSTLL
AROK_CHLP8       ------------------------------------MKHHSLIFLTGFSGSGKSTIGPLL
AROK_CHLTE       ------------------------------------MKHHSLIFLTGFSGSGKSTIGPLL
AROK_CHLL2       ------------------------------------MKHHSLIFLTGFSGSGKSTIGPLL
AROK_CHLPD       ------------------------------------MKHHSLIFLTGFSGSGKSTIGPLL
AROK_CHLPB       ------------------------------------MKHPSLIFLTGFSGSGKSTIGPLL
AROK_PROA2       ------------------------------------MKQPSLIYLTGFSGSGKSTIGPLL
AROK_CHLCH       -----------------------------------MQKEPSLIFLTGFSGSGKSTIGPLL
AROK_PELLD       ------------------------------MGQDTITKQHSLIFLTGFSGSGKSTIGPLL
AROK_CHLPM       -----------------------------------MEKQHSLIFLTGFSGSGKSSIGPLL
AROK_CHLT3       ------------------------------------MKKPSLIFLTGFSTSGKSTIGPLL
AROK_SALRD       ---------------MEWSLAEDDALAYSPLFLPNFRPFPMRVYLTGFMASGKSTVGPEA
AROK_AQUAE       ----------------------------------------MRIYLIGFMCSGKSTVGSLL
AROK_THET2       ------------------------------MARLEVPRPATFVTLTGFMGVGKSRIGREL
AROK_THET8       ------------------------------MARLEVPRPATFVTLTGFMGVGKSRIGREL
AROK_DEIRA       -----------------------------MFPSGLIERPANWVALAGFMGTGKSRIGWEL
AROK_THEP3       ---------------------------------------MKNIVLTGFMATGKTTVGKKV
AROK_THEPX       ---------------------------------------MKNIVLTGFMATGKTTVGKKV
AROK_CALS4       ---------------------------------------MKNIVLTGFMGTGKTTVGKKV
AROK_THEYD       ---------------------------------------MKNIVLIGFMGTGKTSVGKLV
AROK_CALS8       ---------------------------------------MKNIVLTGFMGSGKTTIGRLV
AROK_DESAP       ---------------------------------------MRNVILIGFMGTGKSAVGWRL
AROK_PELTS       ---------------------------------------MKNIVLIGFMGTGKTAVGRRL
AROK_GEOMG       ----------------------------MATSTISAPSSVRNVILTGFMGTGKSSVGRLL
AROK_GEOSL       ---------------------------MRGTWSMSVPSDGRNVVLTGFMGTGKSTVGKLL
AROK_MOOTA       --------------------------------------MPGNIVLIGFMGSGKTTVGRLL
AROK_SYMTH       ----------------------------------------MNIVLVGLMGSGKTAVGRLL
AROK_DESAG       ---------------------------------------MERIFLIGARASGKTTAGRIL
AROK_DESVH       -----------------------------------MGSEVCRVFLIGGRASGKSTVGRAL
AROK1_PELCD      --------------------------------------MATTIYLIGARASGKTTIGRAL
AROK2_PELCD      --------------------------------------MTQTIFMVGARAAGKTTIGQAL
AROK_RHOBA       --------------------------------MNNDEVKPQHLYLTGYRGCGKSTLAKLL
AROK_SYNAS       -----------------------------MIRMTETENDDRNIILIGYRGTGKTSVGQEL
AROK_DEHMB       ------------------------------------MKTKNNIALIGFMGAGKSSISKLL
AROK_DEHMC       ------------------------------------MKTKNNIALIGFMGAGKSSISKLL
AROK_DEHM1       ------------------------------------MKIKNNIALIGFMGAGKSSVSKLL
AROK_LEPBA       ---------------------------------------MMNIILIGARGAGKSKVSRSL
AROK_LEPBP       ---------------------------------------MMNIILIGARGAGKSKVSRSL
AROK_CHLMU       ---------------------------------MPTFDTTKQIFLCGLPSVGKTSFGRLL
AROK_CHLTR       ---------------------------------MPTFDTTKQIFLCGLPSVGKTSFGQHL
AROK_CHLPN       ----------------------------------------MTIILCGLPTSGKSSLGKAL
                                                             . *    **:      

AROK_ALKOO       ADQLDYNFIDLDLF-IEKKESM---SISEIFRLKGEAYFRQKES-EALDLLSD---VEQS
AROK_FUSNN       AKTMDMKFVDIDKV-IEAHEKK---SINDIFHEKGQIYFRDLER-EIILQESL---KNDC
AROK_BACFR       ARELHIPFIDLDWY-IEERFHK---TVGELFSERGEASFRELEKNMLHEV-GE---FEDV
AROK_BACFN       ARELHIPFIDLDWY-IEERFHK---TVGELFSERGEASFRELEKNMLHEV-GE---FEDV
AROK_BACTN       ARKLNVPFIDLDWY-IEERFHK---TVGELFTERGEAGFRELERNMLHEV-AE---FENV
AROK_BACV8       AREMSLNFIDLDWF-IEERFHK---TVQQLFLERGEDGFRELERKMLHEV-AE---FEDV
AROK_PARD8       AKLAGLSFIDLDYY-IEGRYHK---AVSQIFAERGEEAFREIERNMLHEV-AE---FEDV
AROK_AZOPC       AEKLNLSFIDTDFF-IKNRYKK---EITDIFAGEGEEKFRRIEQKILQEIIQK---WENI
AROK_FLAJ1       SKITQIPFLDLDIC-IEKRANL---SIKEIFEQHGEIYFRKLEHEMFLELLQS---SENA
AROK_METI4       SKAKSIPFYDLDQL-IEGKERA---TIPEIFASKGVEYFREQEREIVKQV-AY---SSPG
AROK_BACLD       SKKLGRDFIDIDHE-IEKDFQM---TIPEMFQQKGEAFFRQTEKEYIFQMCEH---TMGN
AROK_BACP2       AKKLYRDFIDVDQE-IEKKYNM---TIPEMFQQKGEAFFRQAEKDYIVDLCEH---TQLK
AROK_BACSU       AKKLYRDFIDIDQQ-IEKDFNM---SIPEIFEKKGEDFFRKTEKEYILDICHH---KRFK
AROK_GEOKA       AKKLYRDFIDVDAE-IERRQGM---SIPELFAQKGEAYFRKVERELIVDLCTN---TRLK
AROK_GEOTN       AKKLYRDFIDVDAE-IERRQGM---SIPEIFAQKGEAYFRKVERELIVDLCTN---TRLK
AROK_OCEIH       AKKLYRDFIDIDEE-IEKRFKM---PTKDIFRLYGEKTFRNAEKDIISEICQQ----RLK
AROK_BACHD       AKRLFRDFIDVDQE-IEKTWKM---KISDIFRLKGEEAFRKIEREMTIDYCTN---TSLK
AROK_CLOB1       SKILKYDLIDTDTL-IEEMEDK---SIKEIFKIYGEDYFREKELKIINKLKK----ESNK
AROK_CLOBH       SKILKYDLIDTDTL-IEEMEDK---SIKEIFKIYGEDYFREKELKIINKLKK----ESNK
AROK_CLOBL       SKILKYDLIDTDTL-IEEMEDK---SIKEIFKIYGEDYFREKELEIINKFKK----ESNK
AROK_CLOBK       SKILKYDLIDTDTL-IEEMEDK---SIKEIFKIYGEDYFREKELEIINKLKK----ESNK
AROK_CLOBM       SKILKYDLIDTDTL-IEEMEDK---SIKEIFKIYGEDYFREKELKIINKLKK----ESNK
AROK_HELPY       GLALKLEVLDTDMI-ISERVGL---SVREIFEELGEDNFRMFEKNLIDELKTL---KTPH
AROK_HELPJ       GLALKLEVLDTDMI-ISERVGL---SVRGIFEELGEDNFRMFEKNLIDELKTL---KTPH
AROK_HELPG       GLALKLEVLDTDMI-ISERVGL---SVREIFEELGEDNFRMFEKNLIDELKTL---KTPH
AROK_HELP2       GLALKLEVLDTDMI-ISERVGL---SVREIFEELGEDNFRMFEKNLIDELKTL---KTPH
AROK_HELPH       GLALKLEVLDTDMI-ISERVGL---SVREIFEELGEDNFRMFEKNLIDELKTL---KTPH
AROK_HELAH       GLALNLEVLDTDMI-ISERVGL---SVRGIFEELGEDNFRMFEKNLIDELKML---KNPH
AROK_HELHP       ALLGGRFLLDTDQI-IEQNMGK---SINEIFESVGESGFRRIESQLILWLSAN---VKNA
AROK_CLOBA       SKELLLKFIDMDIY-IEEKTSK---TISELFEQ-GEDYFRDIESEACKEIIK----YDNV
AROK_CLOBB       AKELMLKFIDMDIC-IEEKTSK---TISELFEQ-GEDYFRDIESETCKEIIK----YDNV
AROK_CLOB8       SEELKINFIDMDNY-IENMTSK---TIPELFEH-GENYFRDFESLACRELAK----EGKA
AROK_DICTD       SLFFNIPFLDLDEY-IEKKLKK---SISDIFIEKGEEYFRNIETESLREAFSL---YPKI
AROK_BACC7       SKELHMDVIDTDQK-IEEKQEK---EIRDIFAEEGEMAFREYESEMLRSLP-----VENV
AROK_BACC0       SKELHMDVVDTDQK-IEENQEK---AILDIFAEEGEMAFREYESEMLRSLP-----VRNA
AROK_BACMK       SKELHMDVVDTDQK-IEEKQEK---AIRDIFAEEGEMAFREYESEMVRSLP-----VQNV
AROK_BACC2       SQELQMDVVDTDQK-IEEKQKK---AIRDIFAEEGEMTFREYESEMLRSLP-----VHNV
AROK_BACCN       SKELGIDVIDTDQK-IEEKQGR---VIRDIFAKEGERSFRQYESEMLCSLP-----TKDV
AROK_STAAC       ADEQNLSFIDIDSY-IEEKYKL---TIPEIFCKHGEQYFRNLEFTCLQECI-----NTAD
AROK_STAA8       ADEQNLSFIDIDSY-IEEKYKL---TIPEIFCKHGEQYFRNLEFTCLQECI-----NTAD
AROK_STAAE       ADEQNLSFIDIDSY-IEEKYKL---TIPEIFCKHGEQYFRNLEFTCLQECI-----NTAD
AROK_STAAT       ADEQNLSFIDIDSY-IEEKYKL---TIPEIFCKHGEQYFRNLEFTCLQECI-----NTAD
AROK_STAAS       ADEQNLSFIDIDSY-IEEKYKL---TIPEIFSKHGEQYFRNLEFTCLQECI-----NTAD
AROK_STAAW       ADEQNLSFIDIDSY-IEEKYKL---TIPEIFSKHGEQYFRNLEFTCLQECI-----NTAD
AROK_STAA1       ADEQNLSFIDIDSY-IEEKYKL---TIPEIFSKHGEQYFRNLEFTCLQECI-----NTAD
AROK_STAAM       ADEQNLSFIDIDSY-IEEKYKL---TIPEIFSKHGEQYFRNLEFTCLQECI-----NTAD
AROK_STAAN       ADEQNLSFIDIDSY-IEEKYKL---TIPEIFSKHGEQYFRNLEFTCLQECI-----NTAD
AROK_STAA2       ADEQNLSFIDIDSY-IEEKYKL---TIPEIFSKHGEQYFRNLEFTCLQECI-----NTAD
AROK_STAA9       ADEQNLSFIDIDSY-IEEKYKL---TIPEIFSKHGEQYFRNLEFTCLQECI-----NTAD
AROK_STAAR       ADEQNLSFIDIDSY-IEEKYKL---TIPEIFSKHGEQYFRNLEFTCLQECI-----NTAD
AROK_STAES       SDLYNLSYVDLDNF-IEVNECK---SIPNIFNDIGEKGFRSLETRYLKSCL-----NTFD
AROK_STAEQ       SDLYNLSYVDLDNF-IEVNECK---SIPNIFNDIGEKGFRSLETRYLKSCL-----NTFD
AROK_STAS1       ASNNQLSYIDLDEH-IAIQENK---SIPEIFEAIGEQGFRKLENEYLQECV-----QRYD
AROK_STAHJ       SLEKQLSFIDLDVY-IEIKENK---TIPEIFEEVGEIGFRKIEYNYLTECT-----KKYD
AROK_LACLM       AKLLAEEFTDLDKL-IEEEIEM---PIATFFELFGEADFRKIENEVFELAV-----QKDI
AROK_LACLS       AKLLAEEFTDLDKL-IEEEIEM---PIATFFELFGEADFRKIENEVFELAV-----QKDI
AROK_LACLA       AKLLTENFTDLDQL-IEEEIEM---TIAEFFELFGEADFRKIENEVFELAL-----QKNI
AROK_STRPB       SKHLSMHCKDMDAI-IEAKIGM---SIAAFFEQHGEIAFRTIESQVLKDLLFA---NDNS
AROK_STRPC       SKHLSMHCKDMDAI-IEAKIGM---SIAAFFEQHGEIAFRTIESQVLKDLLFA---NDNS
AROK_STRPD       SKHLSMHCKDMDAI-IEAKIGM---SIAAFFEQHGEIAFRTIESQVLKDLLFA---NDNS
AROK_STRPZ       SKHLSMHCKDMDAI-IEAKIGM---SIAAFFEQHGEIAFRTIENQVLKDLLFA---NDNS
AROK_STRPG       SKHLSMHCKDMDAI-IEAKIGM---SIAAFFEQHGEIAFRTIENQVLKDLLFA---NDNS
AROK_STRPF       SKHLSMHCKDMDAI-IEAKIGM---SIAAFFEQHGEIAFRTIESQVLKDLLFT---NDNS
AROK_STREM       AAQLDEHFLDMDRL-IEAKIGM---SISAFFSYRGEAAFRKLESDTLQEVLAL---DNET
AROK_STRTD       APYLNGRFVDMDQV-IEDKIGM---SITDFFAKEGEASFRQIESETLEELLQE---GDDV
AROK_STRSY       AHLLNLPVYDMDHI-IEERIGM---PIADYFSLEGEASFRQLETEVLKGLLDL---PSNC
AROK_STRS2       AHLLNLPVYDMDHI-IEERIGM---PIADYFSLEGEASFRQLETEVLKGLLDL---PSNC
AROK_STRGC       GRLLDPNFHDMDEL-IVNQIGM---SINDFFAQEGEEAFRKIETATLESLL-A---NQAK
AROK_ENTFA       ANKLKMPHLDLDTA-LIEKIGR---SIPDYFEKYGEAAFREQETQLLKELS-----KNTA
AROK_SALAI       AELLGVEFRDTDLD-VEATAGK---PISEIFIDEGEAHFRALEREAVAAQLAS----ATG
AROK_SALTO       AELLGVEFRDTDLD-IEATVGK---PISEIFIDEGEAHFRTLERAAVATALAT----TAG
AROK_ACIC1       ASRLAVSFEDTDDV-IEQRAGK---RIAEIFLTDGEAAFRQLEKAVVADRLAA----HTG
AROK_THEFY       AERLGVDLLDTDAE-IERRAGK---TVSDIFVEDGEEAFRALEREVVAEALAS----HPG
AROK_STRAW       AERLGCAYRDTDDD-IVTAEGR---TIADIFVDEGEPVFRAIEKRAVHTALAE----HDG
AROK_STRCO       AERLGTGYRDTDED-IVTAQGR---AIAEIFVDEGEAAFRTLEKEAVRTALAE----HEG
AROK_FRACC       ARRWGVGFRDTDAD-IEAALGT---TVADIFLDHGEEYFRLAERRAVAAALAD----HRG
AROK_SACEN       AERLGVAFRDTDDD-VVRVAGK---PIAEIFTGDGEPVFRAMEERAVAAALAE----HDG
AROK_MYCA1       AKALGVGFLDTDAA-IEQRTGR---PIAEIFATDGEREFRRIEEEVVRAALTE----HDG
AROK_MYCPA       AKALGVGFLDTDAA-IEQRTGR---PIAEIFATDGEREFRRIEEEVVRAALTE----HDG
AROK_MYCBO       AKALGVGLLDTDVA-IEQRTGR---SIADIFATDGEQEFRRIEEDVVRAALAD----HDG
AROK_MYCBP       AKALGVGLLDTDVA-IEQRTGR---SIADIFATDGEQEFRRIEEDVVRAALAD----HDG
AROK_MYCTU       AKALGVGLLDTDVA-IEQRTGR---SIADIFATDGEQEFRRIEEDVVRAALAD----HDG
AROK_MYCTA       AKALGVGLLDTDVA-IEQRTGR---SIADIFATDGEQEFRRIEEDVVRAALAD----HDG
AROK_MYCMM       AKALGVGLLDTDAA-IEQQAGR---SIAEIFATDGEEEFRRIEEEVVRAALAD----HDG
AROK_MYCUA       AKALGVSLLDTDAA-IEQQAGR---SIAEIFATDGEEEFRRIEEEVVRAALVD----HDG
AROK_MYCLE       SKALGVSLLDTDAA-IEKQTGR---SIADIFAIDGEEEFRRIEEGVVRAALVE----HDG
AROK_RHOJR       AQALDLPLFDTDVA-VEEEAGR---TIAEIFVQEGEPAFRALEEEIVRKAIES----HEG
AROK_COREF       ARALNADLVDSDEL-IEKATGK---ACGEVFSELGEPAFRELEAHHVAEALN-----HDG
AROK_CORGL       ARALNTELVDSDEL-IERATGK---ACGAVFSELGEPAFRELEAIHVAEALK-----SSG
AROK_CORDI       ANALNTSVVDSDVL-IEQLQGK---PCGVVFAELGEPNFRDLEAEVIDFALT-----TAG
AROK_CORJK       ANALNLQLVDTDHM-LEKKLGK---TCNQIMGELGEPAFREQEAIVVAEALQ-----TDG
AROK_ECO8A       AQQLNMEFYDSDQE-IEKRTGA---DVGWVFDLEGEEGFRDREEKVINELTE----KQGI
AROK_ECOHS       AQQLNMEFYDSDQE-IEKRTGA---DVGWVFDLEGEEGFRDREEKVINELTE----KQGI
AROK_ECO7I       AQQLNMEFYDSDQE-IEKRTGA---DVGWVFDLEGEEGFRDREEKVINELTE----KQGI
AROK_ECOL6       AQQLNMEFYDSDQE-IEKRTGA---DVGWVFDLEGEEGFRDREEKVINELTE----KQGI
AROK_ECO45       AQQLNMEFYDSDQE-IEKRTGA---DVGWVFDLEGEEGFRDREEKVINELTE----KQGI
AROK_ECOLU       AQQLNMEFYDSDQE-IEKRTGA---DVGWVFDLEGEEGFRDREEKVINELTE----KQGI
AROK_ECO57       AQQLNMEFYDSDQE-IEKRTGA---DVGWVFDLEGEEGFRDREEKVINELTE----KQGI
AROK_ECO24       AQQLNMEFYDSDQE-IEKRTGA---DVGWVFDLEGEEGFRDREEKVINELTE----KQGI
AROK_ECOLI       AQQLNMEFYDSDQE-IEKRTGA---DVGWVFDLEGEEGFRDREEKVINELTE----KQGI
AROK_ECODH       AQQLNMEFYDSDQE-IEKRTGA---DVGWVFDLEGEEGFRDREEKVINELTE----KQGI
AROK_ECOLC       AQQLNMEFYDSDQE-IEKRTGA---DVGWVFDLEGEEGFRDREEKVINELTE----KQGI
AROK_SHISS       AQQLNMEFYDSDQE-IEKRTGA---DVGWVFDLEGEEGFRDREEKVINELTE----KQGI
AROK_SHIFL       AQQLNMEFYDSDQE-IEKRTGA---DVGWVFDLEGEEGFRDREEKVINELTE----KQGI
AROK_SHIDS       AQQLNMEFYDSDQE-IEKRTGA---DVGWVFDLEGEEGFRDREEKVINELTE----KQGI
AROK_SHIBS       AQQLNMEFYDSDQE-IEKRTGA---DVGWVFDLEGEEGFRDREEKVINELTE----KQGI
AROK_SHIB3       AQQLNMEFYDSDQE-IEKRTGA---DVGWVFDLEGEEGFRDREEKVINELTE----KQGI
AROK_ENT38       AQQLNMEFYDSDHE-IEKRTGA---DVGWVFDVEGEEGFRDREEKVINELTE----KQGI
AROK_SALA4       AQQLNMEFYDSDQE-IEKRTGA---DVGWVFDVEGEDGFRNREEKVINELTE----KQGI
AROK_SALCH       AQQLNMEFYDSDQE-IEKRTGA---DVGWVFDVEGEDGFRNREEKVINELTE----KQGI
AROK_SALDC       AQQLNMEFYDSDQE-IEKRTGA---DVGWVFDVEGEDGFRNREEKVINELTE----KQGI
AROK_SALEP       AQQLNMEFYDSDQE-IEKRTGA---DVGWVFDVEGEDGFRNREEKVINELTE----KQGI
AROK_SALG2       AQQLNMEFYDSDQE-IEKRTGA---DVGWVFDVEGEDGFRNREEKVINELTE----KQGI
AROK_SALHS       AQQLNMEFYDSDQE-IEKRTGA---DVGWVFDVEGEDGFRNREEKVINELTE----KQGI
AROK_SALNS       AQQLNMEFYDSDQE-IEKRTGA---DVGWVFDVEGEDGFRNREEKVINELTE----KQGI
AROK_SALPA       AQQLNMEFYDSDQE-IEKRTGA---DVGWVFDVEGEDGFRNREEKVINELTE----KQGI
AROK_SALPK       AQQLNMEFYDSDQE-IEKRTGA---DVGWVFDVEGEDGFRNREEKVINELTE----KQGI
AROK_SALSV       AQQLNMEFYDSDQE-IEKRTGA---DVGWVFDVEGEDGFRNREEKVINELTE----KQGI
AROK_SALTI       AQQLNMEFYDSDQE-IEKRTGA---DVGWVFDVEGEDGFRNREEKVINELTE----KQGI
AROK_SALTY       AQQLNMEFYDSDQE-IEKRTGA---DVGWVFDVEGEDGFRNREEKVINELTE----KQGI
AROK_CITK8       AQQLNMEFYDSDQE-IEKRTGA---DVGWVFDVEGEDGFRDREEKVINELTE----KQGI
AROK_ESCF3       AQQLNMEFYDSDQE-IEKRTGA---DVGWVFDLEGEDGFRDREEKVINELTE----KQGI
AROK_SERP5       AQQLNMEFFDSDQE-IERRTGA---DVGWVFDVEGEEGFRDREEKVINELTE----KQGI
AROK_YERE8       AQQLNMEFFDSDQE-IERRTGA---DVGWVFDVEGEEGFRDREEKVINELTE----KQGI
AROK_YERPE       AQQLNMEFFDSDQE-IERRTGA---DVGWVFDVEGEEGFRDREEKVINELTE----KQGI
AROK_YERPP       AQQLNMEFFDSDQE-IERRTGA---DVGWVFDVEGEEGFRDREEKVINELTE----KQGI
AROK_YERPG       AQQLNMEFFDSDQE-IERRTGA---DVGWVFDVEGEEGFRDREEKVINELTE----KQGI
AROK_YERPA       AQQLNMEFFDSDQE-IERRTGA---DVGWVFDVEGEEGFRDREEKVINELTE----KQGI
AROK_YERPN       AQQLNMEFFDSDQE-IERRTGA---DVGWVFDVEGEEGFRDREEKVINELTE----KQGI
AROK_YERPS       AQQLNMEFFDSDQE-IERRTGA---DVGWVFDVEGEEGFRDREEKVINELTE----KQGI
AROK_YERPB       AQQLNMEFFDSDQE-IERRTGA---DVGWVFDVEGEEGFRDREEKVINELTE----KQGI
AROK_YERP3       AQQLNMEFFDSDQE-IERRTGA---DVGWVFDVEGEEGFRDREEKVINELTE----KQGI
AROK_YERPY       AQQLNMEFFDSDQE-IERRTGA---DVGWVFDVEGEEGFRDREEKVINELTE----KQGI
AROK_PECAS       AQQLNMEFFDSDQE-IERRTGA---DVGWVFDVEGEEGFRDREEKVINELTE----KQGI
AROK_ERWT9       AQQLNMEFFDSDQE-IERRTGA---DVGWVFDVEGEEGFRDREEKIINELTE----KQGI
AROK_SODGM       AQQLNMEFFDSDQE-IERRTGA---DVGWVFDVEGEDGFRDREEKVINELTE----KQGI
AROK_PHOLL       AQQLNMEFYDSDQE-IERRTGA---DVGWVFDVEGEEGFREREEKVINELTE----KQGI
AROK_BAUCH       AQQLNMEFFDSDQE-IERLTGA---DIGWVFDVEGEDGFRSREEKVINELTE----KQGI
AROK_AERHH       AEQLHMEFFDSDHE-IERRSGA---DIGWVFDVEGEEGFRIREEKVIGDLSE----QQGI
AROK_AERS4       AEQLHMEFFDSDHE-IERRSGA---DIGWVFDVEGEEGFRIREEKVIGDLSE----QQGI
AROK_ALTMD       ADELHLDFFDSDQE-IERRTGA---DIAWIFDLEGEDGFRAREENVINDLTD----KQGI
AROK_PSEA6       ADELHLEFYDSDQE-IEKRTGA---DIAWIFDLEGEEGFRAREETVINDLTD----KQGI
AROK_SHEB5       AQMLHLEFHDSDQE-IEQRTGA---DIAWVFDVEGEEGFRRREAQVIADLSE----KQGI
AROK_SHEB8       AQMLHLEFHDSDQE-IEQRTGA---DIAWVFDVEGEEGFRRREAQVIADLSE----KQGI
AROK_SHEB9       AQMLHLEFHDSDQE-IEQRTGA---DIAWVFDVEGEEGFRRREAQVIADLSE----KQGI
AROK_SHESA       AQMLHLEFHDSDQE-IEQRTGA---DIAWVFDVEGEEGFRRREAQVIADLSE----KQGI
AROK_SHESM       AQMLHLEFHDSDQE-IEQRTGA---DIAWVFDVEGEEGFRRREAQVIADLSE----KQGI
AROK_SHESR       AQMLHLEFHDSDQE-IEQRTGA---DIAWVFDVEGEEGFRRREAQVIADLSE----KQGI
AROK_SHEPC       AQMLHLEFHDSDQE-IEQRTGA---DIAWVFDVEGEEGFRRREAQVIADLSE----KQGI
AROK_SHESW       AQMLHLEFHDSDQE-IEQRTGA---DIAWVFDVEGEEGFRRREAQVIADLSE----KQGI
AROK_SHEON       AQMLHLEFHDSDQE-IEQRTGA---DIAWVFDVEGEEGFRRREAQVIADLSE----KQGI
AROK_SHEDO       AQLLHLEFHDSDHE-IEQRTGA---DIAWVFDVEGEEGFRRREAQVIADLSE----KQGI
AROK_SHEFN       AQMLHLDFHDSDHE-IEQRTGA---DIAWVFDVEGEEGFRRREAQVIGDLSE----RQGI
AROK_SHEAM       AQMLHLEFHDSDQE-IESRTGA---DIAWVFDVEGEEGFRRREAQVIADLTE----KQGI
AROK_SHEHH       AQMLHLEFHDSDQE-IESRTGA---DIAWVFDVEGEEGFRNRETQVVADLTE----KQGI
AROK_SHEPA       AQMLHLEFHDSDQE-IESRTGA---DIAWVFDVEGEEGFRIRETQVVADLTE----KQGI
AROK_SHESH       AQMLHLDFHDSDQE-IESRTGA---DIAWVFDVEGEEGFRVRETQVVADLTE----KQGI
AROK_SHEWM       AQMLHLEFHDSDQE-IESRTGA---DIAWVFDVEGEEGFRIRETQVVADLTE----KQGI
AROK_SHELP       AQMLHLEFHDSDQE-IENRTGA---DIAWVFDVEGEEGFRRRETQVVADLTE----KQGI
AROK_COLP3       ADRLHLEFFDSDQE-IERRTGA---DIAWVFDLEGEEGFRKREETVIEDLSE----KHGI
AROK_PSET1       ADQLHLEFVDSDQE-IERRTGA---DIAWVFDLEGEEGFRLREESVIGDLTE----MQGI
AROK_IDILO       ARQLHLEFYDSDSE-IERRTGA---EISWVFELEGEEGFRAREEKVIEELTE----NMGI
AROK_ALIF1       AQQLHMEFLDSDTV-IEERTGA---DIAWVFDVEGEEGFRKREEGVINDLTQ----EQGI
AROK_ALIFM       AQQLHMEFLDSDTV-IEERTGA---DIAWVFDVEGEEGFRKREEGVINDLTQ----EQGI
AROK_ALISL       AQQLHMEFLDSDTV-IEERTGA---DIAWVFDVEGEEGFRIREEGVINDLTQ----EQGI
AROK_PHOPR       AQQLHMEFFDSDTV-IEDRTGA---DISWVFDVEGEEGFRVREEGVIDDLTQ----EQGI
AROK_VIBCH       AQQLHMEFIDSDTV-IEERTGA---DIAWVFDVEGEEGFRKREEAVINDLTE----QQGI
AROK_VIBC3       AQQLHMEFIDSDTV-IEERTGA---DIAWVFDVEGEEGFRKREEAVINDLTE----QQGI
AROK_VIBCB       AQQLHMEFVDSDTV-IEERTGA---DIAWVFDVEGEEGFRKREEAVLEDLTQ----EQGI
AROK_VIBPA       AQQLHMEFVDSDTV-IEERTGA---DISWVFDVEGEEGFRKREEAVLEDLTQ----EQGI
AROK_VIBVU       AQQLHMEFLDSDTV-IEERTGA---DISWVFDVEGEEGFRKREEAVINDLTL----EQGI
AROK_VIBVY       AQQLHMEFLDSDTV-IEERTGA---DISWVFDVEGEEGFRKREEAVINDLTL----EQGI
AROK_BUCAI       SQQLNMEFFDSDQE-IEKRTGA---DISWVFDVEGESGFRLREQRVIDELTT----KQGI
AROK_BUCAP       SQQLNMEFFDSDQE-IEKRTGA---NISWVFDVEGEHGFRQREVKVIDELTK----KQGI
AROK_WIGBR       SQQLSMEFFDSDQE-IEKRTGA---DISWVLDLEGENKFRIREEKIINEITE----KQGI
AROK_BLOFL       AQRLNLEFFDSDRE-IETCTGV---NISWVFDVEGEVGFRNREEKIIDELTQ----KKSI
AROK_BLOPB       ANQLNMEFFDSDQE-IETRTGA---NISWVFDVEGEERFRDREEKIIDELTK----KQGI
AROK_ACTPJ       AQMLGMEFIDSDAV-IEERAGA---DIDWIFDLEGETGFRKREERIINELTQ----NQGV
AROK_ACTP2       AQMLGMEFIDSDAV-IEERAGA---DIDWIFDLEGETGFRKREERIINELTQ----NQGV
AROK_HAEDU       AQMLNMDFIDSDAV-IEERAGA---SIDWIFDIEGEAGFRKREERIINELTKG---QQGI
AROK_ACTSZ       AQQLGMEFFDSDSV-IEERAGA---EISWIFDIEGENGFRKREERIINELTQ----KQGI
AROK_MANSM       AQLLNMEFIDSDNE-IEQRAGA---DISWIFDIEGEDGFRKREERIINELTQ----KQGI
AROK_HAEIN       AQQLNMDFIDSDAV-IEERTGA---DISWIFDLEGEDGFRKREERIINELTQ----MQGI
AROK_HAEIG       AQQLNMDFIDSDAV-IEERTGA---DISWIFDLEGEDGFRKREERIINELTQ----MQGI
AROK_HAEIE       AQQLNMDFIDSDAV-IEERTGA---DISWIFDLEGEDGFRKREERIINELTQ----MQGI
AROK_HAEI8       AQQLNMDFIDSDAV-IEERTGA---DISWIFDLEGEDGFRKREERIINELTQ----MQGI
AROK_PASMU       AQLLSMDFVDSDNE-IEQRAGA---DISWIFDVEGEDGFRKREERIINELTQ----RQGI
AROK_HISS2       AQILGMEFIDTDAE-IEQRAGA---DISWIFDVEGEEGFRKREERIINELTQ----KQGI
AROK_BUCBP       AQQLSMEFYDSDQE-IEKRTGV---DVSWIFDIEGELGFRKREQKIISEIID----KRGI
AROK_PSYIN       AQMLHLDFLDSDAE-IEKKTGA---DIAWVFDVEGEEGFRNREQSMIDELTQ----KHGI
AROK_FRATF       AKQLKLEFIDSDDV-IEKKCGV---DINWIFDLEGEEGFRKREREVISEILAE---KQNI
AROK_FRATH       AKQLKLEFIDSDDV-IEKKCGV---DINWIFDLEGEEGFRKREREVISEILAE---KQNI
AROK_FRATO       AKQLKLEFIDSDDV-IEKKCGV---DINWIFDLEGEEGFRKREREVISEILAE---KQNI
AROK_FRATM       AKQLKLEFIDSDDV-IEKKCGV---DINWIFDLEGEEGFRKREREVIAEILAE---KQNI
AROK_FRATN       AKQLKLEFIDSDDV-IEKKCGV---DINWIFDLEGEEGFRKREREVIAEILAE---KQNI
AROK_FRATT       AKQLKLEFIDSDDV-IEKKCGV---DINWIFDLEGEEGFRKREREVIAEILAE---KQNI
AROK_FRAT1       AKQLKLEFIDSDDV-IEKKCGV---DINWIFDLEGEEGFRKREREVIAEILAE---KQNI
AROK_FRATW       AKQLKLEFIDSDDV-IEKKCGV---DINWIFDLEGEEGFRKREREVIAEILAE---KQNI
AROK_FRAP2       AKQLKLEFIDSDDT-IEKKCGV---DINWIFDLEGEEGFRKRERDVIAEILAE---KQNI
AROK_LEGPC       AKELKLEFYDSDEV-IEERAGA---DISWIFDIEGEEGFRRREQKVIDE-LTQ---KTNI
AROK_LEGPL       AKELKLEFYDSDEV-IEERAGA---DISWIFDIEGEEGFRRREQKVIDE-LTQ---KTNI
AROK_LEGPA       AKELKLEFYDSDEV-IEERAGA---DISWIFDIEGEEGFRRREQKVIDE-LTQ---KTNI
AROK_LEGPH       AKELKLEFYDSDEV-IEERAGA---DISWIFDIEGEEGFRRREQKVIDE-LTQ---KTNI
AROK_METCA       ARALGMEFWDSDKE-IERRTGV---TVPMIFEYEGEAGFRRRESEVIADLTG----KERI
AROK_PSEAE       AKELHLAFKDSDKE-IEQRCGA---NIPWIFDVEGEVGFREREQAMLTELCA----ADGM
AROK_PSEA8       AKELHLAFKDSDKE-IEQRCGA---NIPWIFDVEGEVGFREREQAMLTELCA----ADGM
AROK_PSEAB       AKELHLAFKDSDKE-IEQRCGA---NIPWIFDVEGEVGFREREQAMLTELCA----ADGM
AROK_PSEA7       AKELHLAFKDSDKE-IEQRCGA---NIPWIFDVEGEAGFREREQAMLSELCA----TDGM
AROK_PSEP1       AKELRLLFKDSDKE-IELRCGA---NIPWIFDKEGEPGFRDREQAMIAELCA----LDGV
AROK_PSEPK       AKELRLLFKDSDKE-IELRCGA---NIPWIFDKEGEPGFRDREQAMIAELCA----LDGV
AROK_PSEE4       AKELRLLFKDSDKE-IELRTGA---NIPWIFDKEGEPGFREREQAMIAELCA----LDGV
AROK_PSEF5       AKELRLPFKDSDKE-IELRTGA---NIPWIFDKEGEPGFRDREQAMIAELCG----TDGV
AROK_PSEPF       AKELRLPFKDSDKE-IELRTGA---NIPWIFDKEGEPGFRDREQAMIAELCA----FDGV
AROK_PSE14       AKELRLPFKDSDKE-IELRTGA---NIPWIFDKEGEPGFREREQAMIAELCE----ADGL
AROK_PSESM       AKELRLPFKDSDKE-IELRTGA---NIPWIFDKEGEPGFREREQAMIAELCE----ADGV
AROK_PSEU2       AKELRLPFKDSDKE-IELRTGA---NIPWIFDKEGEPGFRDREQAMIAELCA----ADGV
AROK_HAHCH       AKELQFEFVDSDRE-IEARCGA---DIPWIFDVEGEVGFRGREKSVIADLSQ----RDAV
AROK_ACIBY       AELLGREFLDSDHE-IERKTGA---TIPWIFEKEGEVGFRTRETVVLNELTS----RKAL
AROK_ACIBS       AELLGREFLDSDHE-IERKTGA---TIPWIFEKEGEVGFRTRETVVLNELTS----RKAL
AROK_ACIAD       AELLGREFLDSDHE-IERRTGA---TIPWIFEKEGEIGFRSRETIVLDDLTS----RRDL
AROK_PSYA2       AKQLGRTFVDSDWY-VESQTGA---DIAWIFDKEGEAGFRERETRAIDELTQ----QPQI
AROK_PSYCK       AKQLGRSFVDSDWY-IESQTGA---DIAWIFAKEGEAGFRERETRAIDELTQ----QPQI
AROK_PSYWF       AKHLGRDFIDSDHY-ICEQTGA---DIPWIFEKEGETGFREREARAIAELTA----LPNV
AROK_COXBU       AKLTKRILYDSDKE-IEKRTGA---DIAWIFEMEGEAGFRRREREMIEALCK----LDNI
AROK_COXB2       AKLTKRILYDSDKE-IEKRTGA---DIAWIFEMEGEAGFRRREREMIEALCK----LDNI
AROK_COXBR       AKLTKRILYDSDKE-IEKRTGA---DIAWIFEMEGEAGFRRREREMIEALCK----LDNI
AROK_COXBN       AKLTKRILYDSDKE-IEKRTGA---DIAWIFEMEGEAGFRRREREMIEALCK----LDNI
AROK_COXB1       AKLTKRILYDSDKE-IEKRTGA---DIAWIFEMEGEAGFRRREREMIEALCK----LDNI
AROK_AROAE       AKRHQMRFVDCDHE-IEARTGV---KVPTIFEIEGEAGFRRRESQLLDELTH----ETGL
AROK_DECAR       ARRLSRPFFDTDHE-IVERTGV---PIPTIFEIEGEEGFRRREAQTIYDLTA----ENNI
AROK_NEIMA       AQRLDYRFYDSDHE-IAAAAGV---PIPTIFEMEGEQGFRSRETAILKKLVI----LPHI
AROK_NEIMB       AQRLDYRFYDSDHE-IAAAAGV---PIPTIFEMEGEQGFRSRETAILKKLVI----LPHI
AROK_NEIM0       AQRLDYRFYDSDHE-IAAAAGV---PIPTIFEMEGEQGFRSRETAILKKLVI----LPHI
AROK_NEIG1       AQRLDYRFYDSDHE-IAAAAGV---PIPTIFEMEGEQGFRSRETAILKKLIV----LPHI
AROK_THIDA       AKHYGCTFYDSDHE-IEARTGV---KIPVIFEIEGEAGFRRREEAVIAELTT----LSGI
AROK_NITEU       ANLVGKTFIDIDHE-IQRRTGV---GIPVIFEIEGEAGFRKRESEVLRDIVR----QQNI
AROK_NITMU       SHFLEKTFYDSDRE-IQKRTGV---SIPTIFEIEGEEGFRRRETEILSELMN----ARNI
AROK_BURMA       ARRLDRPFFDSDHE-IEARTGA---RIPVIFELEGEAGFRDREAQMIAELTQ----RENI
AROK_BURPS       ARRLDRPFFDSDHE-IEARTGA---RIPVIFELEGEAGFRDREAQMIAELTQ----RENI
AROK_BURP1       ARRLDRPFFDSDHE-IEARTGA---RIPVIFELEGEAGFRDREAQMIAELTQ----RENI
AROK_BURTA       ARRLDRPFFDSDHE-IEARTGA---RIPVIFELEGESGFRDREAQMIAELTQ----RENI
AROK_BURL3       ARRLDRTFFDSDHE-IEARTGA---RIPVIFEMEGEAGFRDRETQVITDLTQ----RENI
AROK_RALSO       ARRLDLPFFDSDHE-IEARCGV---RVPVIFEHEGEMGFRDRETQMIDELTA----RHGV
AROK_CUPPJ       ARRLHYPFFDSDHE-LEAHCGV---RIPVIFEHEGEEGFRDREAAMIRELTG----RSGI
AROK_BORPA       ARALRREFIDLDHE-LEARCGV---RVPVIFEIEGEAGFRRREAAALQECTQ----RRQI
AROK_BORPE       ARALRREFIDLDHE-LEARCGV---RVPVIFEIEGEAGFRRREAAALQECTQ----RRQI
AROK_BORBR       ARALRREFIDLDHE-LEARCGV---RVPVIFEIEGEAGFRRREAAALQECTQ----RRQI
AROK_BORA1       ARALGREFIDLDHE-LEARCGV---RVPVIFEIEGEAGFRKRESTALQECTQ----RRGI
AROK_CHRVO       ARRTGKTFYDSDQE-IEARTGV---RVATIFDIEGEMRFRNREACVIRDLAQ----QRDI
AROK_NITOC       ARITGKNFYDSDRE-IESRTGV---SIPVIFEIEGESGFRQRECKIIAELVQ----LNNI
AROK_HYDCU       ADKLHYQFLDSDQV-IEDKTGA---TIPMIFDIEGESGFRAREKAAIDDLTQ----QSEI
AROK_ACIAC       ARRLGLPFIDSDHV-IEQRIGG---SIRGFFDREGEAAFRDLEEEVILELTEAN--VPPQ
AROK_STRMK       AERFTLDFVDVDQA-IVDAAGA---SIPTIFEHSGEAGFRSHEREALARVLE----GRGQ
AROK_STRM5       AERFTLDFVDVDQA-IVDAAGA---SIPTIFEHSGETGFRSHEREALARVLE----GRGQ
AROK_XANAC       AERFGLEFVDVDQA-IVEQVGS---SIPAIFEQHGEARFRQHEAETLQALLE----QDNK
AROK_XANC5       AERFGLEFVDVDQA-IVDQVGS---SIPAIFEQHGEARFRQYEAQILQALLE----QDNK
AROK_XANOR       AERFGLEFVDVDQA-IVEQVGS---SIPAIFAQHGEAGFRQHEADTLQALLE----QDNK
AROK_XANOM       AERFGLEFVDVDQA-IVEQVGS---SIPAIFAQHGEAGFRQHEADTLQALLE----QDNK
AROK_XANOP       AERFGLEFVDVDQA-IVEQVGS---SIPAIFAQHGEAGFRQHEADTLQALLE----QDNK
AROK_XANCP       AERFGLDFVDVDQA-IVEQVGS---SIPAIFEQHGEARFRQHEAEALHGLLA----QSNK
AROK_XANC8       AERFGLDFVDVDQA-IVEQVGS---SIPAIFEQHGEARFRQHEAEALHGLLA----QSNK
AROK_XYLF2       AKHFNLHFADTDHA-IVERAGT---SISTIFKYSGEPEFRRLEREVLYDLLN----HENR
AROK_XYLFT       AKHFNLHFADTDHA-IVERAGT---SISTIFKYSGEPEFRRLEREVLYDLLN----HENR
AROK_XYLFM       AKHFNLHFADTDHA-IVERAGT---SISTIFKYSGEPEFRRLEREVLHDLLN----HENR
AROK_XYLFA       AKHFSLHFADTDHA-IVERAGT---NISAIFKYSGEPEFRRLEREVLHDLLN----HENQ
AROK_BARHE       ATMLCLPFYDSDQE-IEKAAQM---TITELFKTYGESEFRALEQRVILNLMKN----RPL
AROK_BARQU       ATMLGLPFYDSDQE-IEKAAQM---TITEFFKVYGESEFRALEQHVTLSLMKK----SPL
AROK_BRUAB       ANMLNLPFKDADTE-IETVSRM---TVAELFEAYGEVEFRDLERRVILRLLDD----GPM
AROK_BRUA2       ANMLNLPFKDADTE-IETVSRM---TVAELFEAYGEVEFRDLERRVILRLLDD----GPM
AROK_BRUSU       ANMLNLPFKDADTE-IETVSRM---TVAELFEAYGEVEFRDLERRVILRLLDD----GPM
AROK_RHILO       ATMLSLPFIDSDQE-IESVSRM---TVPELFERYGEAEFRALEQRVILRVLEN----GPQ
AROK_RHIME       AQALGVPFVDSDHE-IERVSRM---TVSDLFATYGEEEFRALEARVLKRLLRS----GPR
AROK_BRADU       AARLKLPFVDADTE-IEAAAGM---TIPEIFERHGEGHFRDGEARVIARLLDG----GPV
AROK_RHOPA       ALRLGLPFLDADTE-IESAAAM---TIPEIFETHGEPHFRDGEARVISRLLDG----GTK
AROK_NITWN       AARLRMRFVDADAE-IELAAGM---PIPEIFETHGEPHFRDGEARVIARLLNG----GPI
AROK_CAUVC       ANVLGLPFRDADNE-VEAAAGR---SISEIFAELGEPAFRDGERRVIARLLDE----PPH
AROK_ZYMMO       ASQLNMPFSDSDLE-IEEAAGQ---SITEIFARYGENYFRNGERRVISRLIAG----EPK
AROK_NOVAD       ASLLHVPFVDADEE-IERAAHM---PIPEIFATYGEPYFRDGERRVIARLMGTGRNTDRK
AROK_MAGSA       AARLGLDFVDSDAE-FEAASGS---SISDYFARFGEAAFREGERKVIARLLDG----PPV
AROK_RHORT       AQMAGVPFVDADVE-IERAAKR---TIAEIFATYGESEFRALERRVMARLLAG----RTC
AROK_RHOS4       ARGLNVPFLDSDEE-IERAANR---TIAEIFARDGEPFFREKESQVLARLLRG----SPC
AROK_RUEPO       AQRLGVPFLDSDAE-IESAANM---SIPEIFERDGEAFFRDRESRVIARLLEG----APC
AROK_NOSS1       AKELGYGFLDTDNV-IAQATKK---SINEIFAEAGEAGFRQIESDVLAQVCSY----TKL
AROK_TRIV2       AQELGYGFLDTDNV-IAQAAKK---SINEIFAEAGEAGFRQIESDVLAQVCSY----TKL
AROK_NOSP7       AKHLGYGFLDLDGV-IAKATDK---SINQLFAEEGEAGFRQIESDVLSQVCAF----TKL
AROK_RIPO1       AQRLDYRFFDTDIL-IERVTQQ---SINDIFVTQGETVFRDIETQVLSEVAAC----TRS
AROK_MICAN       SRRLQYRFFDTDIL-IERVAGK---KIREIFVDEGEATFRELETQVLAELSSL----TKT
AROK_SYNY3       AEQLGYRFFDADVL-IERVAGK---AIADIFAEDGEDTFRDLETEVLGHLAAQ----TRS
AROK_SYNE7       AESLGYTYVDTDSL-IENVTGR---SIPEIFASDGEAGFRQIETQVLEEVASY----RRL
AROK_SYNP6       AESLGYTYVDTDSL-IENVTGR---SIPEIFASDGEAGFRQIETQVLEEVASY----RRL
AROK_THEEB       AQRLGYSFVDTDAV-ITAFRQR---PIREIFAQEGEPAFRELEQQVLAQVSSY----HHL
AROK_SYNJB       AAQLRFQFFDTDGL-VEQVGGS---SIAQIFAEHGEAYFRDLETQVLAQLSSY----TRL
AROK_SYNJA       AAQLRRPFFDTDAL-VEQVAGC---SIAQIFAEQGEAHFRELETQVLAQLSGY----TRL
AROK_GLOVI       AEKLGYGFVDLDAL-IEQVSGK---RVGEIFEREGEAVFRDLESRVLAEVSAY----TRL
AROK_PROMA       AKLLKYSFIDQDEL-IEKVAKS---SVSQIFREEGENGFRDIETQVLKQIGQR----HSL
AROK_PROMT       AKMINYAFVDTDDV-IEKASKQ---SISSIFEKDGEKVFRDVEKKVLKEISQH----HSL
AROK_SYNSC       AERLGYGFVDADAV-IEQAAGC---SIPEIFERDGDAGFRSLESQVLSAISQR----HSL
AROK_SYNPX       AEQLGYGFVDADAV-IEQAAGC---SIPEIFERDGEAGFRALESQVLNAIGQR----HSL
AROK_SYNS9       AKRLGYGFVDADAV-IEQVAGC---TIPEIFERDGEAGFRSIESQVLNAISQR----HSL
AROK_PROMM       AEQLSYGFVDTDAV-IEQLAGQ---PIPKIFSEEGEAGFRTMESQVLNAIGQR----HSL
AROK_LACF3       GEALQQPVYDLDDE-VEKAACK---PIPQIFADDGEASFRDLEHSALKEVVKR----RQG
AROK_CHLP8       ANSLGFEFIDLDRE-IELAAGK---SINRIFAEDGEAAFRELELRTLERIGSQ----KEM
AROK_CHLTE       ANSLGFEFIDLDRE-IELTAGK---SINRIFAEDGEAAFRSLELRTLEKIGQQ----ERM
AROK_CHLL2       ANSLGYGFIDLDQE-IESKAGK---SITKIFAEEGEQTFRNLELETLRQLTGK----KEL
AROK_CHLPD       ANSLGYDFIDLDQA-IEAITGK---SVSRIFAEEGESYFRKLELDTLKTVTNR----EEL
AROK_CHLPB       ANSLGYDFLDLDKE-IERQADK---PITRIFAEEGEDHFRERERAMLESIVGR----KEL
AROK_PROA2       ANSLGYDFVDLDQQ-IEHLAGK---TINRIFTEEGEAHFRDLELMVLQNYSGK----SEL
AROK_CHLCH       ANSLGYEFVDLDAL-IERECGK---SINQIFAEAGEAAFRQHEEQTLETLLMR----RKT
AROK_PELLD       ANSLGYEFLDVDQA-VEQRAGK---PITRIFAEEGEAAFRELELQTLKTVAGE----KEM
AROK_CHLPM       ANSLGYDFIDIDSA-IEEQEGK---TITRIFAEEGERAFRKLEQAMIATIAER----KEM
AROK_CHLT3       ANSLGFEFIDIDKE-IVDREQK---SINEIFAEKGEPYFRELEYNVLSSISQS----EDL
AROK_SALRD       AARLGQPFLDLDRL-ITAHAGR---SIPALFAEEGEARFRELERDLLRRTATT----DDL
AROK_AQUAE       SRSLNIPFYDVDEE-VQKREGL---SIPQIFEKKGEAYFRKLEFEVLKDLSEK----ENV
AROK_THET2       ARALMLHFIDLDRY-IERRTGI---SIPDIFRHLGEEAFRRMEKEAVRELVGK----DYL
AROK_THET8       ARALMLHFIDLDRY-IERRTGI---SIPDIFRHLGEEAFRRMEKEAVRELVGK----DYL
AROK_DEIRA       SRALALHFVDTDKL-ITRVVGK---SIPEVFAQEGEGYFRACEREVVQRVTRL----DHA
AROK_THEP3       ATNMSFGFIDTDKM-IEKMANM---TVSDIFEKYGEDYFRRLEKAAVIKAARL----KNF
AROK_THEPX       ATTMSFGFIDTDKM-IEKMANM---TVSDIFEKYGENYFRKLEKAAVKKAARL----KNF
AROK_CALS4       ATTLHFNFIDTDKL-VEKMAGM---SVAEIFEKHGEEYFRKLEKAAVIKASRL----KNH
AROK_THEYD       AKKLGFDFVDVDEV-IEKATGM---EISEIFSKFGESRFRDIEEEMIKLITPK----KRQ
AROK_CALS8       AEKLNIDLVDTDSE-IIKEFKL---TIDQIFEIHGEKKFRECEKRVIERVSKL----ENV
AROK_DESAP       ARILDRPFLDTDSE-IERLAGK---PVRRIFIEDGEVRFRSEEALLCRKLAVP----RGL
AROK_PELTS       AGRLKREFIDTDAE-IEKVTGK---TVAQIFARDGQIRFRSEEALLVRKLAGK----ENL
AROK_GEOMG       AHRLGFRYCDLDAL-IVEGEGV---SINEIFARHGEPHFRALETEAVRSVSRE----ERC
AROK_GEOSL       ARRLGYRFSDLDAL-IVERAGI---SINEIFERYGEQRFRELETEAIRSLGGV----SGR
AROK_MOOTA       ARDLGWSFLDTDTM-VEERLGL---PVKEIFAREGEEFFREVEKEAVARVATA----RQA
AROK_SYMTH       AERLGRPFVDTDRL-VEADAGR---TVADIFAAEGEEGFRRREAEVVARAAAG----DNQ
AROK_DESAG       AEKLGWRCADTDEM-VQRRAGC---SIADMVARDGWPVFREAEAGALQAACAL----TRV
AROK_DESVH       AARLGWDFADTDAM-VTRRAGC---DIATLVAERGWDAFRDMESDALRDAAAR----ERV
AROK1_PELCD      ASVLNYAFVDTDEY-MSATSHM---TVAEVVAKEGWVGFRRRESEALHAVTA-----PKT
AROK2_PELCD      ANALSYPFVDTDLY-MLETTNL---TVADVVVTEGWEGFRRRESEALRTVTK-----PGI
AROK_RHOBA       AQKLSLPSVDLDDV-IETTAGK---SIAEIFANETEVGFRDREEAALMEVSRR----PQH
AROK_SYNAS       ARRLHRPFHDTDVL-IEKREGR---SIRDMVAREGWAFFRERERAAISSLDGL----RRC
AROK_DEHMB       SEKLGKPLVSTDAC-IETREGL---SISHIFKENGEDYFRQMESKVLEDICQN----PNQ
AROK_DEHMC       SEKLGKPLVSTDAC-IETREGL---SISHIFKENGEDYFRQMESKVLEDICQN----PNQ
AROK_DEHM1       SERLGKTLVSTDAC-IETREGL---SIISIFKEKGEDYFRQMESRVLEDLCRQ----SGQ
AROK_LEPBA       SKQSEIPVVSTDSVAVYETGGI---PIPKFVENNGWKAFRELEYSILQKLQNA----NGI
AROK_LEPBP       SKQSEIPVVSTDSVAVYETGGI---PIPKFVENNGWKAFRELEYSILQKLQNA----NGI
AROK_CHLMU       AQFLSLPFFDTDHLLSARFHGD---SPKAIYQRFGEEGFCQEELLTLINLPVI-----PS
AROK_CHLTR       SQFLSLPFFDTDHLLSDRFHGD---SPKTIYQRYGEEGFCREEFLALTSVPVI-----PS
AROK_CHLPN       AKFLNLPFYDLDDLIVSNYSSALYSSSAEIYKAYGDQKFSECEARILETLPP-----EDA
                 .        . *                          *   *                 

AROK_ALKOO       VIATGGGTVISEENRSKLKQI-G---------RVIYLEAEPSWILT-NIKRS--AVIRPL
AROK_FUSNN       VIATGGGSILDNENIKRLKET-S---------FIVFLNATIECLYL-RLKDN--TT-RPI
AROK_BACFR       VISTGGGAPCFFDNMEYMNRV-G---------TTVFLDVDPKVLFS-RLRVA--KQQRPI
AROK_BACFN       VISTGGGAPCFFDNMEYMNRV-G---------TTVFLDVDPKVLFS-RLRVA--KQQRPI
AROK_BACTN       VISTGGGAPCFYDNMEFMNRT-G---------KTVFLNVHPDVLFR-RLRIA--KQQRPI
AROK_BACV8       VVSTGGGTPCFFDNMEYMNDC-G---------DTVFLDVEPAVLFR-RLRVA--KQQRPL
AROK_PARD8       LISTGGGAPCFFDNMEFMNAS-G---------TTVYLKVSVEELAK-RLELC--KHTRPV
AROK_AZOPC       VISTGGGTPCFFHNMELMNAS-G---------TTVYLKATIELLTE-RLINM--KCARPL
AROK_FLAJ1       IIGLGGGTPCYANNHLLLQRDDI---------VSVYLKASIDTLYN-RLVHN--KSKRPL
AROK_METI4       IVATGGGTLLNPSNLWLLKRY-G---------RLFYLQASLDLLWT-RLKN---KTDRPL
AROK_BACLD       IVSLGGGAFQ-QEEIRKKCLEHC---------FVIFLDLRWENWKQ-RMDLL--IENRPV
AROK_BACP2       IVSLGGGAFK-QEEIKRACLKHC---------TVLFLDLSWENWKQ-RLDIL--IENRPV
AROK_BACSU       IVSLGGGSFK-QEEIRNCCLENC---------LVLHLDLSWENWKQ-RADLL--IESRPV
AROK_GEOKA       ILSLGGGAYL-QEDVRRACLAHG---------IVFFLDLSWEHWKEERLPLI--VDSRPV
AROK_GEOTN       ILSLGGGAYL-QEEVRRACLAHG---------IVFFLDLSWDYWKEERLPLI--VDSRPV
AROK_OCEIH       VVSLGGGAFL-QKEIQEICLNSS---------IIFYLDLSWDRWKD-RIELL--MESRPV
AROK_BACHD       VISLGGGAYM-QDAIRTACLDHC---------IVIYLDLSWSLWKE-RLNVL--IDNRPV
AROK_CLOB1       VISTGGGLPIYNKNIYELKKI-G---------FTVYLKVPLEELIKRMVKKE--YDTRPL
AROK_CLOBH       VISTGGGLPIYNKNIYELKKI-G---------FTVYLKVPLEELIKRMVKKE--YDTRPL
AROK_CLOBL       VISTGGGLPIYNKNIYELKKI-G---------FTVYLKVPLEELIKRMVKKE--YDTRPL
AROK_CLOBK       VISTGGGLPIYNKNIYELKNI-G---------FTVYLKVPLEELIKRMVKKE--YDTRPL
AROK_CLOBM       VISTGGGLPIYNKNIYELKKI-G---------FTVYLKVPLEELIKRMVKKE--DDARPL
AROK_HELPY       VISTGGGIVMHE----NLKGL-G---------TTFYLKMDFETLIKRLNQKE--REKRPL
AROK_HELPJ       IISTGGGIVMHE----NLKGL-G---------TTFYLKMDFETLIKRLNQKE--REKRPL
AROK_HELPG       VISTGGGIVMHD----NLKGL-G---------TTFYLKIDFETLIKRLNQKE--REKRPL
AROK_HELP2       VISTGGGIVMHD----NLKGL-G---------TTFYLKMDFETLIKRLNQKE--REKRPL
AROK_HELPH       VISTGGGIIMHE----NLKGL-G---------TTFYLKMDFETLIKRLNQKE--REKRPL
AROK_HELAH       VISTGGGIIMHD----NFKGL-G---------TTFYLKMDFETIIKRLSKKE--REKRPL
AROK_HELHP       VIATGGGMPIYN----DVAYL-G---------YVFWLDMSFESILKRLTITE--QEKRPL
AROK_CLOBA       VIATGGGVVKKGINVETLKNN-G---------LVIFIDRPVEKIISDIDVS------RRP
AROK_CLOBB       VIATGGGVVKKDINIETLKNN-G---------LVIFIDRPVEKIISDIDVS------RRP
AROK_CLOB8       IISSGGGVVKRKENIDILKEE-S---------FIIFIDRPLEELLGDVDIS------KRP
AROK_DICTD       VLSTGGGVVLREENRRILREK-S---------KVIYLKGEFENLMKHLENKE--EHEKRP
AROK_BACC7       IITTGGGIIEREENRKWMKEN-G---------TVVYLYCDPHVIAERLRED----TTRPL
AROK_BACC0       IITTGGGIIEREENRKWMKEN-G---------IVVYLYCDPHVIAERLRED----TTRPL
AROK_BACMK       IITTGGGIIERAENRKWMKEN-G---------TVVYLYCDPHVIAERLRED----TTRPL
AROK_BACC2       IITTGGGIIERAENRKWMKEN-G---------TVVYLYCDPNVIAERLRED----TTRPL
AROK_BACCN       IITTGGGIVERIENREWMKEN-G---------TVVYLYCDPYVIADRLHED----ITRPL
AROK_STAAC       IIATGGGIIESEEAFNFLKNQ-K---------NIIWLDCNIDIIYSRINDD----PHRPN
AROK_STAA8       IIATGGGIIESEEAFNFLKNQ-K---------NIIWLDCNIDIIYSRINDD----PHRPN
AROK_STAAE       IIATGGGIIESEEAFNFLKNQ-K---------NIIWLDCNIDIIYSRINDD----PHRPN
AROK_STAAT       IIATGGGIIESEEAFNFLKNQ-K---------NIIWLDCNIDIIYSRINDD----PHRPN
AROK_STAAS       IIATGGGIIESEEAFNFLKNQ-K---------NIIWLDCNIDIIYSRINDD----PHRPN
AROK_STAAW       IIATGGGIIESEEAFNFLKNQ-K---------NIIWLDCNIDIIYSRINDD----PHRPN
AROK_STAA1       IIATGGGIIESEEAFNFLKNQ-K---------NIIWLDCNIDIIYSRINDD----PHRPN
AROK_STAAM       IIATGGGIIESEEAFNFLKNQ-K---------NIIWLDCNIDIIYSRINDD----PHRPN
AROK_STAAN       IIATGGGIIESEEAFNFLKNQ-K---------NIIWLDCNIDIIYSRINDD----PHRPN
AROK_STAA2       IIATGGGIIESEEAFNFLKNQ-K---------NIIWLDCNIDIIYSRINDD----PHRPN
AROK_STAA9       IIATGGGIIESEEAFNFLKNQ-K---------NIIWLDCNIDIIYSRINDD----PHRPN
AROK_STAAR       IIATGGGIIESEEVFNFLKNQ-K---------NIIWLDCNIDIIYSRINDD----PHRPN
AROK_STAES       IISTGGGIIEDTNSLKLLKNQ-K---------HVVWLDCDIEIIFKRVKND----SHRPN
AROK_STAEQ       IISTGGGIIEDTNSLKLLKNQ-K---------HVVWLDCDIEIIFKRVKND----SHRPN
AROK_STAS1       IISTGGGIIEGDESFRILKEQ-P---------KVIWLDCDIEILYKRIKND----SNRPN
AROK_STAHJ       VIATGGGVIEYTESLNYLKQY-K---------YIFWLDCDIDVIFKRVTND----KHRPN
AROK_LACLM       IIATGGGIIENPKNLNVLDRA-S---------RVVFLTADFDTLWKRISMDW--QNVRPL
AROK_LACLS       IIATGGGIIENPKNLNVLDRA-S---------RVVFLTADFDTLWKRISMDW--QNVRPL
AROK_LACLA       IIATGGGIIENPKNLEALDRE-A---------GVVFLTADFETLWERISMDL--QNVRPL
AROK_STRPB       VIVTGGGVVVLQENRQLLRKNHQ---------HNILLVASFETLYQRLKHDK--KSQRPL
AROK_STRPC       VIVTGGGVVVLQENRQLLRKNHQ---------HNILLVASFETLYQRLKHDK--KSQRPL
AROK_STRPD       VIVTGGGVVVLQENRQLLRKNHQ---------HNILLVASFETLYQRLKHDK--KSQRPL
AROK_STRPZ       VIVTGGGVVVLQENRQLLRKNHQ---------HNILLVASFETLYQRLKHDK--KSQRPL
AROK_STRPG       VIVTGGGVVVLQENRQLLRKNHQ---------HNILLVASFETLYQRLKHDK--KSQRPL
AROK_STRPF       VIVTGGGVVVLQENRQLLRKNHQ---------HNILLVASFETLYQRLKHDK--KSQRPL
AROK_STREM       IVSTGGGVVLSKANRELIRKNHK---------HNILLTASFEVLYDRLKKDR--LCQRPL
AROK_STRTD       IISTGGGVVVTECNRKLLKKNRK---------HNVWLHSSFDVVYNRIKKDI--KNQRPL
AROK_STRSY       IVSTGGGVIKSEVNRELLLANRE---------DNVLLTASFEVSYQRIRKDR--QSQRPL
AROK_STRS2       IVSTGGGVIKSEVNRELLLANRE---------DNVLLTASFEVSYQRIRKDR--QSQRPL
AROK_STRGC       IISPGGGIVVNPHNRDLLEKN-P---------YNIYLRVDFDTLYKRIENDL--AMQRPL
AROK_ENTFA       VLSTGGGIVVGPENRSLLKSF-Q---------QVIYLHATPEELLKRITEDT--ENQRPL
AROK_SALAI       VLALGGGAVLAEQTRAALVGH-----------TVVYLSVELPDAVRRVGL----GAGRPL
AROK_SALTO       VLALGGGAVLAEETRSALVGH-----------TVVHLSVELPDAVRRVGL----GAGRPL
AROK_ACIC1       VLALGGGAILDDDTRALLADH-----------TVIYLEVEFSEAVRRVGL----NRDRPL
AROK_THEFY       VVALGGGAILNEQTRADLAGH-----------RVVYLEVEFADAAKRVGL----DTARPL
AROK_STRAW       VLALGGGAILDADTRALLAGH-----------RVVYLSMEVDEAVKRTGL----NAARPL
AROK_STRCO       VLALGGGAILDADTRALLAGQ-----------RVVYLSMDVEEAVKRTGL----NAARPL
AROK_FRACC       VLALGGGAVLDAENRTLLAGH-----------RVVYLEVGVSDAVRRVGL----ARDRPL
AROK_SACEN       VLSLGGGSVLSERTRALLAEQ-----------PVVFLSVGLAEGARRTGL----STARPL
AROK_MYCA1       VLSLGGGAVTSPGVREALAGH-----------TVVYLEISATEGVRRTGG----NTVRPL
AROK_MYCPA       VLSLGGGAVTSPGVREALAGH-----------TVVYLEISATEGVRRTGG----NTVRPL
AROK_MYCBO       VLSLGGGAVTSPGVRAALAGH-----------TVVYLEISAAEGVRRTGG----NTVRPL
AROK_MYCBP       VLSLGGGAVTSPGVRAALAGH-----------TVVYLEISAAEGVRRTGG----NTVRPL
AROK_MYCTU       VLSLGGGAVTSPGVRAALAGH-----------TVVYLEISAAEGVRRTGG----NTVRPL
AROK_MYCTA       VLSLGGGAVTSPGVRAALAGH-----------TVVYLEISAAEGVRRTGG----NTVRPL
AROK_MYCMM       VLSLGGGAVTSPGVRSALDGH-----------TVVYLEISAAEGVRRTGG----SNVRPL
AROK_MYCUA       VLSLGGGAVTSPGVRSALDGH-----------TVVYLEISAAEGVRRTGG----SNVRPL
AROK_MYCLE       VVSLGGGAVTSPGVCAALAGH-----------IVIYLEINAEEAMRRACG----STVRPL
AROK_RHOJR       IVSLGGGSILSERTRELLKGH-----------TVIYLEISVAEGLKRTGT----NTARPL
AROK_COREF       VVSLGGGAILTESTRELLREH-----------DVVWIDVSVAEGVRRTAG----ERTRPV
AROK_CORGL       VVSLGGGSVLTESTRELLKGQ-----------DVVWIDVPVEEGIRRTAN----ERSRPV
AROK_CORDI       VVSLGGGAVTTESVRQKLRAQ-----------IVVWVDVSAAEGVRRTAV----ENSRPL
AROK_CORJK       IVSLGGGAVVTESTRELLADH-----------TVVYLNVSIDEGVRRTSG----SNTRPL
AROK_ECO8A       VLATGGGSVKSRETRNRLSARG----------VVVYLETTIEKQLARTQR----DKKRPL
AROK_ECOHS       VLATGGGSVKSRETRNRLSARG----------VVVYLETTIEKQLARTQR----DKKRPL
AROK_ECO7I       VLATGGGSVKSRETRNRLSARG----------VVVYLETTIEKQLARTQR----DKKRPL
AROK_ECOL6       VLATGGGSVKSRETRNRLSARG----------VVVYLETTIEKQLARTQR----DKKRPL
AROK_ECO45       VLATGGGSVKSRETRNRLSARG----------VVVYLETTIEKQLARTQR----DKKRPL
AROK_ECOLU       VLATGGGSVKSRETRNRLSARG----------VVVYLETTIEKQLARTQR----DKKRPL
AROK_ECO57       VLATGGGSVKSRETRNRLSARG----------VVVYLETTIEKQLARTQR----DKKRPL
AROK_ECO24       VLATGGGSVKSRETRNRLSARG----------VVVYLETTIEKQLARTQR----DKKRPL
AROK_ECOLI       VLATGGGSVKSRETRNRLSARG----------VVVYLETTIEKQLARTQR----DKKRPL
AROK_ECODH       VLATGGGSVKSRETRNRLSARG----------VVVYLETTIEKQLARTQR----DKKRPL
AROK_ECOLC       VLATGGGSVKSRETRNRLSARG----------VVVYLETTIEKQLARTQR----DKKRPL
AROK_SHISS       VLATGGGSVKSRETRNRLSARG----------VVVYLETTIEKQLARTQR----DKKRPL
AROK_SHIFL       VLATGGGSVKSRETRNRLSARG----------VVVYLETTIEKQLARTQR----DKKRPL
AROK_SHIDS       VLATGGGSVKSRETRNRLSARG----------VVVYLETTIEKQLARTQR----DKKRPL
AROK_SHIBS       VLATGGGSVKSRETRNRLSARG----------VVVYLETTIEKQLARTQR----DKKRPL
AROK_SHIB3       VLATGGGSVKSRETRNRLSARG----------VVVYLETTIEKQLARTQR----DKKRPL
AROK_ENT38       VLATGGGSVKSRETRNRLSARG----------VVVYLETTIEKQLARTQR----DKKRPL
AROK_SALA4       VLATGGGSVKSRETRNRLSARG----------VVVYLETTIEKQLARTQR----DKKRPL
AROK_SALCH       VLATGGGSVKSRETRNRLSARG----------VVVYLETTIEKQLARTQR----DKKRPL
AROK_SALDC       VLATGGGSVKSRETRNRLSARG----------VVVYLETTIEKQLARTQR----DKKRPL
AROK_SALEP       VLATGGGSVKSRETRNRLSARG----------VVVYLETTIEKQLARTQR----DKKRPL
AROK_SALG2       VLATGGGSVKSRETRNRLSARG----------VVVYLETTIEKQLARTQR----DKKRPL
AROK_SALHS       VLATGGGSVKSRETRNRLSARG----------VVVYLETTIEKQLARTQR----DKKRPL
AROK_SALNS       VLATGGGSVKSRETRNRLSARG----------VVVYLETTIEKQLARTQR----DKKRPL
AROK_SALPA       VLATGGGSVKSRETRNRLSARG----------VVVYLETTIEKQLARTQR----DKKRPL
AROK_SALPK       VLATGGGSVKSRETRNRLSARG----------VVVYLETTIEKQLARTQR----DKKRPL
AROK_SALSV       VLATGGGSVKSRETRNRLSARG----------VVVYLETTIEKQLARTQR----DKKRPL
AROK_SALTI       VLATGGGSVKSRETRNRLSARG----------VVVYLETTIEKQLARTQR----DKKRPL
AROK_SALTY       VLATGGGSVKSRETRNRLSARG----------VVVYLETTIEKQLARTQR----DKKRPL
AROK_CITK8       VLATGGGSVKSRETRNRLSARG----------VVVYLETTIEKQLARTQR----DKKRPL
AROK_ESCF3       VLATGGGSVKSRETRNRLSARG----------VVVYLETTIEKQLARTQR----DKKRPL
AROK_SERP5       VLATGGGSVKSRETRNRLSARG----------VVVYLETTIEKQLARTQR----DKKRPL
AROK_YERE8       VLATGGGSVKSRETRNRLSARG----------VVVYLETTIEKQLARTQR----DKKRPL
AROK_YERPE       VLATGGGSVKSRETRNRLSARG----------VVVYLETTIEKQLARTQR----DKKRPL
AROK_YERPP       VLATGGGSVKSRETRNRLSARG----------VVVYLETTIEKQLARTQR----DKKRPL
AROK_YERPG       VLATGGGSVKSRETRNRLSARG----------VVVYLETTIEKQLARTQR----DKKRPL
AROK_YERPA       VLATGGGSVKSRETRNRLSARG----------VVVYLETTIEKQLARTQR----DKKRPL
AROK_YERPN       VLATGGGSVKSRETRNRLSARG----------VVVYLETTIEKQLARTQR----DKKRPL
AROK_YERPS       VLATGGGSVKSRETRNRLSARG----------VVVYLETTIEKQLARTQR----DKKRPL
AROK_YERPB       VLATGGGSVKSRETRNRLSARG----------VVVYLETTIEKQLARTQR----DKKRPL
AROK_YERP3       VLATGGGSVKSRETRNRLSARG----------VVVYLETTIEKQLARTQR----DKKRPL
AROK_YERPY       VLATGGGSVKSRETRNRLSARG----------VVVYLETTIEKQLARTQR----DKKRPL
AROK_PECAS       VLATGGGSVKSRETRNRLSARG----------VVVYLETTIEKQLARTQR----DKKRPL
AROK_ERWT9       VLATGGGSVKSRETRNRLSARG----------VVVYLETTIEKQLARTQR----DKKRPL
AROK_SODGM       VLATGGGSVKSRETRNRLSARG----------VVVYLETTIEKQLARTQR----DKKRPL
AROK_PHOLL       VLATGGGSVKSRETRNRLSARG----------VVVYLETTIEKQLARTQR----DKKRPL
AROK_BAUCH       VLATGGGSIKSRETRNRLSARG----------VVIYLDTTIEKQLVRTKR----DKKRPL
AROK_AERHH       VLATGGGAIKSRETRNKLSARG----------IVVYLETTIEKQLARTQR----DKRRPL
AROK_AERS4       VLATGGGAIKSRETRNKLSARG----------IVVYLETTIEKQLARTQR----DKRRPL
AROK_ALTMD       VLATGGGSIVTKAVRNRLSARG----------IVVYLQTTIDKQVARTQR----DKRRPL
AROK_PSEA6       VLATGGGSVVSKAVRNRLSARG----------IVVYLQTTIDKQVARTQR----DKRRPL
AROK_SHEB5       VLATGGGSVQSKDIRNHLSARG----------IVVYLETTIDKQVARTQR----DKRRPL
AROK_SHEB8       VLATGGGSVQSKDIRNHLSARG----------IVVYLETTIDKQVARTQR----DKRRPL
AROK_SHEB9       VLATGGGSVQSKDIRNHLSARG----------IVVYLETTIDKQVARTQR----DKRRPL
AROK_SHESA       VLATGGGSVQSKDIRNHLSARG----------IVVYLETTIDKQVARTQR----DKRRPL
AROK_SHESM       VLATGGGSVQSKDIRNHLSARG----------IVVYLETTIDKQVARTQR----DKRRPL
AROK_SHESR       VLATGGGSVQSKDIRNHLSARG----------IVVYLETTIDKQVARTQR----DKRRPL
AROK_SHEPC       VLATGGGSVQSKDIRNHLSARG----------IVVYLETTIDKQVARTQR----DKRRPL
AROK_SHESW       VLATGGGSVQSKDIRNHLSARG----------IVVYLETTIDKQVARTQR----DKRRPL
AROK_SHEON       VLATGGGSVQSKDIRNHLSARG----------IVVYLETTIDKQVARTQR----DKRRPL
AROK_SHEDO       VLATGGGSVQSKDIRNHLSARG----------IVVYLETTIDKQVARTQR----DKRRPL
AROK_SHEFN       VLATGGGSVQSKDIRNYLSARG----------IVVYLETTIDKQVARTQR----DKRRPL
AROK_SHEAM       VLATGGGSVQSKDIRNYLSARG----------IVVYLETTIDKQVARTQR----DKRRPL
AROK_SHEHH       VLATGGGSIQSKEIRNNLSARG----------IVVYLETTIDKQVARTQR----DKRRPL
AROK_SHEPA       VLATGGGSIQSKEIRNNLSARG----------IVVYLETTIDKQVARTQR----DKRRPL
AROK_SHESH       VLATGGGSIQSKEIRNNLSARG----------IVVYLETTIDKQVARTQR----DKRRPL
AROK_SHEWM       VLATGGGSIQSKEIRNNLSARG----------IVVYLETTIDKQVARTQR----DKRRPL
AROK_SHELP       VLATGGGSIQSKDIRNNLSARG----------IVVYLETTIDKQVARTQR----DKRRPL
AROK_COLP3       VLATGGGSVISTNVRNHLSARG----------IVVYLETTIDKQVARTQR----DRRRPL
AROK_PSET1       VLATGGGSVMSKEVRNKLSARG----------IVVYLETPIEKQVARTQR----DKRRPL
AROK_IDILO       VLATGGGSVMSKESRNRLSARG----------VVVYLKTPIEKQLARTQR----DKRRPL
AROK_ALIF1       VLATGGGSVISKESRNRLSARG----------VVVYLETTIEKQLARTQR----DKKRPL
AROK_ALIFM       VLATGGGSVISKESRNRLSARG----------VVVYLETTIEKQLARTQR----DKKRPL
AROK_ALISL       VLATGGGSVISKESRNRLSARG----------VVVYLETTIEKQLARTQR----DKKRPL
AROK_PHOPR       VLATGGGSVVSKENRNRLSARG----------VVVYLETTIEKQLARTQR----DKKRPL
AROK_VIBCH       VLATGGGSVISKENRNRLSARG----------IVVYLETTIEKQLARTNR----DKKRPL
AROK_VIBC3       VLATGGGSVISKENRNRLSARG----------IVVYLETTIEKQLARTNR----DKKRPL
AROK_VIBCB       VLATGGGSVKSKENRNRLSARG----------VVVYLETTIEKQLARTNR----DKKRPL
AROK_VIBPA       VLATGGGSVKSKENRNRLSARG----------VVVYLETTIEKQLARTNR----DKKRPL
AROK_VIBVU       VLATGGGSVKSRENRNRLSARG----------IVVYLETTIEKQLARTNR----DKKRPL
AROK_VIBVY       VLATGGGSVKSRENRNRLSARG----------IVVYLETTIEKQLARTNR----DKKRPL
AROK_BUCAI       VLATGGGSVKFRETRNFLSSRG----------IVVYLETTIEKQLARTKR----DKKRPL
AROK_BUCAP       VLATGGGSVKFKENRNILSARG----------IVIYLETTIEKQLSRTKR----DKKRPL
AROK_WIGBR       VLATGGGSIQSRKTRNRLSARG----------LVVYLETTIDKQLDRTKR----DKKKPI
AROK_BLOFL       VLATGGGSIKSHIARDHLAKRG----------LVIYLKTTIDKQLVRTKR----DKRRPL
AROK_BLOPB       ILATGGGSVKSHITRNNLSDRG----------FVVYLETTIEKQLIRTQH----DKRRPL
AROK_ACTPJ       VLSTGGGSVLSKENRNVLSARG----------IVIYLETTVDKQFERTQR----DKKRPL
AROK_ACTP2       VLSTGGGSVLSKENRNVLSARG----------IVIYLETTVDKQFERTQR----DKKRPL
AROK_HAEDU       VLSTGGGSILSKENRNALSARG----------IVIYLETTVDKQFERTQR----DKKRPL
AROK_ACTSZ       VLSTGGGVVLSKENRNHLSARG----------IVVYLQTTVAKQFERTQR----DKKRPL
AROK_MANSM       VLSTGGGAILSKETRNHLSARG----------IVIYLQTTVDKQFERTQR----DKKRPL
AROK_HAEIN       VLSTGGGAVLSKENRNYLSARG----------IVIYLETTVEKQFQRTQR----DKKRPL
AROK_HAEIG       VLSTGGGAVLSKENRNYLSARG----------IVIYLETTVEKQFQRTQR----DKKRPL
AROK_HAEIE       VLSTGGGAVLSKENRNYLSARG----------IVIYLETTVEKQFQRTQR----DKKRPL
AROK_HAEI8       VLSTGGGAVLSKENRNYLSARG----------IVIYLETTVEKQFQRTQR----DKKRPL
AROK_PASMU       VLSTGGGAVLSKENRNHLSARG----------IVIYLETTVEKQYQRTQR----DKKRPL
AROK_HISS2       VLSTGGGAIVSKDNRNYLSARG----------TVIYLETTVEKQFQRTQR----DKKRPL
AROK_BUCBP       VLSTGGGSILSREIRNKLSSRG----------VVIYLETSVEKQLVRTKK----NKQRPL
AROK_PSYIN       VLATGGGALIRPENRIHLSARG----------IVVYLKTSVNKQLARTLK----DKRRPL
AROK_FRATF       VLATGGGAILDPETRSLLSSRG----------KVVYLEATIEQQLERTSK----DTKRPL
AROK_FRATH       VLATGGGAILDPETRSLLSSRG----------KVVYLEATIEQQLERTSK----DTKRPL
AROK_FRATO       VLATGGGAILDPETRSLLSSRG----------KVVYLEATIEQQLERTSK----DTKRPL
AROK_FRATM       VLATGGGAILDPETRSLLSSRG----------KVVYLEATIEQQLERTSK----DTKRPL
AROK_FRATN       VLATGGGAILDPETRSLLSSRG----------KVVYLEATIEQQLERTSK----DTKRPL
AROK_FRATT       VLATGGGAILDPETRSLLSSRG----------KVVYLEATIEQQLERTSK----DTKRPL
AROK_FRAT1       VLATGGGAILDPETRSLLSSRG----------KVVYLEATIEQQLERTSK----DTKRPL
AROK_FRATW       VLATGGGAILDPETRSLLSSRG----------KVVYLEATIEQQLERTSK----DTKRPL
AROK_FRAP2       VLATGGGAILDPDTRSLLSSRG----------KVVYLEATIEQQLERTAK----DTKRPL
AROK_LEGPC       VLATGGGVVITPENRNALAGRG----------TVIYLKTSLQQQFERTKR----DTKRPL
AROK_LEGPL       VLATGGGVVITPENRNALAGRG----------TVIYLKTSLQQQFERTKR----DTKRPL
AROK_LEGPA       VLATGGGVVITPENRNALAGRG----------TVIYLKTSLQQQFERTKR----DTKRPL
AROK_LEGPH       VLATGGGVVITPENRNALAGRG----------TVIYLKTSLQQQFERTKR----DTKRPL
AROK_METCA       VLATGGGSVLAAENREHLAARG----------LVIYLQCSVQKQLERTHK----DMNRPL
AROK_PSEAE       VIATGGGAVMRDGNRQVLRAGG----------RVVYLHASVEHQIARTAR----DRNRPL
AROK_PSEA8       VIATGGGAVMRDGNRQVLRAGG----------RVVYLHASVEHQIARTAR----DRNRPL
AROK_PSEAB       VIATGGGAVMRDGNRQVLRAGG----------RVVYLHASVEHQIARTAR----DRNRPL
AROK_PSEA7       VIATGGGAVMRDGNRQILRAGG----------RVVYLHASVEHQIARTAR----DRNRPL
AROK_PSEP1       VLATGGGAVMREANRQALHQGG----------RVIYLHASVEQQVGRTAR----DRNRPL
AROK_PSEPK       VLATGGGAVMREANRQALHQGG----------RVIYLHASVEQQVGRTAR----DRNRPL
AROK_PSEE4       VLATGGGAVMRDANRAALRAGG----------RVVYLHASVEQQVGRTSR----DRNRPL
AROK_PSEF5       VLATGGGAVMREANRRALHAGG----------RVVYLHASVEQQVGRTAR----DRNRPL
AROK_PSEPF       VLATGGGAVMRDANRKALHEGG----------RVVYLHASVEQQVGRTSR----DRNRPL
AROK_PSE14       VLATGGGAVMRGENRQALRAGG----------RVVYLHASIEQQVGRTAR----DRNRPL
AROK_PSESM       VLATGGGAVMRTENRQALRAGG----------RVVYLHASIEQQVGRTAR----DRNRPL
AROK_PSEU2       VLATGGGAVMRSENRHALRAGG----------RVVYLHASIEQQVGRTAR----DRNRPL
AROK_HAHCH       VIATGGGAVVDPDNQIALKENG----------FIVYLHTSVEQQYQRTRK----DRKRPL
AROK_ACIBY       VLATGGGAITQAPNREFLKQRG----------IVVYLYTPVELQLQRTYR----DKNRPL
AROK_ACIBS       VLATGGGAITQAPNREFLKQRG----------IVVYLYTPVELQLQRTYR----DKNRPL
AROK_ACIAD       VLATGGGVVTQPANRSYLKTRG----------VVVYLYTPVELQLQRTYR----DKNRPL
AROK_PSYA2       VLATGGGAVMAAENREFLKQRG----------IVIYLNAPVDVQMARTAK----DKSRPL
AROK_PSYCK       VLATGGGAVMAAENREYLKQRG----------IVIYLNAPVDVQMARTAK----DKSRPL
AROK_PSYWF       VLATGGGVVMQPQNRDNLTKQG----------ITIYLRANVDVQLKRTAK----DKSRPL
AROK_COXBU       ILATGGGVVLDEKNRQQISETG----------VVIYLTASIDTQLKRIGQK--GEMRRPL
AROK_COXB2       ILATGGGVVLDEKNRQQISETG----------VVIYLTASIDTQLKRIGQK--GEMRRPL
AROK_COXBR       ILATGGGVVLDEKNRQQISETG----------VVIYLTASIDTQLKRIGQK--GEMRRPL
AROK_COXBN       ILATGGGVVLDEKNRQQISETG----------VVIYLTASIDTQLKRIGQK--GEMRRPL
AROK_COXB1       ILATGGGVVLDEKNRQQISETG----------VVIYLTASIDTQLKRIGQK--GEMRRPL
AROK_AROAE       VLATGGGVVLDPANRAVLAARG----------IVVYLNVPTQVLWERTRN----DRNRPL
AROK_DECAR       VLATGGGVVINPENRRRLHDTG----------WVVYLNVSPVLLYERTRH----DRNRPL
AROK_NEIMA       VLSTGGGAVLKEENRALIRKSG----------TVVYLHAPPETLLERTRC----DNSRPL
AROK_NEIMB       VLSTGGGAVLKEENRALIRKSG----------TVVYLHAPPETLLERTRC----DNSRPL
AROK_NEIM0       VLSTGGGAVLKEENRALIRKSG----------TVVYLHAPPETLLERTRC----DNSRPL
AROK_NEIG1       VLSTGGGAVLKEENRALIRKSG----------TVVYLHAPPETLLERTRC----DNSRPL
AROK_THIDA       VLATGGGAVLSPANREHLRTNG----------LVIYLRGSPEQLCERTRN----DRNRPL
AROK_NITEU       VLATGGGAILHPDNRALLRQHG----------TVVYLCAPVTELRRRTYL----DKNRPL
AROK_NITMU       ILATGGGAVLSGVNRAMLKHGG----------TVIYLRASIDDLWRRTRH----DKNRPL
AROK_BURMA       VLATGGGAILRPENRKLLHERG----------LVVYLRANPHDLWLRTRK----DKNRPL
AROK_BURPS       VLATGGGAILRPENRKLLHERG----------LVVYLRANPHDLWLRTRK----DKNRPL
AROK_BURP1       VLATGGGAILRPENRKLLHERG----------LVVYLRANPHDLWLRTRK----DKNRPL
AROK_BURTA       VLATGGGAILRPENRKLLHERG----------LVVYLRANPHDLWLRTRK----DKNRPL
AROK_BURL3       VLATGGGAVLRPENRDCLKNNG----------IVVYLRANPHDLWLRTRK----DKNRPL
AROK_RALSO       VVATGGGAVLRPENRAFLRERG----------TVIYLRANPHDLYLRTRH----DKNRPL
AROK_CUPPJ       VLATGGGAVLRPENRELLKSRG----------TVVYLRASPHDLWLRTRH----DRNRPL
AROK_BORPA       ILATGGGAVLAAENRQALRERG----------IVIYLRASVEELFRRTSR----DRNRPL
AROK_BORPE       ILATGGGAVLAAENRQALRERG----------IVIYLRASVEELFRRTSR----DRNRPL
AROK_BORBR       ILATGGGAVLAAENRQALRERG----------IVIYLRASVEELFRRTSR----DRNRPL
AROK_BORA1       ILATGGGAVLAEENRRLLRERG----------IVLYLRASVDELFRRTSR----DRNRPL
AROK_CHRVO       VLATGGGAVLREENRKVLASHG----------TVIYLRASIDDLLARTQH----DKNRPL
AROK_NITOC       VLATGGGAVLAAENRRELSQRG----------IVVYLYAPPKQLYRRTSH----DNNRPL
AROK_HYDCU       VLATGGGAILNPENRKNLRSRG----------FVVYLKSSVDSLVQRTRH----DRNRPL
AROK_ACIAC       VLATGGGVVIRPGNRTRLRERG----------TVVYLNASPEEIFRHIRH----DQTRPL
AROK_STRMK       LVSTGGGAVLDPGNRALIAQRG----------FVVYLRVSVNAQLERLAR----DKGRPL
AROK_STRM5       LVSTGGGAVLDPDNRALIARRG----------FVVYLRVSVAEQLERLAR----DKGRPL
AROK_XANAC       LISTGGGAVLDPRNRERICARG----------FVVYLHVSVPAQLTRLAR----DRNRPL
AROK_XANC5       LISTGGGAVLDPRNRERICARG----------FVVYLHVSVPAQLTRLAR----DRNRPL
AROK_XANOR       LISTGGGTVLDPHNRQRICARG----------FVVHLHVSVPTQLTRLAR----DRNRPL
AROK_XANOM       LISTGGGTVLDPHNRQRICARG----------FVVHLHVSVPTQLTRLAR----DRNRPL
AROK_XANOP       LISTGGGTVLDPHNRQRICARG----------FVVHLHVSVPTQLTRLAR----DRNRPL
AROK_XANCP       LVSTGGGAILDAGNRQRIRERG----------FVVYLHVSVPAQLTRLAR----DRNRPL
AROK_XANC8       LVSTGGGAILDAGNRQRIRERG----------FVVYLHVSVPAQLTRLAR----DRNRPL
AROK_XYLF2       LIATGGGTILDPENRHRMQKRG----------FVVFLKINVNTQLERLAH----DRYRPL
AROK_XYLFT       LIATGGGTILDPENRHRMQKRG----------FVVFLKINVNTQLERLAH----DRYRPL
AROK_XYLFM       LIATGGGTILDPENRHRMQKRG----------FVVFLKINVNTQLERLAH----DRYRPL
AROK_XYLFA       LIATGGGTILDPENRRCMQERG----------FVVFLKINVNTQLERLAH----DRYRPL
AROK_BARHE       VLATGGGAYINEDIRKAVHKNG----------ISIWLKVDLDTLMQRVSK----RPTRPL
AROK_BARQU       VLATGGGAYINEDIRQVINKNG----------ISIWLKADLDILMKRVSR----HPTRPL
AROK_BRUAB       VLATGGGAYMNAETRAAIAEAG----------ISIWINADLDVLMERVSR----RQNRPL
AROK_BRUA2       VLATGGGAYMNAETRAAIAEAG----------ISIWINADLDVLMERVSR----RQNRPL
AROK_BRUSU       VLATGGGAYMNAETRAAIAEAG----------ISIWINADLDVLMERVSR----RQNRPL
AROK_RHILO       VLSTGGGAFMNAQTREAIAGHG----------VSVWLKAELDLLMDRVSK----KQNRPL
AROK_RHIME       VVSTGGGAYINERSRRHIKKGG----------LTIWLNAELDVLWERVNK----RDTRPL
AROK_BRADU       VLATGGGAFMREETRARIAAKA----------VSIWLKADHDVIMRRVRR----RADRPL
AROK_RHOPA       VLATGGGAFMREETRDRIREKA----------ISMWLEAEADVILRRVKR----RADRPL
AROK_NITWN       VLATGGGAVLREETRARLSERA----------VSIWLKADAEVILRRVRR----RADRPL
AROK_CAUVC       VLATGGGAFVNAETRALINEKA----------VSVWLKADVELLARRVSR----KDNRPL
AROK_ZYMMO       VLAVGGGAFMDEETRKLVLEKT----------LAIWVKADIDTLAERVTK----QADRPL
AROK_NOVAD       VLSTGGGAFCDPATRALILERG----------IAVWLDSDVDTLVERVGR----KDNRPL
AROK_MAGSA       VLATGGGAFVDPTTRERIKAAG----------TSVWIRADLELLLKRTVG----RDHRPL
AROK_RHORT       VLATGGGAFMAEDTRALIRLHG----------LSLWLRADLDLLVARTAG----RTHRPL
AROK_RHOS4       VLSTGGGAFMAEGNRRMIREQG----------VSVWLKADLDVLWHRVRH----KATRPL
AROK_RUEPO       VLSTGGGAFLAEANRRMISEHG----------VSVWLKADLTVLWNRVRH----KDTRPL
AROK_NOSS1       TVATGGGIVLRRENWSYLHHGL-----------ILWLDVPVDILYARLAAD--T-T-RPL
AROK_TRIV2       TVATGGGIVLRRENWSYLHHGL-----------IVWLDVSVDILYARLAAD--T-T-RPL
AROK_NOSP7       TIATGGGIVLRRENWGYLHHGL-----------IVWLDVPVELIYRRLAED--T-T-RPL
AROK_RIPO1       VIATGGGIVLNSQNWSYLHHGL-----------IIWLDVSIKLLKTRLIND--T-T-RPL
AROK_MICAN       VIATGGGMVLKPMNWSYLRHGL-----------MIWLDVPLEILVKRLKQD--T-S-RPL
AROK_SYNY3       VIATGGGVVLRRQNWSYLHHGL-----------VIWLDGSLELLLARLQGD--E-A-RPL
AROK_SYNE7       VVATGGGIVIRPENWSYLQQGL-----------VIWLDVPIPELLRRLEGD--Q-N-RPL
AROK_SYNP6       VVATGGGIVIRPENWSYLQQGL-----------VIWLDVPIPELLRRLEGD--Q-N-RPL
AROK_THEEB       VVATGGGIVLNPMNWSYLHHGI-----------VVWLHVPLAVLCQRLRQD--R-E-RPL
AROK_SYNJB       VIATGGGIVLRPKNWSYLHHGL-----------TVWLDVAPELIWQRLKRD--PGQ-RPL
AROK_SYNJA       VVATGGGIVLRPKNWSYLHHGL-----------TVWLDAAPELIWQRLKRD--PGQ-RPL
AROK_GLOVI       VVATGGGVVLARRNWGYLHHGV-----------VVWLDADIETLLGRVEHE--PGT-RPL
AROK_PROMA       VVATGGGLVTRSENWGVLHQGI-----------VIWLDPNRELLFARLKSD--KTVVRPL
AROK_PROMT       VIATGGGLVTLPENWGILHQGI-----------VIWLDLDLRRSIKRLESD--HKR-RPL
AROK_SYNSC       VVATGGGVVTQPENWGLLHSGI-----------VIWLDVVPDQLLQRLNAD--STV-RPL
AROK_SYNPX       VVATGGGVVTQQENWGLLHSGI-----------VVWLDVVPEQLMQRLRAD--STV-RPL
AROK_SYNS9       VVATGGGVVTKPENWGQLHSGI-----------VVWLDVNRAQLIERLRDD--STQ-RPL
AROK_PROMM       VVATGGGIVSKPENWGVLHQGI-----------VIWLNPGREELLRRLNAD--SGN-RPL
AROK_LACF3       ILATGGGTPVAERNQRLLEHAQA---------PVILLTASPAETARRLGDG--EGR---P
AROK_CHLP8       VVSLGGGVLENDRCFELIRRTGT----------LVYMKSSPEILSLRLQHK----TDRPL
AROK_CHLTE       VVSLGGGVLENDRCFELIRSHGT----------LIYLKSSPEILTLRLQHK----TDRPL
AROK_CHLL2       VVSLGGGVLENNDCYRLIRENGT----------LVYLKSSPRSLARRLCNK----TDRPL
AROK_CHLPD       IVSLGGGALESNECYTLIKEKGT----------LVYLKSGSGTLTKRLCHK----TDRPL
AROK_CHLPB       VVSLGGGALQNNDCFSLIISSGT----------MVYLHSSPLILAKRMSHK----TDRPL
AROK_PROA2       VVSLGGGLLQNDRCFSLIISTGT----------LVYLHSNPLVLAKRLSHK----SDRPL
AROK_CHLCH       VVSLGGGVLEQPRAFELVRQAGT----------VVYLKSPVKTLARRLSNK----TDRPL
AROK_PELLD       VVSLGGGALQYDPSHAFIAGAGT----------LVYLKSSAANLAKRLVNK----RDRPL
AROK_CHLPM       VASLGGGALEHTPTFELISTTGT----------LVYLKSDPKNLAKRLFHK----TDRPL
AROK_CHLT3       VVALGGGTLENDKCFEFIRKAGT----------LVYLKSDVATLARRLSHK----EDRPL
AROK_SALRD       VVALGGGALLDDANRAFAKEHGL----------VLYLEAPVDTLLGRVTGD--D-TRRPL
AROK_AQUAE       VISTGGGLGANEEALNFMKSRGT----------TVFIDIPFEVFLERCKDS----KERPL
AROK_THET2       VLSLGGGTFMDPESQKALLGRGP----------VVALWASPETILERAMRK--P-GERPL
AROK_THET8       VLSLGGGTFMDPESQKALLGRGP----------VVALWASPETILERAMRK--P-GERPL
AROK_DEIRA       VISLGGGTFIHEENRRLLLSRGP----------VVVLWATPETVYQRTKHS-----DRPL
AROK_THEP3       VIATGGGVVLNPSNIVQLRKNGV----------VICFVARPEIILRNIGKN----KDRPL
AROK_THEPX       VIATGGGVVLNPSNIVQLRKNGV----------VICFVARPEIILRNIGKN----KDRPL
AROK_CALS4       VIATGGGVVLNPSNIVQLRKNGV----------IILLKARPEVILRNISKT----KDRPL
AROK_THEYD       VIATGGGVVLRDENMKRLKKDGV----------IFCLRASENVIFERLKQT----TNRPL
AROK_CALS8       VISTGGGVVLDPENVNLLRKNGV----------IYFLYASPENILKRLKDD----NTRPL
AROK_DESAP       VVATGGGVVLNPENVANLRAGGV----------LIGLSADPEVIYQRVRRK----KSRP-
AROK_PELTS       VISTGGGMVLNPENVRLLKENGV----------LIALTADPEVICRRVKNK----KNRPL
AROK_GEOMG       VVSTGGGAVISPENRCLLRKAGV----------VVNLTATVEEVCRRLREE----TDRPL
AROK_GEOSL       VVATGGGAVIAPRNRVLLREAGL----------VVNLTASLEVILSRLKGD----RERPL
AROK_MOOTA       VIATGGGAVLCGVNVKLLREGNK----------VVWLQVRPETALKRAGLD----DSRPL
AROK_SYMTH       VIATGGGAVLRTENREALRRTGF----------VIWLDAEPETLYDRARGQ--GLHRRPL
AROK_DESAG       VVSTGGGMVLRADNRAALREGG----------IVFYLCAPAAVLASRLVLDPVVS-QRPS
AROK_DESVH       VVATGGGMVLRAENRALLREAG----------VTVFLSLPVEVVAARLARNPEHG-QRPS
AROK1_PELCD      VIATGGGMVLATANRKYMRAHG----------KVFYLHVPAEVMAERLKADPNSA-QRPT
AROK2_PELCD      VVATGGGMVLSEENRDFMRANG----------TVFYLSAPAEVLAARLEAYPDAG-QRPT
AROK_RHOBA       VIALGGGTILREANRNIIANSG----------WCVWLDAEPDVLVARLAGDATTADRRPS
AROK_SYNAS       VLATGGGAVLDPKNAEVLKSLG----------WVVLLTASEEIIVRRILNDPASREQRPS
AROK_DEHMB       IIDCGGGIVTRPHNLSIMRLNC----------LVVYLESRPEDLENRLKNH----TNRPL
AROK_DEHMC       IIDCGGGIVTRPHNLSIMRLNC----------LVVYLESRPEDLENRLKNH----TNRPL
AROK_DEHM1       IIDCGGGIVMRPPNLSLMRLNC----------LVIYLESRPEDLEARLKNH----TNRPL
AROK_LEPBA       ILDCGGGILFDLDESGNEVLSERKLDLLRKIGRIVYLERGIEELVEKVKG----DKTRPD
AROK_LEPBP       ILDCGGGILFDLDESGNEVLSERKLDLLRKIGRIVYLERGIEELVEKVKG----DKTRPD
AROK_CHLMU       VVALGGKTLLDKQIYEHITQREN--------ILLVLLDLPFATLYQRLQK-------KPL
AROK_CHLTR       IVALGGCTPIIEPSYAHILGRNS--------ALLVLLELPIATLCQRLQH-------RSI
AROK_CHLPN       LISLGGGTLMYEASYRAIQTRGA----------LVFLSVELPLIYERLEK-----RGLPE
                     **                              .                       

AROK_ALKOO       LVDER-------KSMDKIIEILE----NRRLYYEGTSEIKIPVSHRTLEEIIKDIVCNI-
AROK_FUSNN       LNDVE-------DKRKLIEELLE----KRKFLYQISADYIIDINEHTNIYETVDKIKEIY
AROK_BACFR       LQG---------KKDDELLDFIVQALEKRAPFYRQ-ANYIYCADKLEDRSQIETSVQQLR
AROK_BACFN       LQG---------KKDDELLDFIVQALEKRAPFYRQ-ANYIYCADKLEDRSQIETSVQQLR
AROK_BACTN       LQG---------KEDDELMDFIIQALEKRAPFYTQ-AQYIFNADELEDRWQIESSVQRLQ
AROK_BACV8       LAN---------KSDEELMDFICEALQKRHPFYSK-AKHLFKADELEDKRQIQASVDSLR
AROK_PARD8       LKG---------RSGEELRAFIAESLEKRNPFYTK-ASITFDAEKMLTESDVHDISNALM
AROK_AZOPC       IKD---------KSPEEIKYFVINNLVKRELFYNQ-ASIVFFIKKM----TMNDIIENLM
AROK_FLAJ1       IAN---------MDEEEMKEFIAKHLFDRSFYYNH-AQHKVAVDNRTIDETVQDILDILA
AROK_METI4       LLG---------K---EPKVILEKLLKEREVLYKQ-ADIEIAVDGRTVEELGELLWSYWE
AROK_BACLD       LHN---------RTIEEMKQLFN----ERKSIYAF-HHLKVETDNRSAEETADYIVEMLK
AROK_BACP2       LHN---------RTLDEMKELFE----ERREIYSL-HNSRVETDHLEAEEVANYIVDTLK
AROK_BACSU       LHN---------RSMDEMEQLFN----ERKVIYDK-HNSKVATDNLSPEEVADYIVETLK
AROK_GEOKA       LKN---------KTLEEVEQLFF----QRQSAYAL-HHSRVVLNELEAEQAAEQIVESIK
AROK_GEOTN       LKN---------KTLEEVEQLFF----QRQSAYAL-HHSRVVINELEAEQAADQIVESIK
AROK_OCEIH       LQG---------KTMKEMKQLYE----DRKPIYEQ-HHSRVDTDYHEIEEVADYIAESLK
AROK_BACHD       LQD---------KKVEEMEQLFT----KRQPTYQK-NSFQVETDGREVAEIVSYLEEVIK
AROK_CLOB1       LKN---------NDTKFLEEMYK----NRIEIYEK-AHTIICNTNYKESLITIVRAYKKW
AROK_CLOBH       LKN---------NDTKFLEEMYK----NRIEIYEK-AHTIICNTNYKESLITIVRAYKKW
AROK_CLOBL       LKN---------NDTKFLEEMYK----NRIEIYEK-AHTIICNTNYEESLITIVRAYKKW
AROK_CLOBK       LKN---------NDTKFLEEMYK----NRIEIYEK-AHTIICNTNYEESLIKIVRAYKKW
AROK_CLOBM       LKN---------DDTKFLEEMYK----NRIEIYEK-AHTIICNTNYEESLIAIVKAYKKW
AROK_HELPY       L-----------NNLTQAKELFE----KRQALYEK-NASFIIDARGGLNNSLKQVLQFIA
AROK_HELPJ       L-----------NNLTQAKELFE----KRQALYEK-NASFIIDARGGLNNSLKQVLQFIA
AROK_HELPG       L-----------NNLTQAKELFE----KRQALYEK-NASFIIDARGGLNNSLKQVLQFIA
AROK_HELP2       L-----------NDLTQAKELFE----KRQALYEK-NASFIIDARGGLNNSLKQVLQFIA
AROK_HELPH       L-----------NNLTQAKELFE----KRQALYEK-NASFIIDARGGLNNSLKQVLQFIA
AROK_HELAH       L-----------NNLTQAKELFE----KRQALYEK-NASFIINAQGGLKKSLKQALQFIA
AROK_HELHP       F-----------SDISKARQLYN----ERKSIYKK-QSKYIINGDASALEIARKIIECMD
AROK_CLOBA       LLK---------NGKERIIGLYK----ERYDIYNKACHKIVVND-GTIDEVIEEIKKIII
AROK_CLOBB       LLK---------NGKERIIGLYK----ERYDIYKKACHKIVVNG-STIDEVVGEIKKIII
AROK_CLOB8       LLK---------EGREKIIKLYE----ERYELYRLCADKIIRND-REIGNIVNEIKEVIL
AROK_DICTD       LLK---------KGREELYNLWK----KRLPLYESCADIIVEVDNKDIDEITFEIIERLR
AROK_BACC7       FQKK---------DIDAFVMKFE----LR-RAYYEEAHIHIDTTNKSVKQIMDELKEKIN
AROK_BACC0       FQKK---------DIDAFVTKFE----SR-RAYYEEAHIHIDTTNKSVKQIMNELKEKIN
AROK_BACMK       FQKK---------DIDAFITKFE----SR-RAYYEEADIHIDTTNKSVKQIMNELKQKIN
AROK_BACC2       FQKK---------DIDAFVKKFE----SR-RAYYEEAHIHIDTTNKSVKQIMNELKEKIN
AROK_BACCN       FQKE---------NVEAFVAKFE----ER-RAFYEEAVIQIDTTNKSIQEVTEEILRRIN
AROK_STAAC       ANNK---------TIKQLNDLYC----SRNLRYNEIAFKKFDSHLLSISEIYYELLNLIK
AROK_STAA8       ANNK---------TIKQLNDLYC----SRNLRYNEIAFKKFDSHLLSISEIYYELLNLIK
AROK_STAAE       ANNK---------TIKQLNDLYC----SRNLRYNEIAFKKFDSHLLSISEIYYELLNLIK
AROK_STAAT       ANNK---------TIKQLNDLYC----SRNLRYNEIAFKKFDSHLLSISEIYYELLNLIK
AROK_STAAS       ANNK---------TIKQLNDLYC----SRNLRYNEIAFKKFDSHLLSISEIYYELLNLIK
AROK_STAAW       ANNK---------TIKQLNDLYC----SRNLRYNEIAFKKFDSHLLSISEIYYELLNLIK
AROK_STAA1       ANNK---------TIKQLNDLYC----SRILRYNEIAFKKFDSHLLSISEIYYELLNLIK
AROK_STAAM       ANNK---------TIKQLNDLYC----SRILRYNEIAFKKFDSHLLSISEIYYELLNLIK
AROK_STAAN       ANNK---------TIKQLNDLYC----SRILRYNEIAFKKFDSHLLSISEIYYELLNLIK
AROK_STAA2       ANNK---------TIKQLNDLYC----SRILRYNEIAFKKFDSHLLSISEIYYELLNLIK
AROK_STAA9       ANNK---------TIKQLNDLYC----SRILRYNEIAFKKFDSHLLSISEIYYELLNLIK
AROK_STAAR       ANNK---------TIKQLNDLYC----SRILRYNEIAFKKFDSHLLSISEIYYELLNLIK
AROK_STAES       AKSK---------NLNQLDALYS----SRLSRYNEIAFMKVDSAQ-SVSEICTLIKTKLL
AROK_STAEQ       AKSK---------NLNQLDALYS----SRLSRYNEIAFMKVDSAQ-SVSEICTLIKTKLL
AROK_STAS1       ANNK---------SLFELKSLYS----SRVSRYNEIAFIKVNSSQ-SLSDLQNDIMEAIV
AROK_STAHJ       AIDK---------SKKQLNNLYL----SRISRYNEIAFMKVNSDK-TIREIYNEIINYLT
AROK_LACLM       AQD-----------KEAAQLLFE----KRMKDYSLVADLTIDVTDKSPEQIAEQIREKWE
AROK_LACLS       AQD-----------KEAAQLLFE----KRMKDYSLVADLTIDVTDKSPEQIAELIREKWE
AROK_LACLA       AQD-----------KKAAQLLFE----KRKNDYAKVADLTIDVTDKSPEQIVEEIREKWG
AROK_STRPB       FLKY---------SKEAFYEFYQ----QRMVFYEGLSDLVIRVDHRTPEEVANIIEGY--
AROK_STRPC       FLKY---------SKEAFYEFYQ----QRMVFYEGLSDLVIRVDHRTPEEVANIIEGY--
AROK_STRPD       FLKY---------SKEAFYEFYQ----QRMVFYEGLSDLVIRVDHRTPEEVANIIEGY--
AROK_STRPZ       FLKY---------SKEAFYEFYQ----QRMVFYEGLSDLVIRVDHRTPEEVANIIEGY--
AROK_STRPG       FLKY---------SKEAFYEFYQ----QRMVFYEGLSDLVIRVDHRTPEEVANIIEGY--
AROK_STRPF       FLKY---------SKEAFYEFYQ----QRMVFYEGLSDLVIRVDHRTPEEVANIIEGY--
AROK_STREM       FLNH---------SKAEFYAIFQ----QRMALYEGLADKVINVEHRTPKEVAAIIANMS-
AROK_STRTD       FLNH---------SKEEFKAIYD----GRMALYKGLADLVVTVDNRTPEEVARFIKCM--
AROK_STRSY       FLQC---------SKEEFEALYR----ERMALYQGLADTVIDTDKLIPEQVARKILCK--
AROK_STRS2       FLQC---------SKEEFEALYR----ERMALYQGLADTVIDTDKLIPEQVARKILCK--
AROK_STRGC       YLNN---------TREEFKKIFE----ARLPIYEKIATHIIDVAGKTPEEIAEIIRCL--
AROK_ENTFA       AIER---------SSKEIITLFE----SRKNFYEECAKMTIDTTNRSPEEIINEILQQLK
AROK_SALAI       LAV-N--------PRATLKHLLD----QRRPYYAAVATATVVTDG-RTPEQLAVEVAALL
AROK_SALTO       LAV-N--------PRATLKYLLE----QRRPHYAAVATATVVTDG-RTPEQLAVEVAALL
AROK_ACIC1       LLG-N--------PRAQLRALMD----ARRPLYEQTATHTVGTTG-RTPDEVADEIAALI
AROK_THEFY       LLG-N--------PRARLKALLR----ERLPIYQSLATLTVSTSE-HTPEEAAELIAKEL
AROK_STRAW       LAV-N--------PRRQWRELME----ARRHLYTEVARAVVATDG-RGPEEVAQAVLDAL
AROK_STRCO       LAV-N--------PRKQWRELME----ARRHLYEDVATAVVATDG-RTPEEVTQAALDAV
AROK_FRACC       LVE-G--------PRTRLAALLR----ARRPLYAEVATVVIDTAG-HEPDEVTDLLAAAL
AROK_SACEN       LAGVN--------PRATFKALLD----ARLPLYREVATWELATDG-VEPDALVDRIVERV
AROK_MYCA1       LAGPD--------RAEKYRALLA----ERSPLYRRAATIRVDTNR-RNPGAVVRYIVSRL
AROK_MYCPA       LAGPD--------RAEKYRALLA----ERSPLYRRAATIRVDTNR-RNPGAVVRYIVSRL
AROK_MYCBO       LAGPD--------RAEKYRALMA----KRAPLYRRVATMRVDTNR-RNPGAVVRHILSRL
AROK_MYCBP       LAGPD--------RAEKYRALMA----KRAPLYRRVATMRVDTNR-RNPGAVVRHILSRL
AROK_MYCTU       LAGPD--------RAEKYRALMA----KRAPLYRRVATMRVDTNR-RNPGAVVRHILSRL
AROK_MYCTA       LAGPD--------RAEKYRALMA----KRAPLYRRVATMRVDTNR-RNPGAVVRHILSRL
AROK_MYCMM       LAGPD--------RAEKFRALMS----QRIPLYRRVSTIRVDTNR-RNPGAVVRYIMSRL
AROK_MYCUA       LAGPD--------RAEKFRALMS----QRIPLYRRVSTIRVDTNR-RNPGAVVRYIMSRL
AROK_MYCLE       LAGPD--------RAEKFQDLMA----RRVPLYRRVATIRVDTNC-HNLGAVVRYIMARL
AROK_RHOJR       LAGGD--------PRQKYTELMR----KRRPLYRQVASIRIRTDG-RSPARVVQQLVAKL
AROK_COREF       LAADD--------PVEHYRNLLE----TRRPLYEEVSTFRVRTNS-RSPQQVVAEILHHL
AROK_CORGL       LQAAD--------PAEHYRNLVK----VRTPLYEEVATYRLRTNN-RSPQQVVAAVLHHL
AROK_CORDI       LDTTN--------PLERYSELLA----QRRDFYKEVADYRAHTDG-RSPQQIVADILGFL
AROK_CORJK       LNVAD--------PRGKYAQLFA----QRSAFYEEVSNFMVRCDG-KEPRRVVTDILSFI
AROK_ECO8A       LHVET-------PPREVLEALAN----ERNPLYEEIADVTIRTDD-QSAKVVANQIIHML
AROK_ECOHS       LHVET-------PPREVLEALAN----ERNPLYEEIADVTIRTDD-QSAKVVANQIIHML
AROK_ECO7I       LHVET-------PPREVLEALAN----ERNPLYEEIADVTIRTDD-QSAKVVANQIIHML
AROK_ECOL6       LHVET-------PPREVLEALAN----ERNPLYEEIADVTIRTDD-QSAKVVANQIIHML
AROK_ECO45       LHVET-------PPREVLEALAN----ERNPLYEEIADVTIRTDD-QSAKVVANQIIHML
AROK_ECOLU       LHVET-------PPREVLEALAN----ERNPLYEEIADVTIRTDD-QSAKVVANQIIHML
AROK_ECO57       LHVET-------PPREVLEALAN----ERNPLYEEIADVTIRTDD-QSAKVVANQIIHML
AROK_ECO24       LHVET-------PPREVLEALAN----ERNPLYEEIADVTIRTDD-QSAKVVANQIIHML
AROK_ECOLI       LHVET-------PPREVLEALAN----ERNPLYEEIADVTIRTDD-QSAKVVANQIIHML
AROK_ECODH       LHVET-------PPREVLEALAN----ERNPLYEEIADVTIRTDD-QSAKVVANQIIHML
AROK_ECOLC       LHVET-------PPREVLEALAN----ERNPLYEEIADVTIRTDD-QSAKVVANQIIHML
AROK_SHISS       LHVET-------PPREVLEALAN----ERNPLYEEIADVTIRTDD-QSAKVVANQIIHML
AROK_SHIFL       LHVET-------PPREVLEALAN----ERNPLYEEIADVTIRTDD-QSAKVVANQIIHML
AROK_SHIDS       LHVET-------PPREVLEALAN----ERNPLYEEIADVTIRTDD-QSAKVVANQIIHML
AROK_SHIBS       LHVET-------PPREVLEALAN----ERNPLYEEIADVTIRTDD-QSAKVVANQIIHML
AROK_SHIB3       LHVET-------PPREVLEALAN----ERNPLYEEIADVTIRTDD-QSAKVVANQIIHML
AROK_ENT38       LQVET-------PPREVLEALAG----ERNPLYEEIADVTIRTDD-QSAKVVANQIIHML
AROK_SALA4       LQVEA-------PPREVLEALAN----ERNPLYEEIADVTIRTDD-QSAKVVANQIIHML
AROK_SALCH       LQVEA-------PPREVLEALAN----ERNPLYEEIADVTIRTDD-QSAKVVANQIIHML
AROK_SALDC       LQVEA-------PPREVLEALAN----ERNPLYEEIADVTIRTDD-QSAKVVANQIIHML
AROK_SALEP       LQVEA-------PPREVLEALAN----ERNPLYEEIADVTIRTDD-QSAKVVANQIIHML
AROK_SALG2       LQVEA-------PPREVLEALAN----ERNPLYEEIADVTIRTDD-QSAKVVANQIIHML
AROK_SALHS       LQVEA-------PPREVLEALAN----ERNPLYEEIADVTIRTDD-QSAKVVANQIIHML
AROK_SALNS       LQVEA-------PPREVLEALAN----ERNPLYEEIADVTIRTDD-QSAKVVANQIIHML
AROK_SALPA       LQVEA-------PPREVLEALAN----ERNPLYEEIADVTIRTDD-QSAKVVANQIIHML
AROK_SALPK       LQVEA-------PPREVLEALAN----ERNPLYEEIADVTIRTDD-QSAKVVANQIIHML
AROK_SALSV       LQVEA-------PPREVLEALAN----ERNPLYEEIADVTIRTDD-QSAKVVANQIIHML
AROK_SALTI       LQVEA-------PPREVLEALAN----ERNPLYEEIADVTIRTDD-QSAKVVANQIIHML
AROK_SALTY       LQVEA-------PPREVLEALAN----ERNPLYEEIADVTIRTDD-QSAKVVANQIIHML
AROK_CITK8       LQVEA-------PPREVLEALAN----ERNPLYEEIADVTIRTDD-QSAKVVANQIIHML
AROK_ESCF3       LQVEA-------PPREVLEALAN----ERNPLYEEIADVTIRTDD-QSAKVVANQIIHML
AROK_SERP5       LQVDS-------PPREVLEALAK----ERNPLYEEIADVTIRTDD-QSAKVVANQIINML
AROK_YERE8       LQVDS-------PPREVLEALAK----ERNPLYEEIADVTIRTDD-QSAKVVANQIINML
AROK_YERPE       LQVDE-------PPREVLEALAK----ERNPLYEEIADVTIRTDD-QSAKVVANQIINML
AROK_YERPP       LQVDE-------PPREVLEALAK----ERNPLYEEIADVTIRTDD-QSAKVVANQIINML
AROK_YERPG       LQVDE-------PPREVLEALAK----ERNPLYEEIADVTIRTDD-QSAKVVANQIINML
AROK_YERPA       LQVDE-------PPREVLEALAK----ERNPLYEEIADVTIRTDD-QSAKVVANQIINML
AROK_YERPN       LQVDE-------PPREVLEALAK----ERNPLYEEIADVTIRTDD-QSAKVVANQIINML
AROK_YERPS       LQVDE-------PPREVLEALAK----ERNPLYEEIADVTIRTDD-QSAKVVANQIINML
AROK_YERPB       LQVDE-------PPREVLEALAK----ERNPLYEEIADVTIRTDD-QSAKVVANQIINML
AROK_YERP3       LQVDE-------PPREVLEALAK----ERNPLYEEIADVTIRTDD-QSAKVVANQIINML
AROK_YERPY       LQVDE-------PPREVLEALAK----ERNPLYEEIADVTIRTDD-QSAKVVANQIINML
AROK_PECAS       LQVET-------PPREVLEALAK----ERNPLYEEIADVTIRTDE-QSAKVVANQIINML
AROK_ERWT9       LQVES-------PPREVLEALAD----ERNPLYDEIADVTIRTDD-QSAKVVANQIINML
AROK_SODGM       LQVEA-------PPREVLEALAR----ERNPLYEEIADVTIRTDE-QSAKVVANQIINML
AROK_PHOLL       LQVDA-------PAREVLENLAN----ERNPLYEEIADVTIRTDE-QSAKVVANQIIELL
AROK_BAUCH       LQAKI-------PSREVLEALAR----ERNPLYEEIADITIRANE-QSAKVVAYHIISML
AROK_AERHH       LQTEE-------PPREVLERLAQ----ERNALYEEVADFVIQTDD-QSAKVVANQIVKLI
AROK_AERS4       LQTEE-------PPREVLERLAQ----ERNALYEEVADFVIQTDD-QSAKIVANQIVKLI
AROK_ALTMD       LQN-E-------DPEQVLRDLAE----MRNPLYEEVADYIVDTDD-QSARAVANQIISKI
AROK_PSEA6       LQK-D-------DPETVLRRLAE----ERNPMYEDAADYIVDTDE-QSARAVANQIIEKI
AROK_SHEB5       LQV-D-------DPREVLENLAE----IRNPLYEEIADVIVKTDD-QSAKIVANQIIEQL
AROK_SHEB8       LQV-D-------DPREVLENLAE----IRNPLYEEIADVIVKTDD-QSAKIVANQIIEQL
AROK_SHEB9       LQV-D-------DPREVLENLAE----IRNPLYEEIADVIVKTDD-QSAKIVANQIIEQL
AROK_SHESA       LQV-D-------DPREVLENLAE----IRNPLYEEIADVIVKTDD-QSAKVVANQIIEQL
AROK_SHESM       LQV-D-------DPREVLENLAE----IRNPLYEEIADVIVKTDD-QSAKVVANQIIEKL
AROK_SHESR       LQV-D-------DPREVLENLAE----IRNPLYEEIADVIVKTDD-QSAKVVANQIIEKL
AROK_SHEPC       LQV-D-------DPREVLESLAE----IRNPLYEEIADVIVKTDD-QSAKIVANQIIEKL
AROK_SHESW       LQV-D-------DPREVLESLAE----IRNPLYEEIADVIVKTDD-QSAKIVANQIIEKL
AROK_SHEON       LQV-D-------DPREVLESLAE----IRNPLYEEIADVVVKTDD-QSAKVVANQIIEKL
AROK_SHEDO       LQV-D-------DPREVLENLAE----TRNPLYEEIADVIVKTDE-QSAKIVANQIIEQL
AROK_SHEFN       LQV-D-------DPREVLESLAE----IRNPLYEEIADVIVKTDE-QSAKIVANQIIEQL
AROK_SHEAM       LQV-D-------DPRSVLETLAE----SRNPLYEEIADVIVKTDD-QSAKVVANQIIEQL
AROK_SHEHH       LQV-D-------DPREVLENLAE----VRNPLYEEIADVIVKTDE-QSAKVVANQIIEQL
AROK_SHEPA       LQV-D-------DPREVLESLAE----VRNPLYEEIADVIVKTDE-QSAKVVANQIIEQL
AROK_SHESH       LQV-D-------DPREVLENLAA----TRNPLYEEIADVIVKTDE-QSAKVVANQIIEQL
AROK_SHEWM       LQV-E-------DPREVLENLAA----TRNPLYEEIADVIVKTDE-QSAKVVANQIIEQL
AROK_SHELP       LQV-E-------DPREVLEKLAE----IRNPLYEEIADVIVKTDE-QSAKVVANQIIDQL
AROK_COLP3       LQTSE-------EPRTVLENLAV----ERNPLYEDIADIIVQTDD-QSAKVVAHKIIERL
AROK_PSET1       LQTEE-------APRDVLERLAE----EREPLYKEVADFVVRTDE-QSAKVVANQIIEKL
AROK_IDILO       IAEAE-------DPRKVLEELAQ----ERDPLYEEIADITVQTDE-QSAKFVVNDIIEQL
AROK_ALIF1       LQT-D-------EPREVLEALAK----ERNALYEEVSDYVVRTDD-QSAKVVANQIIQML
AROK_ALIFM       LQT-D-------EPREVLEALAK----ERNALYEEVSDYVVRTDD-QSAKVVANQIIQML
AROK_ALISL       LQT-D-------EPREVLEALAK----ERNALYEEVSDYVVRTDD-QSAKVVANQIIQML
AROK_PHOPR       LQT-D-------APREVLEALAA----ERNPMYEEVSDYVVRTDD-QSAKVVANQIINML
AROK_VIBCH       LQT-D-------CPREVLEQLAE----DRNPLYEEIADITVRTDD-QSAKVVANQIVKML
AROK_VIBC3       LQT-D-------CPREVLEQLAE----DRNPLYEEIADITVRTDD-QSAKVVANQIVKML
AROK_VIBCB       LQT-D-------NPREVLESLAG----ERNPLYEEVADYTVRTDD-QSAKVVANQIVKML
AROK_VIBPA       LQT-D-------NPREVLEQLAE----ERNPLYEEVADYTVRTDD-QSAKVVANQIVKML
AROK_VIBVU       LQT-D-------NPREVLESLAG----ERNPLYEEIADYTVRTDD-QSAKVVANQIVKML
AROK_VIBVY       LQT-D-------NPREVLESLAG----ERNPLYEEIADYTVRTDD-QSAKVVANQIVKML
AROK_BUCAI       LQNAD-------SNRMILENLAY----ERNPFYEEIADIKVKTDD-QSAKSVAFNIIRLL
AROK_BUCAP       LQSNI-------SNRTVLENLAY----ERNPLYEEIADFKIQTDN-QSAKSVAYSIIHLL
AROK_WIGBR       LQNKN-------SVKSFLEKLAT----ERNPLYEDIADLIIKTDF-KSAKIIAHQIINTL
AROK_BLOFL       LKSSTLF--NYQNLRELLEDLAK----ERNPLYEEISDITVSTDE-YSVKCVVNKILVLL
AROK_BLOPB       LRSSS----ASGNTRDLLQVLAK----ERNPLYEEIADIRISTDE-QNVRVVVNKIIILR
AROK_ACTPJ       LQ-TE-------NPRETLEALAK----VRNPLYEEIADITLQTDE-QSAKLVATHIIELI
AROK_ACTP2       LQ-TE-------NPRETLEALAK----VRNPLYEEIADITLQTDE-QSAKLVATHIIELI
AROK_HAEDU       LQ-TE-------DPRKILEAIAK----ERNPLYEEIADITLQTDE-QSAKVVATHIIELI
AROK_ACTSZ       LQGVE-------DARQVLENLAV----IRNPLYEEVADITLPTDE-QSAKVMANQIIDLI
AROK_MANSM       LQGVE-------DVRKVLEDLAQ----VRNPLYEEVADITLPTDE-QSAKLMASHIVELI
AROK_HAEIN       LQDAE-------NPRQVLEDLAK----IRNPLYEEIADITLPTDE-QNAKIMVNQIVDLI
AROK_HAEIG       LQDAE-------NPRQVLEDLAK----IRNPLYEEIADITLPTDE-QNAKIMVNQIVDLI
AROK_HAEIE       LQDAE-------NPRQVLEDLAK----IRNPLYEEIADITLPTDE-QNAKIMVNQIVDLI
AROK_HAEI8       LQDAE-------NPRQVLEDLAK----IRNPLYEEIADITLPTDE-QNAKVMVNQIVDLI
AROK_PASMU       LQEVE-------DPRQVLEDLAK----IRNPLYEEIADITLPTDE-QSAKVMATQIVDLI
AROK_HISS2       LQNVE-------DPRQVLEDLAK----VRNPLYEEVADIILPTDE-QSAKLMANQIIDLI
AROK_BUCBP       LQVDN------TSIQTVLEELAF----HRNPLYQSIADITIRMND-RSIKAIVFYIIRLL
AROK_PSYIN       LQTDD--------PRTVLEALAE----KRNEFYDEVADYTMETDE-QSAKVVASQIIALL
AROK_FRATF       LRVDD--------KRPVLEQLMA----EREPLYRSIADVVVETNG-ATVKNIVNKISTFL
AROK_FRATH       LRVDD--------KRPVLEQLMA----EREPLYRSIADVVVETNG-ATVKNIVNKISTFL
AROK_FRATO       LRVDD--------KRPVLEQLMA----EREPLYRSIADVVVETNG-ATVKNIVNKISTFL
AROK_FRATM       LRVDD--------KRPVLEQLMA----EREPLYRSIADVVVETNG-ATVKNIVNKISTFL
AROK_FRATN       LRVDD--------KRPVLEQLMA----EREPLYRSIADVVVETNG-ATVKNIVNKISTFL
AROK_FRATT       LRVDD--------KRPVLEQLMA----EREPLYRSIADVVVETNG-ATVKNIVNKISTFL
AROK_FRAT1       LRVDD--------KRPVLEQLMA----EREPLYRSIADVVVETNG-ATVKNIVNKISTFL
AROK_FRATW       LRVDD--------KRPVLEQLMA----EREPLYRSIADVVVETNG-ATVKNIVNKISTFL
AROK_FRAP2       LRVDD--------KKPVLEQLMA----EREPLYRSIADVVVETNG-ATVKNIVNKISTFL
AROK_LEGPC       LQTED--------LEGRLESLRD----EREPFYDELADVSFETDK-LTVKAVANNIIKYL
AROK_LEGPL       LQTED--------LEGRLESLRD----EREPFYDELADVSFETDK-LTVKAVANNIIKYL
AROK_LEGPA       LQTED--------LEGRLESLRD----EREPFYDELADVSFETDK-LTVKAVANNIIKYL
AROK_LEGPH       LQTED--------LEGRLESLRD----EREPFYDELADVSFETDK-LTVKAVANNIIKYL
AROK_METCA       LQTEN--------PRQRLEELLR----VRDPIYRELADYVVDTGQ-HSSRSAVRRIINAY
AROK_PSEAE       LQKPN--------PGQILRDLMA----LRDPLYREIADVVVETDE-RPPRLVVQEILERL
AROK_PSEA8       LQKPN--------PGQILRDLMA----LRDPLYREIADVVVETDE-RPPRLVVQEILERL
AROK_PSEAB       LQKPN--------PGQILRDLMA----LRDPLYREIADVVVETDE-RPPRLVVQEILERL
AROK_PSEA7       LQKPN--------PGQILRDLMD----LRDPLYREIADVVVETDE-RPPRLVVQEILERL
AROK_PSEP1       LRTAN--------PEATLRTLLE----TRDPLYREIADLVVETDE-RPPRMVVIDILERL
AROK_PSEPK       LRTAN--------PEATLRTLLE----TRDPLYREIADLVVETDE-RPPRMVVIDILERL
AROK_PSEE4       LRTAN--------PEATLRALFE----ARDPLYREIADLVVETDE-RPPRMVVLDILERL
AROK_PSEF5       LRTAD--------PAKTLRDLLE----IRDPLYREIADLVVETDE-RPPRMVVLDILERL
AROK_PSEPF       LRTAN--------PEKTLRDLLA----IRDPLYREIADLVVETDE-RPPRMVVLDILDRL
AROK_PSE14       LRTAD--------PARVLSELLA----IRDPLYREIADVVIETDE-RPPRMVVLEILARL
AROK_PSESM       LRTAD--------PARVLSELLA----IRDPLYREIADVVIETDE-RPPRMVVLEILARL
AROK_PSEU2       LRTAD--------PARVLSELLA----IRDPFYREIADIVIETDE-RPPRMVVLEILARL
AROK_HAHCH       LRSED--------PLSVLKKLMS----VREPIYRSIADLIISTDS-KRPKGVVRDIVKTL
AROK_ACIBY       LQVEN--------PEQKLRDLLK----IRDPLYREVAHYTIETNQ-GAARDLAQKILQLI
AROK_ACIBS       LQVEN--------PEQKLRDLLK----IRDPLYREVAHYTIETNQ-GAARDLAQKILQLI
AROK_ACIAD       LQVEN--------PEQRLRDLLK----LRDPLYRDVAHHIIETNQ-GAARELAQQILRVI
AROK_PSYA2       LQQPN--------PRKILQGLYS----ARDPLYRQVAHIIMPTGH-TYPRHMVNQLLQQL
AROK_PSYCK       LQQPN--------PRKILQGLYS----ARDPLYREVAHIIMPTGH-TYPRHMVNQLLQQL
AROK_PSYWF       LNTPN--------PRAVLQSLFD----VRDPLYREVADIVVETGD-GYPRYMLKKIIEAL
AROK_COXBU       FIKNN--------SKEKLQQLNE----IRKPLYQAMADLVYPTDD-LNPRQLATQILVDI
AROK_COXB2       FIKNN--------SKEKLQQLNE----IRKPLYQAMADLVYPTDD-LNPRQLATQILVDI
AROK_COXBR       FIKNN--------SKEKLQQLNE----IRKPLYQAMADLVYPTDD-LNPRQLATQILVDI
AROK_COXBN       FIKNN--------SKEKLQQLNE----IRKPLYQAMADLVYPTDD-LNPRQLATQILVDI
AROK_COXB1       FIKNN--------SKEKLQQLNE----IRKPLYQAMADLVYPTDD-LNPRQLATQILVDI
AROK_AROAE       LQVSN--------PRERIESLYR----ERDPLYREVADIIVDGGR-GNPGGMVRQVEKAI
AROK_DECAR       LRVED--------PLAKLEELHS----IRDPLYREVAHIVVDGSH-LVASGIVQYLLREF
AROK_NEIMA       LQVAD--------PLAKLRELYA----ARDPVYRQTADFTVESA---NCRETVQTLLKRL
AROK_NEIMB       LQVAD--------PLAKLRELYA----ARDPVYRQTADFTVESA---NCRETVQTLLKRL
AROK_NEIM0       LQVAD--------PLAKLRELYA----ARDPVYRQTADFTVESA---NCRETVQTLLKRL
AROK_NEIG1       LQVAD--------PLAKLRELYA----ARDPVYRQTADFTVESA---NCRETVQTLLKRL
AROK_THIDA       LQTGN--------PLAKLRELYQ----QRDPIYRELADVTVDTAR-QSVAGMTRVLYGKL
AROK_NITEU       LQTGN--------VHAKLIELFT----QRDPLYRETAHIIMDSGR-QSARAFVQKLIQKL
AROK_NITMU       LQTSD--------PRARLAELFV----QRDPLYRETAHIVVESGK-RSPRHLAQSLAQQL
AROK_BURMA       LQTDD--------PKAKLEALYE----ARDPLYRECAHFVIETGR-PSVNGLVNMVLMQL
AROK_BURPS       LQTDD--------PKAKLEALYE----ARDPLYRECAHFVIETGR-PSVNGLVNMVLMQL
AROK_BURP1       LQTDD--------PKAKLEALYE----ARDPLYRECAHFVIETGR-PSVNGLVNMVLMQL
AROK_BURTA       LQTDD--------PKAKLEALYE----ARDPLYRECAHFVIETGR-PSVNGLVNMVLMQL
AROK_BURL3       LQTED--------PKGRLEALYE----VRDPLYRECADFVIETGR-PSVNGLVNMVLMQL
AROK_RALSO       LQTEN--------PRARLEELHA----IRDPLYREVAHFVIETGK-PTVAQLVNMVLMQL
AROK_CUPPJ       LQTED--------PKGKLEALYG----ARDPLYREVADFIIETGK-PSVAQLANMVLMQL
AROK_BORPA       LATAD--------PRATLRELMV----AREPLYNEVADLVIDTGS-MPIATLVKSLLPKL
AROK_BORPE       LATAD--------PRATLRELMV----AREPLYNEVADLVIDTGS-MPIATLVKSLLPKL
AROK_BORBR       LATAD--------PRATLRELMV----AREPLYNEVADLVIDTGS-MPIATLVKSLLPKL
AROK_BORA1       LATAD--------PRGTLNDLMI----KREPLYKEVADLVIETGA-MPITTLIKAILPKL
AROK_CHRVO       LQIAD--------PRAKLESLFN----ERDPFYREIADIIIDTTQ-QNVNLLVGRLVDQL
AROK_NITOC       LRTGN--------PLERLKCLLK----ERDPLYREVADVIIKTGK-QPVKAVANEVLRQL
AROK_HYDCU       LQTEN--------PEQVLRKLIE----ERGPLYEEVADLVIQTEQ-VSVHRVVKQILDKL
AROK_ACIAC       LQVGS--------PLDRLRELQR----ERDPLYREAAHFVISPERGKNVAALVQHIAMQL
AROK_STRMK       LQRPD--------REQVLHDLAA----HRDPLYRELADITLDTDPYTAADATAHLVVKLA
AROK_STRM5       LQRPD--------REQVLHDLAA----HRDPLYRELADLILDTDPYTAADATAQLVVKLA
AROK_XANAC       LQRAD--------REQVLHAMAA----HRTPLYHQVADLSLETDHLSPAEATAQLVLRLA
AROK_XANC5       LQRAD--------REQVLHAMAA----HRTPLYRQVADLSLETDHLSPAEATAQLVLRLA
AROK_XANOR       LQRAD--------REQLLHAMAA----HRTPLYHEVADLSLETDHFSPAEATAQLVLRLA
AROK_XANOM       LQRAD--------REQLLHAMAA----HRTPLYHEVADLSLETDHFSPAEATAQLVLRLA
AROK_XANOP       LQRAD--------REQLLHAMAA----HRTPLYHEVADLSLETDHFSPAEATAQLVLRLA
AROK_XANCP       LQRPD--------REQVLHGMAA----LRTPLYQEVADLTLETDHLSPAEATAQLVLRLA
AROK_XANC8       LQRPD--------REQVLHGMAA----LRTPLYQEVADLTLETDHLSPAEATAQLVLRLA
AROK_XYLF2       LQQID--------RKQVLSDLYA----TRQPLYQKIADMIVTTDHMSPNTATAQLILDLT
AROK_XYLFT       LQQID--------RKQVLSDLYA----TRQPLYQKIADMIVTTDHMSPNTATAQLILDLT
AROK_XYLFM       LQQTD--------RKQVLSDLYA----TRQPLYQKIADMIVTTDHMSPNTATAQLILDLT
AROK_XYLFA       LQQID--------RKQVLSDLYA----TRQPLYQQIADMIVTTDHMSPNTATAQLILDLT
AROK_BARHE       LQTEN--------PKETMQKLMK----QRYPIYAKANLTINSHKENR-QTVAQNVIRSVQ
AROK_BARQU       LQTAN--------PKETMKKLME----QRYPIYAKANLTINSYKESR-HTVAQNVIRSVQ
AROK_BRUAB       LRNSD--------PRGVMQRLMD----ERYPVYALAELHLMTRDEKK-EVIAAELIEVLA
AROK_BRUA2       LRNSD--------PRGVMQRLMD----ERYPVYALAELHLMTRDEKK-EVIAAELIEVLA
AROK_BRUSU       LRNSD--------PRGVMQRLMD----ERYPVYALAELHLMTRDEKK-EVIAAELIEVLA
AROK_RHILO       LKSAD--------PRAVLERLMS----ERYPVYATSDVTVPTRDDRK-EVIAAEVLNALC
AROK_RHIME       LKTEN--------PKQTLENLMR----ARYPIYAEADLTVLSRDVKK-EAMVEEVLAAVA
AROK_BRADU       LQTAD--------PEGTVTRLLT----EREPVYSHADLTIASRDVPH-DKIVEECIETLR
AROK_RHOPA       LKTPD--------PAGTIARLIA----ERYPLYREADITIASRDVPH-EKIVDECVAALH
AROK_NITWN       LQTAD--------PAATIKRLIA----EREPIYRQADITVASRDVPY-EWIVDECIGLLH
AROK_CAUVC       VRGKD--------PVKVLTELAE----ARYPAYAEAQVHVETGDTPH-MVAVEAILTALR
AROK_ZYMMO       LIGHD--------VRTRLQELAD----IRDSFYAMAPLHVWTGAQPH-EEIVDAIIMALP
AROK_NOVAD       LKTGN--------PREILTRLKD----EREPFYAQAPIHMTSGAQPH-QVTASKILRAID
AROK_MAGSA       LKQGD--------PREILGRLME----ARYPIYAEADIIVESTDEVP-EATVIRVMEGLI
AROK_RHORT       LNNGD--------AREKLAELMA----KRHPVYAEADIVFDALDESQ-DASALRVRSCLL
AROK_RHOS4       LRTPN--------PRETLRALLE----ARDPVYAQADLAVES-GEGTVEQMAVRVREALA
AROK_RUEPO       LRTAD--------PRATLRALYE----ARVPLYSEADLCVISDGETSIEQMVDRVIAALA
AROK_NOSS1       LQDDD--------PKGKLRSLLE----QRTPLYSQADLRICVNAEETPEQIANKVMQAIP
AROK_TRIV2       LQDDD--------PKGKLRSLLE----QRTPLYSQADLRICVNAEETPEQIANKIMQVIP
AROK_NOSP7       LQDAD--------LKGKLRSLLE----QRTPLYSQADLHITVQEGETPEDIANRIIEVIP
AROK_RIPO1       LKESD--------LTLKLKTLDE----QRRNLYNKADLTIVINQNRTPESIVSEILEAIP
AROK_MICAN       LQSTD--------LDSKLELLLE----QRRGLYAEADLRIVVSDLDTPTDIVEKILTAIP
AROK_SYNY3       LQVEN--------LEERLGNLLA----QRQPLYAQADLRFPLQADQDPLAIAGELLATIP
AROK_SYNE7       LQTEA--------PATTLQALWE----QRRDRYAQADLRIAIEASEDPEVTMQRILEVIP
AROK_SYNP6       LQTEA--------PATTLQALWE----QRRDRYAQADLRIAIEASEDPEVTMQRILEVIP
AROK_THEEB       LQEQP--------LEERLGELLQ----ARQHLYAQADLELRITLEDTPETVCDRLLETLP
AROK_SYNJB       LQTPD--------PQAALYKLMQ----EREPFYAQADVRVPIRSETSPPQLVEQIWQAIR
AROK_SYNJA       LQTPD--------PQAALQRLMQ----EREPFYAQADVRVPIHSEASPSQLAEQVWQAIC
AROK_GLOVI       LAGGD--------RHLRLVELLG----ERARLYAQADVRVS--AAGLPPAVAEETLRCLA
AROK_PROMA       LDNKD--------PKDVLDSLIK----QRYLSYAEADLHISIERET-PEEVALVIFKKLS
AROK_PROMT       LLGDN--------LAENFSQIYE----SRKPIYLESDLRIEVEDQS-PYEVATMVAEHLQ
AROK_SYNSC       LQTTD--------PEASLNALLN----ERRPLYSEADLTVVINDET-PEAVADGILQLLP
AROK_SYNPX       LQTED--------PDAALNALLN----QRRPLYAEADLTVVINQET-PLAVADGILQLLP
AROK_SYNS9       LQQPN--------PEAALDTLLQ----ERRPLYGEADLTVVIKDES-PDAVADGILQLLP
AROK_PROMM       LQTED--------PEAAFDCLFA----ERLPLYCEADLHVEVGAEE-PDGIALKIIEFLP
AROK_LACF3       LASKL--------TPAELADLQD----ARRPAYDRCADLTIRTDKLSPTAVAKLIIAFLR
AROK_CHLP8       LKGPNGEKLSREQVEQRISEILE----KREPRYQ-KADLIIVTDSKKIGSTVEEMTRKIE
AROK_CHLTE       LKGPDGRKLTREEIQQRIAELLK----KREPRYL-KADLVLFTDSKKIGASVEELTRKIE
AROK_CHLL2       LKGEHGTRLSREEIELKISTILE----KREPRYA-TADLSVQTDIKRIGSTVEELTRTII
AROK_CHLPD       LKSEQGGKLSNGEIEQKIRELLA----RREPRYN-SATITVQTDTGRIGSTVEELTRKIN
AROK_CHLPB       MKGENGERLSSEEIEKKILALLE----HREPRYK-TAQIMVETDTKRIGTTVEELTRKIE
AROK_PROA2       MKGEDGQRLSRDAIEQKILNMLE----QREPRYK-TAQITVETDTKRIGTTVEELTRKIE
AROK_CHLCH       LKGEQGEKLSQEEIEQKIAELLA----RREPRYE-CADITVETDAKRIGSTVEELTRKIE
AROK_PELLD       LRGENGRKHSREELEEKIRRILE----EREPRYQ-QAALTVQTDQKRIGSTVEELTRKIE
AROK_CHLPM       LRSSGTEKPDREALERNISAILE----KRSPRYE-SAAITVYTDQKRIGSTVEELTRKIE
AROK_CHLT3       MKGENGEKLSIEDISDRVEKLLA----KREPRYS-AAEILALTDKTPLGVTIENLTRQIE
AROK_SALRD       LEDDTGTRLPRDEQRTRIEAMLD----ERRPAYE-AAHHTLDADR-----PVEEVVGRIV
AROK_AQUAE       LKRPLDE----------IKNLFE----ERRKIYS-KADIKVKGEK-----PPEEVVKEIL
AROK_THET2       LQ--------VENPLERIRTLLE----ARAPIYR-KAHIHVSTDGRRVEEVVEEIVEKLW
AROK_THET8       LQ--------VENPLERIRTLLE----ARAPVYR-KAHIHVSTDGRRVEEVVEEIVEKLW
AROK_DEIRA       LK--------VEDPLSRIRTLMN----EREGVYR-QGTIHVHSDGRPSEEIVEEVVERLW
AROK_THEP3       LMVDN--------PEEKIRQLLK----EREPFYR-FADYTIDVSDMTIDEVAEEVIKAYI
AROK_THEPX       LMVDN--------PEEKIRQLLK----EREPFYR-FADYTIDVSDMTIDEVAEEVIKAYI
AROK_CALS4       LAVED--------PEKRIRELLE----EREPFYR-FADYTIDVSDKTIEEVAEEVIRAYI
AROK_THEYD       LQVEN--------PEERIKELLQ----KRMPLYE-KADFCIDTEGLTPEEVAEKIIKEYE
AROK_CALS8       LKNGD--------KLSNIIRLMN----IRMPFYK-NCDFEINTDILSPELAAEKIISIHM
AROK_DESAP       LLRGN--------VRARIRELLE----ERAGAYD-VAEFTVDTGMHSLPKTVGLIMEFLK
AROK_PELTS       LMRGD--------LRENIKALLK----EREGVYD-VAEHKVDTGSMSLDQAVENIIHFLK
AROK_GEOMG       LKDDR--------SGERIAAMMA----EREQFYA-DAELRIDTTGKSVEDVVAEITGYLE
AROK_GEOSL       LKSNN--------TPEALAALMT----ARENAYA-DADLRIDTAGKSVEDVVTEIATFVR
AROK_MOOTA       LQGRE--------PRD-IAALLR----RREPYYA-FADIYIDTDGKEAAAVAREIKEALK
AROK_SYMTH       LSGPD--------PLGRLRALAA----ARRPFYAQAAHVRICTDRRSLQDVVAEIMEKLQ
AROK_DESAG       LTGGN--------PAAEIAAVLA----ERDTLYRETAHHVVDACQPAAAVAGQMLRLLAA
AROK_DESVH       LTGKA--------VADEVADVMR----ERAPLYAEAARHVVRGDAPVACIVEDITALLAF
AROK1_PELCD      LTGRS--------IVEEINEVMA----ERETLYHETAHYILNGSVPVERVVKQALDMLGG
AROK2_PELCD      LTGRP--------IVEEVSEVLA----ARENLYRSAAHHVLDASVAPEAVLVQALELLKK
AROK_RHOBA       LTDQS--------VFDEVQSVMS----HREPLYRASADLRIDTSHRNMDEILTEVLKAAP
AROK_SYNAS       FSGKASTEISEETMRKETTEILK----QRMPIYRVLADQIIDTSQISTAEIVDEILRRFQ
AROK_DEHMB       FNAER---------SDKMLKLLE----SRLPLYRDAADITVSTHNKSCHEVCEEIEDSLR
AROK_DEHMC       FNAER---------SDKMLKLLE----SRLPLYRDAADITVSTHNKSCHEVCEEIEDSLR
AROK_DEHM1       YNAER---------LDKMLKLLE----SRLPLYRAAANITISTHNKSCHEVCEEIEDKLR
AROK_LEPBA       LSKIT-----------TYRSILE----KRLPVYQEAAHFKLNLTKLSKEEAAEKILDWIG
AROK_LEPBP       LSKIT-----------TYRSILE----KRLPVYQEAAHFKLNLTKLSKEEAAEKILDWIG
AROK_CHLMU       PESLK--------NTPSLENALFQRLEKLRLLTPHIFSLQAATSLHEIGEVCQSFCLQFL
AROK_CHLTR       PERLA--------HAPSLEDTLSQRLDKLRSLTSNAFSLRAETSSEAVMRDCQSFCLRFL
AROK_CHLPN       RLKEA-------MKTKPLSEILT----ERIDRMKEIADYIFPVDHVDHSSKSSLEQASQD
                                                                             

AROK_ALKOO       ---------------------------------------------
AROK_FUSNN       IIS------------------------------------------
AROK_BACFR       KLLNLHIAS------------------------------------
AROK_BACFN       KLLNLHIAS------------------------------------
AROK_BACTN       ELLEL----------------------------------------
AROK_BACV8       KKLNK----------------------------------------
AROK_PARD8       KIL------------------------------------------
AROK_AZOPC       PKI------------------------------------------
AROK_FLAJ1       ---------------------------------------------
AROK_METI4       TMEKTDPR-------------------------------------
AROK_BACLD       LGQS-----------------------------------------
AROK_BACP2       LGWDLYSK-------------------------------------
AROK_BACSU       IGWDLYQPM------------------------------------
AROK_GEOKA       WTWDVYEPNR-----------------------------------
AROK_GEOTN       WMWDVYEPNR-----------------------------------
AROK_OCEIH       LAWDIYEPTS-----------------------------------
AROK_BACHD       LGWEIYGS-------------------------------------
AROK_CLOB1       KGI------------------------------------------
AROK_CLOBH       KGI------------------------------------------
AROK_CLOBL       KGI------------------------------------------
AROK_CLOBK       KGI------------------------------------------
AROK_CLOBM       KGI------------------------------------------
AROK_HELPY       ---------------------------------------------
AROK_HELPJ       ---------------------------------------------
AROK_HELPG       ---------------------------------------------
AROK_HELP2       ---------------------------------------------
AROK_HELPH       ---------------------------------------------
AROK_HELAH       ---------------------------------------------
AROK_HELHP       KEVQE----------------------------------------
AROK_CLOBA       NN-------------------------------------------
AROK_CLOBB       NN-------------------------------------------
AROK_CLOB8       DNLEMN---------------------------------------
AROK_DICTD       DD-------------------------------------------
AROK_BACC7       E--------------------------------------------
AROK_BACC0       E--------------------------------------------
AROK_BACMK       E--------------------------------------------
AROK_BACC2       V--------------------------------------------
AROK_BACCN       S--------------------------------------------
AROK_STAAC       ASDQY----------------------------------------
AROK_STAA8       ASDQY----------------------------------------
AROK_STAAE       ASDQY----------------------------------------
AROK_STAAT       ASDQY----------------------------------------
AROK_STAAS       ASDQY----------------------------------------
AROK_STAAW       ASDQY----------------------------------------
AROK_STAA1       ASDQY----------------------------------------
AROK_STAAM       ASDQY----------------------------------------
AROK_STAAN       ASDQY----------------------------------------
AROK_STAA2       ASDQY----------------------------------------
AROK_STAA9       ASDQY----------------------------------------
AROK_STAAR       ASDQY----------------------------------------
AROK_STAES       SD-------------------------------------------
AROK_STAEQ       SD-------------------------------------------
AROK_STAS1       CE-------------------------------------------
AROK_STAHJ       CG-------------------------------------------
AROK_LACLM       IE-------------------------------------------
AROK_LACLS       IE-------------------------------------------
AROK_LACLA       IN-------------------------------------------
AROK_STRPB       ---------------------------------------------
AROK_STRPC       ---------------------------------------------
AROK_STRPD       ---------------------------------------------
AROK_STRPZ       ---------------------------------------------
AROK_STRPG       ---------------------------------------------
AROK_STRPF       ---------------------------------------------
AROK_STREM       ---------------------------------------------
AROK_STRTD       ---------------------------------------------
AROK_STRSY       ---------------------------------------------
AROK_STRS2       ---------------------------------------------
AROK_STRGC       ---------------------------------------------
AROK_ENTFA       E--------------------------------------------
AROK_SALAI       --------AA-----------------------------------
AROK_SALTO       --------PS-----------------------------------
AROK_ACIC1       --------TVREENR------------------------------
AROK_THEFY       --------PAAGD--------------------------------
AROK_STRAW       --------ELKEA--------------------------------
AROK_STRCO       --------ELKEA--------------------------------
AROK_FRACC       GPLLAGGSEPDEAADAAGGSEPDEAADAAGGSEPDEAADAAGGKR
AROK_SACEN       --------TADRAAGRE----------------------------
AROK_MYCA1       --------PATDACR--------AAT-------------------
AROK_MYCPA       --------PATDACR--------AAT-------------------
AROK_MYCBO       --------QVPSPSE--------AAT-------------------
AROK_MYCBP       --------QVPSPSE--------AAT-------------------
AROK_MYCTU       --------QVPSPSE--------AAT-------------------
AROK_MYCTA       --------QVPSPSE--------AAT-------------------
AROK_MYCMM       --------DDPTPNTSPSSTASGAAT-------------------
AROK_MYCUA       --------DDPTPNTSPSSTASGAAT-------------------
AROK_MYCLE       --------QAQLATPVSGGDRKSSEAERSGAPLRKSSEVVK----
AROK_RHOJR       --------AE-----------------------------------
AROK_COREF       --------EDD----------------------------------
AROK_CORGL       --------EID----------------------------------
AROK_CORDI       --------ETLR---------------------------------
AROK_CORJK       --------EEVRLERLTERDASHQIRPQ-----------------
AROK_ECO8A       ESN------------------------------------------
AROK_ECOHS       ESN------------------------------------------
AROK_ECO7I       ESN------------------------------------------
AROK_ECOL6       ESN------------------------------------------
AROK_ECO45       ESN------------------------------------------
AROK_ECOLU       ESN------------------------------------------
AROK_ECO57       ESN------------------------------------------
AROK_ECO24       ESN------------------------------------------
AROK_ECOLI       ESN------------------------------------------
AROK_ECODH       ESN------------------------------------------
AROK_ECOLC       ESN------------------------------------------
AROK_SHISS       ESN------------------------------------------
AROK_SHIFL       ESN------------------------------------------
AROK_SHIDS       ESN------------------------------------------
AROK_SHIBS       ESN------------------------------------------
AROK_SHIB3       ESN------------------------------------------
AROK_ENT38       ESN------------------------------------------
AROK_SALA4       ESN------------------------------------------
AROK_SALCH       ESN------------------------------------------
AROK_SALDC       ESN------------------------------------------
AROK_SALEP       ESN------------------------------------------
AROK_SALG2       ESN------------------------------------------
AROK_SALHS       ESN------------------------------------------
AROK_SALNS       ESN------------------------------------------
AROK_SALPA       ESN------------------------------------------
AROK_SALPK       ESN------------------------------------------
AROK_SALSV       ESN------------------------------------------
AROK_SALTI       ESN------------------------------------------
AROK_SALTY       ESN------------------------------------------
AROK_CITK8       ESN------------------------------------------
AROK_ESCF3       ESN------------------------------------------
AROK_SERP5       ESN------------------------------------------
AROK_YERE8       ESN------------------------------------------
AROK_YERPE       ESN------------------------------------------
AROK_YERPP       ESN------------------------------------------
AROK_YERPG       ESN------------------------------------------
AROK_YERPA       ESN------------------------------------------
AROK_YERPN       ESN------------------------------------------
AROK_YERPS       ESN------------------------------------------
AROK_YERPB       ESN------------------------------------------
AROK_YERP3       ESN------------------------------------------
AROK_YERPY       ESN------------------------------------------
AROK_PECAS       ESN------------------------------------------
AROK_ERWT9       EKS------------------------------------------
AROK_SODGM       ESS------------------------------------------
AROK_PHOLL       EKN------------------------------------------
AROK_BAUCH       ERN------------------------------------------
AROK_AERHH       GM-------------------------------------------
AROK_AERS4       GM-------------------------------------------
AROK_ALTMD       GL-------------------------------------------
AROK_PSEA6       NQ-------------------------------------------
AROK_SHEB5       GF-------------------------------------------
AROK_SHEB8       GF-------------------------------------------
AROK_SHEB9       GF-------------------------------------------
AROK_SHESA       GF-------------------------------------------
AROK_SHESM       GF-------------------------------------------
AROK_SHESR       GF-------------------------------------------
AROK_SHEPC       GF-------------------------------------------
AROK_SHESW       GF-------------------------------------------
AROK_SHEON       GF-------------------------------------------
AROK_SHEDO       GF-------------------------------------------
AROK_SHEFN       GF-------------------------------------------
AROK_SHEAM       GF-------------------------------------------
AROK_SHEHH       GF-------------------------------------------
AROK_SHEPA       GF-------------------------------------------
AROK_SHESH       GF-------------------------------------------
AROK_SHEWM       GF-------------------------------------------
AROK_SHELP       GF-------------------------------------------
AROK_COLP3       DF-------------------------------------------
AROK_PSET1       DF-------------------------------------------
AROK_IDILO       ESINGLG--------------------------------------
AROK_ALIF1       EER------------------------------------------
AROK_ALIFM       EER------------------------------------------
AROK_ALISL       EER------------------------------------------
AROK_PHOPR       EER------------------------------------------
AROK_VIBCH       EEHIM----------------------------------------
AROK_VIBC3       EEHIM----------------------------------------
AROK_VIBCB       EER------------------------------------------
AROK_VIBPA       EER------------------------------------------
AROK_VIBVU       EES------------------------------------------
AROK_VIBVY       EES------------------------------------------
AROK_BUCAI       EEI------------------------------------------
AROK_BUCAP       EKM------------------------------------------
AROK_WIGBR       FKT------------------------------------------
AROK_BLOFL       KKNGAIYKD------------------------------------
AROK_BLOPB       KKSSL----------------------------------------
AROK_ACTPJ       DNLQ-----------------------------------------
AROK_ACTP2       DNLQ-----------------------------------------
AROK_HAEDU       DNLQ-----------------------------------------
AROK_ACTSZ       DNFHG----------------------------------------
AROK_MANSM       DNFNS----------------------------------------
AROK_HAEIN       DNMNGLNGAL-----------------------------------
AROK_HAEIG       DNMNGLNGAL-----------------------------------
AROK_HAEIE       DNMNGLNGTL-----------------------------------
AROK_HAEI8       DNMNGLNGAL-----------------------------------
AROK_PASMU       DNLHG----------------------------------------
AROK_HISS2       DNLKI----------------------------------------
AROK_BUCBP       NNF------------------------------------------
AROK_PSYIN       DF-------------------------------------------
AROK_FRATF       VEETIL---------------------------------------
AROK_FRATH       VEETIL---------------------------------------
AROK_FRATO       VEETIL---------------------------------------
AROK_FRATM       VEETIL---------------------------------------
AROK_FRATN       VEETIL---------------------------------------
AROK_FRATT       VEETIL---------------------------------------
AROK_FRAT1       VEETIL---------------------------------------
AROK_FRATW       VEETIL---------------------------------------
AROK_FRAP2       VEETIL---------------------------------------
AROK_LEGPC       YGEV-----------------------------------------
AROK_LEGPL       YGEV-----------------------------------------
AROK_LEGPA       YGEV-----------------------------------------
AROK_LEGPH       YGEV-----------------------------------------
AROK_METCA       EKSGTRLRTE-----------------------------------
AROK_PSEAE       RKLPPR---------------------------------------
AROK_PSEA8       RKLPPR---------------------------------------
AROK_PSEAB       RKLPPR---------------------------------------
AROK_PSEA7       RKLPPR---------------------------------------
AROK_PSEP1       QQLPPR---------------------------------------
AROK_PSEPK       QQLPPR---------------------------------------
AROK_PSEE4       QQLPPR---------------------------------------
AROK_PSEF5       QQLPPR---------------------------------------
AROK_PSEPF       AQLPPR---------------------------------------
AROK_PSE14       AELPPR---------------------------------------
AROK_PSESM       AELPPR---------------------------------------
AROK_PSEU2       AELPPR---------------------------------------
AROK_HAHCH       RASREETVER-----------------------------------
AROK_ACIBY       LSNKLK---------------------------------------
AROK_ACIBS       LSNKLK---------------------------------------
AROK_ACIAD       LSSGSH---------------------------------------
AROK_PSYA2       NSFCASTSVVSEPEKD-----------------------------
AROK_PSYCK       NSFCISTSVDSEPEKD-----------------------------
AROK_PSYWF       KQHYPEHMKS-----------------------------------
AROK_COXBU       KQTYSDL--------------------------------------
AROK_COXB2       KQTYSDL--------------------------------------
AROK_COXBR       KQTYSDL--------------------------------------
AROK_COXBN       KQTYSDL--------------------------------------
AROK_COXB1       KQTYQTYENRTR---------------------------------
AROK_AROAE       QNFHKKTCEH-----------------------------------
AROK_DECAR       NRL------------------------------------------
AROK_NEIMA       SR-------------------------------------------
AROK_NEIMB       SR-------------------------------------------
AROK_NEIM0       SR-------------------------------------------
AROK_NEIG1       SR-------------------------------------------
AROK_THIDA       DLLKGEATSFDPAG-------------------------------
AROK_NITEU       RQSNQEFTAAGSPPCVKPSE-------------------------
AROK_NITMU       TISSR----TG----------------------------------
AROK_BURMA       EMAGIVAKPLQA---------------------------------
AROK_BURPS       EMAGIVAKPLQA---------------------------------
AROK_BURP1       EMAGIVAKPLQA---------------------------------
AROK_BURTA       EMAGIVAKPLQA---------------------------------
AROK_BURL3       ELAGVIAKPLQA---------------------------------
AROK_RALSO       EVAGIVVPPAASSPTSQVSRQS-----------------------
AROK_CUPPJ       EMAGFRIDTAAASDQPANDTHS-----------------------
AROK_BORPA       QAYEKK---------------------------------------
AROK_BORPE       QAYEKK---------------------------------------
AROK_BORBR       QAYEKK---------------------------------------
AROK_BORA1       QAYEKKL--------------------------------------
AROK_CHRVO       LDSPHHPKETD----------------------------------
AROK_NITOC       RQYKGGAPQRKSFVHVKSNKGA-----------------------
AROK_HYDCU       AEQKII---------------------------------------
AROK_ACIAC       ELAGIRPPSP-----------------------------------
AROK_STRMK       TQWQRQDLTP-----------------------------------
AROK_STRM5       TQWQRQDLTA-----------------------------------
AROK_XANAC       AQWRMSSNPA-----------------------------------
AROK_XANC5       AQWRMSSTPA-----------------------------------
AROK_XANOR       AQWRMSSAPA-----------------------------------
AROK_XANOM       AQWRMSSAPA-----------------------------------
AROK_XANOP       AQWRMSSAPA-----------------------------------
AROK_XANCP       AQWRMSSTPA-----------------------------------
AROK_XANC8       AQWRMSSTPA-----------------------------------
AROK_XYLF2       AHWQKSSNTA-----------------------------------
AROK_XYLFT       AHWQKSSNTA-----------------------------------
AROK_XYLFM       AHWQKSSNTA-----------------------------------
AROK_XYLFA       AHWQKSSNAA-----------------------------------
AROK_BARHE       HYLDTEKNDRNNQHANQNCHC------------------------
AROK_BARQU       NYIYTEINDRNNQHANQDRHC------------------------
AROK_BRUAB       AHLEKEQAASAG---------------------------------
AROK_BRUA2       AHLEKEQAASAG---------------------------------
AROK_BRUSU       AHLEKEQAASAG---------------------------------
AROK_RHILO       RHFGIDEIAATGEIES-----------------------------
AROK_RHIME       DHQKA----------------------------------------
AROK_BRADU       AHLCGEQAAQPPADVASAVR-------------------------
AROK_RHOPA       DYLCAAPP-QP----------------------------------
AROK_NITWN       RRLCRGEMTRNAMKDPDEGFDTTQ---------------------
AROK_CAUVC       QAHA-----------------------------------------
AROK_ZYMMO       R--------------------------------------------
AROK_NOVAD       QWL------------------------------------------
AROK_MAGSA       TYL-DLEKTV-----------------------------------
AROK_RHORT       SYLADHAETAP----------------------------------
AROK_RHOS4       TRPDVLETDE-----------------------------------
AROK_RUEPO       TRKDVLELS------------------------------------
AROK_NOSS1       SVLKQTASN------------------------------------
AROK_TRIV2       SVLKQTTAN------------------------------------
AROK_NOSP7       NVLKPQASH------------------------------------
AROK_RIPO1       TVIKPKVEANQFN--------------------------------
AROK_MICAN       TVIKDFHPERDHN--------------------------------
AROK_SYNY3       GLLKPQCSAEQN---------------------------------
AROK_SYNE7       SVLKNSADSSPAEIET-----------------------------
AROK_SYNP6       SVLKNSADSSPAEIET-----------------------------
AROK_THEEB       CILKPMEPC------------------------------------
AROK_SYNJB       ARLRDGIPS------------------------------------
AROK_SYNJA       ARLRAQPPCNR----------------------------------
AROK_GLOVI       ARLAEDSAP------------------------------------
AROK_PROMA       EIIRVQED-------------------------------------
AROK_PROMT       SILIDQEPQAERHTTEL----------------------------
AROK_SYNSC       SLLQDPTQRRTD---------------------------------
AROK_SYNPX       SLLKDPTQRRTD---------------------------------
AROK_SYNS9       TLIKDPTEQRER---------------------------------
AROK_PROMM       QLLSPPPQMNG----------------------------------
AROK_LACF3       IHQDQSA--------------------------------------
AROK_CHLP8       RHIRRVER-------DS----------------------------
AROK_CHLTE       RHIRRASK-------NNTNEK------------------------
AROK_CHLL2       RFVRQAEQARLKQQSDNNREKQ-----------------------
AROK_CHLPD       RYVRKTTG--------NSRAK------------------------
AROK_CHLPB       RYVRRAEKNQNSHSQTKKQSRK-----------------------
AROK_PROA2       RYIRRCEKKQ--LERNTKQRKQ-----------------------
AROK_CHLCH       RYMRTLAL--------SSEE-------------------------
AROK_PELLD       RLVRKAPQIG---EDGQQPEQP-----------------------
AROK_CHLPM       RFVRKQSSIE---QNDQHKDRP-----------------------
AROK_CHLT3       RHIRANCKTN-----------------------------------
AROK_SALRD       EVVTAQAEPA-----------------------------------
AROK_AQUAE       LSLEGNALGG-----------------------------------
AROK_THET2       RHAEARGA-------------------------------------
AROK_THET8       RHAEARGA-------------------------------------
AROK_DEIRA       AWRDAQAAWAALPPDYDRATS------------------------
AROK_THEP3       RLKKG----------------------------------------
AROK_THEPX       RLKKG----------------------------------------
AROK_CALS4       KLKGR----------------------------------------
AROK_THEYD       RLSNGKT--------------------------------------
AROK_CALS8       AKESKR---------------------------------------
AROK_DESAP       ERGYLEAGSDSESGGVPELPDISR---------------------
AROK_PELTS       EHNYIE---------------------------------------
AROK_GEOMG       GR-------------------------------------------
AROK_GEOSL       EHQ------------------------------------------
AROK_MOOTA       AWLESLT--------------------------------------
AROK_SYMTH       ERGERG---------------------------------------
AROK_DESAG       AG-------------------------------------------
AROK_DESVH       S--------------------------------------------
AROK1_PELCD      ---------------------------------------------
AROK2_PELCD      QA-------------------------------------------
AROK_RHOBA       SSIGQADLS------------------------------------
AROK_SYNAS       SQRFNV---------------------------------------
AROK_DEHMB       KYENTSG--------------------------------------
AROK_DEHMC       KYENTSG--------------------------------------
AROK_DEHM1       EYENTSG--------------------------------------
AROK_LEPBA       IKSKSI---------------------------------------
AROK_LEPBP       IKSKSI---------------------------------------
AROK_CHLMU       TAQEIPYA-------------------------------------
AROK_CHLTR       STKESSYA-------------------------------------
AROK_CHLPN       LITLLKS--------------------------------------