CLUSTAL format seed alignment for MF_00110

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

AROB_BACSU            ----------------MKTLHVQTA--------SSSYPVFIGQGIRKKACELLTSLNRPL
AROB_BACP2            ----------------MKTLEVKTS--------SATYPVYIGDGIKRNIVDLMTSTGHSY
AROB_OCEIH            ----------------MEEMTVQSN--------QSSYPIYIGQGLR---YQLSSYIEKKY
AROB_BACAN            ----------------MGNIHIQTK--------SKEYDVYVGKESLSHLTTIVQNMQPSV
AROB_BACCR            ----------------MGNIHIQTK--------SKEYDVHVGKEVLSNLTTIVQNMQPAV
AROB_LISMO            ----------------MPEITVRAK--------SKTYPVYINEFALEDIREKWTKSLAKF
AROB_STAEQ            -----------------MELKTSYA--------SDNYPIIVKHHAINSLERYIKNEEQ--
AROB_STAS1            -----------------MKLETTYK--------SNNYPIIVEHQAIDHLHQFIKDYED--
AROB_STACT            -----------------MELMTTYK--------SNNYPIIIKNNAITELTELLKPYRD--
AROB_MACCJ            -----------------MKLTTNYN--------DNNYDIFVEYNVLNKDYDFNY-YDK--
AROB_EXIS2            -----------------MTHLTIRA--------SRPYSVYVEPDAIRRIHEVKQAQEAD-
AROB_EXISA            -----------------MVTIPISA--------STPYDVVLDNQD-RWIDSVDWSRYS--
AROB_PELPD            ----------------MSVLTVNLG--------ENSYDILIDGGTLPSLGRHCLERGLSG
AROB_GEOSL            --------------MTIETLRVELG--------ERSYDIRVGSAIIGTIGAVCRDAVAGR
AROB_PELTS            ----------------METVNVNLG--------KRSYPIYAGPGILQDLGELLGGLPVGR
AROB_THEP3            ----------------MDFITIDLK--------ERSYPIYFAYDSFDKLGEIVKKHVRSS
AROB_HUNT2            ----------------MIKLNVNLQ--------DRSYPIYISTD-YSQIGKCIQSAKLTG
AROB_PELUB            --------------MGLIKLKVNTN--------SQQYSIIIGNNILKKVNKFLKENSIDF
A0A1V6INJ9_9EURY      -----------MNIKETKTISVKTE--------KRPYDIVIGRDIFRNALESILEENKEC
F8C417_THEGP          ----------------MKILKVKT---------KPSYEIIIKENVFEDIPNDLKKNFNFG
F8AD96_THEID          ----------------MKILEVKT---------GRPYEILIEGGLLTEVPEDLKRLNLGY
AROB_LEPIN            -------------MSLIETVPVNTE--------HKSVPVHLHSN-LSGLSEEIAKLPGVT
AROB_UNCTG            ----------------MKQIIVNLK--------TKKYDIVISQS-ENDFFTALAKAAKTN
AROB_STRGC            -----------------MKLNVNLP--------HHPYDIVIENGALSQVGSWLSQLWQPQ
AROB_STRT2            -----------------MKLEVNLK--------QNPYDIIIEKGALKGVGQWVKSLWEPQ
AROB_CLOK5            ----------------MKAIDINVK--------EKSYKISIKKGILSSIGERLKTTYQSR
AROB_LEUCK            ----------------MTVITVSLE--------KKQYQVKIDRRLHQEIGQAVSLVWTPR
AROB_LEUMM            ----------------MSTITVDLA--------TKKYDVKIDNTLHTRLGQEISAVWSAR
AROB_DEHM1            ----------------MKSIGLNLS--------GREYKILIGSDLLAETADLLKQAIPCD
AROB_ALKOO            ----------------MLETKINLG--------KVTYPLYMGRNLLDNLDVLIEDHIEGK
AROB_NATTJ            ---------MKNKFDTLTVETGVKS--------KKKYPIYIGKAILNLLDKVIPRNVSVL
AROB_VIBPA            ----------------MERITVNLA--------ERSYPISIGAGLFE-DPAYLSQVLSNK
AROB_VIBVY            -----------MWSATMERITVNLA--------ERSYPITIGAGLFE-DSAHLSSLTAG-
AROB_ALIF1            ----------------METIHVDLA--------ERSYPISIGAELFC-NPAHFSSVIPAK
AROB_PSYIN            ----------------MEKIVVALG--------KRSYPISIGEGLLT-HAELFKSAIKG-
AROB_SHEWM            ----------------MKQIQVDLG--------VRSYPIVIGRNLMS-CGEHFARFLQD-
AROB_SHEDO            ----------------MQQIQVNLG--------DRSYPIHIGLDLLK-QQQTFQS-LQS-
AROB_SHIDS            ----------------MERIVVTLG--------ERSYPITIASGLFN-EPASFLPLKSG-
AROB_ECOLI            ----------------MERIVVTLG--------ERSYPITIASGLFN-EPASFLPLKSG-
AROB_SALTY            ----------------MERITVTLG--------ERSYPITIAAGLFN-EPASFLPLKSG-
AROB_KLEP7            ----------------MERLTVTLG--------ERSYPITIAAGLFN-DPASFLPLKSG-
AROB_ERWT9            ----------------MERITVTLG--------ERSYPITIAAGLFS-DPTSFWPLKAG-
AROB_PHOLL            ----------------MEKITVTLG--------ERSYPITIAKGLFD-DPSAFAPLKAG-
AROB_HAMD5            ----------------MKKMTITLG--------PRNYPITISSGLLN-HFDSFEPLKKG-
AROB_HAEIN            ----------------MLCVNVELQ--------ERRYPILIGSGLLQ-DERSY-PIKRG-
AROB_BLOFL            ---------------MIKRIIVNVK--------TGSYPIIIGYGLLNKDFMSYWTIKNG-
AROB_PSEPK            ----------------MQTLKVDLG--------ERSYPIYIGEGLLDQPELLAPHIAGR-
AROB_PSEU5            ----------------MQTLQVDLG--------ERSYPIHIGERLIDRSDLFASKIRGR-
AROB_METCA            ----------------MKTLHVELG--------ERGYPIYIGRGLLGHPDLIQAHLPGG-
AROB_AROAE            ----------------MRTLNVALG--------DRAYPIHIGPGVLDNAGLIRPFLRTA-
AROB_THIDA            ----------------MQTLTVDLG--------DRSYPIHIGAALLTRADLVLPHLAQK-
AROB_SACD2            ----------------MKTLHVDLG--------DRSYPIFIGAGLLANPEKFLPYLAAK-
AROB_TERTT            ----------------MRTLNLDLG--------ERSYPIFIGQSLLQNPALFTPHLSSQ-
AROB_HALHL            ----------------MRTQWVELG--------ERSYPIYIGDGVLDQ-GVLAEHLVAD-
AROB_CUPNH            ----------------MITLEVDLG--------ERSYPIHIGTGLLDNAELLRPHVRGQ-
AROB_CUPMC            ----------------MITLEVDLG--------TRSYPIHIGSGLLDRADLLAPHVRGQ-
AROB_RALPJ            ----------------MITVDVDLG--------DRAYPIHIGSGLLSKAELFAPHIRGA-
AROB_RALSO            ----------------MITVDVDLG--------ERAYPIHIGTGLLSQAELFAPHIRGT-
AROB_BURCJ            ----------------MITVNVDLG--------DRAYPIHIGAGLIGRTELFAPHIKGS-
AROB_BORPE            ----------------MDVVEVATP--------GGSYPIHIGPGRLDALDASIPAD-AT-
AROB_NITEU            -------------MNAIESIEVALDTLP----ENRSYSIHIGQGLLSRMDLLLPHLPGK-
AROB_IDILO            ----------------MAEVNVSLG--------ERSYTIYIGNALLPNYVERLPHKLNQ-
AROB_DICNV            ----------------MKRLTVHTAE------KAQQYPILIAPDLIKNASLWHLYCSAP-
AROB_RHIME            -------MTSHVMPTAERKVRVDLA--------ERSYDILIGPGLIAAAGKEIASRL-KG
AROB_RHIEC            -------MNAISSTSAVQTVHVPLG--------ERAYDILIGPGLIARAGTEIASRL-KG
AROB_BRADU            -------MTAPLKHSDPVNVDVALG--------DRAYDIVIGRGVLASLGERVAALR-PG
AROB_RHOPB            -------MTAPLNHSAPITVEVALG--------DRGYDIVIGRDVLRSLGTRIAALR-PG
AROB_RHOS4            --------------MTVDAVRVELG--------ARAYEVRIGPGLIARAGAEIAPLL-RR
AROB_JANSC            ---------------MSDTVRVELG--------ARAYDVEIGAGLIASAGARIAPLL-SR
AROB_PARDP            --------------MSIDTVHVDLG--------ARSYDVRIGQGLLARAGEEIVALA-GP
AROB_RHORT            MSPDTAADAAADPALQSSVLTVSLG--------ERSYPIHIGPGLLGRAGALIAPLL-RK
AROB_CAUVC            ---------------MIRTVPVGLG--------ERAYDVVIGPGLLDQAGERVAAVLGKR
AROB_CAUSK            ---------------MITTIPVGLG--------ARAYDVVIGTGLIDRAGEHIAPLL-KR
AROB_HYPNA            ----------MKTSSPLETVRVELG--------ARAYDILVGHGALSELGPRLSQML-KR
AROB_ZYMMO            ---------MSSEVSKTVTVPIDLG--------NHSYKIDIGAGLYQQAVSILTPYV-RN
AROB_XANOR            -------------MTLPRSSRSVAV--------DGAQPYTITIAPGLLADDARLARHVRG
AROB_OPITP            ---------------MPNTLTVDLG--------HRSYPIVFAADVRNNVRDQVAELTTAG
AROB_ACIC5            ----------------MRTIQVTTP--------GVQYPVYLGSGLLPQVASRLRKLTAPN
AROB_DICTD            ----------------MEELTIDLK--------DKKYPIYIGYNILRRL---IKEYWDKY
AROB_CHLCH            -------------------MSTIIV--------KTPVTVGLQELFREHKLSKKSVVLFDS
AROB_PELLD            -------------------MSTIIV--------SSPVTAGLASRFKAHGLKLKTVVLFDT
AROB_GLOC7            ----------------MYSR---IPVNL----PQNSYEIAIASGS---LSRLGAEMSTLN
AROB_RIPO1            ----------------MSII---IPVKL----PHTSYNIAIAPGS---LSQLGSHLEPLK
AROB_MICAN            ----------------MAIC---IPVNL----PDRSYNILIEKGS---LANLGGEMSQLS
AROB_NOSP7            ----------------MTSL---INVNL----PEQSYEIAIAPSN---LDQLGQQMANLK
AROB_SYNP2            ----------------MDAT---TRVEL----GENSYDIAIAKES---LQQIGTFLRPLD
AROB_THEEB            ----------------MTTL---IPVPL----GEHSYRIAIGANTRRQLPALLAAYTPLT
AROB_PROMA            ----------------MNQDNCRIKVNL----KNNPYEVVVGSEI---LYTIGEELLRIN
AROB_PROMP            ----------------MHKN--KILVPL----SNNSYEVIIKQGL---INNIGEELIRIG
AROB_HELHP            ----------------MSEILH---IQT----ATSNYPIHI------------GILPHIE
AROB_HELPY            ----------------MQEIL----IPL----KEKNYKVFL------------GELPEIK
AROB_CAMC5            ----------------MQIRLN---LEQ----KKYGYNVYI------------NELERIE
AROB_CAMHC            ----------------MQVNVD---LKE----N--SYKVFI------------DEFKELT
AROB_PARUW            --------------------------ML----NSSNYVIQSHCLD-----DLKYYLESLS
AROB_STRS7            ---------------MTQTLQVKSR--------INDYPIIFTDDIFQPLNQFLAEKGDVK
AROB_PYRFU            ----------------MEGIIFGDL--------STLPDLLSSLSPYKVVVLTNTTLKELW
AROB_PYRAB            ----------------MENIIFSPL--------SSLPSIVEELNPYKIAVLTNDMLKSLW
AROB_THEKO            ----------------MEGLSFGPL--------SILPSLAEELNPHRVAFLTNTTVERLW
AROB_SULTO            ----------------MRIVNENLC--------NNEISIVIGKGALSALEELKDKKVALF
AROB_SULAC            ---------------MIRFSESITS--------QQDIDVVVGENALSYLREIQNKK-AIF
AROB_SACS2            ----------------MREILEDIC--------CSEVRVVVGEGSLSKLSKIKDNNAAVI
E0SS73_IGNAA          ----------------MRCIEEDIC--------CNRTKIFIGRNIIEVLREYIDGKALIL
A8MCY5_CALMQ          ---------------MRSFTYRSRC--------SGEVRVLVNYPHADELSKLLDKYTSCM
AROB_PYRNV            ----------------MRRFFYRHS--------RGVTEVVVGSG--LQYGDYVERPVVLA
AROB_PYRIL            ----------------MRRFFYRHT--------RGVTEVVVGRG--LPYGEYIERPVVLA
AROB_PYRAE            ----------------MRRFFYTHS--------RGVTEVVVGRG--IPYDKYVERPVVLI
AROB_PYRCJ            ----------------MRRFYYRHS--------RGVTEVAVGKR--LDYATYAPSPLVLI
G4RLC8_THETK          ----------------MREFFYRHS--------RGITRVIVGRD--IDIGRLIGGRAVYL
A8A8F0_IGNH4          ------------MRSSSRLEVPITE--------EHTYKVIIGRNVFKEVESALPENVKPC
G0EHA3_PYRF1          -----------MTSVFAVRLVSPRY--------SPPYPVIIGKDLVKDLGDILAEYTRLN
AROB_STRAW            ------------MSEAVTRIHVGGTAG------TDPYEVLVGRQLLGELAGLIGDRV-KR
AROB_STRCO            ------------MSEAVTRIQVGGTAG------SEPYEVLVGRQLLGELGGLIGAKA-KR
AROB_THEFY            --------------MTVTRIGVGGTS--------TPYDVVVGNGILGELPALVGERA-QR
AROB_ARTS2            ------------MSSESTVIKVTGKSA------ADNYDVVVGRGLLGRLPELLGERV-KR
AROB_LEIXX            ------------MTDETTEILVAGAN---------PYPVVIGRGLRFDLARHLGSAV-SK
AROB_MYCTU            ----------MTDIGAPVTVQVAVDP---------PYPVVIGTGLLDELEDLLADR--HK
AROB_MYCLE            ----------MTNIDAPVTVQVAVDP---------PYPVVIGTGLSDQLDELLANR--HR
AROB_SACEN            -------------MTEPVRIRVESQA---------PYDVVVGRGLLGELVDMLRDA--SV
C6W902_ACTMD          -------------MGEPVRIRVAAER---------PYEVIVGRGLLGDLVELLRGT--SK
AROB_CORGL            ----------MSAVQIFNTVHVNGSS---------PYDVHIGSGLNELIVQRAAESGAEQ
AROB_COREF            ----------MHVTTIFDTVPVNGAS---------PYEVVIGSGLTPLIAERAAGSGATQ
AROB_CORP2            ----------------MQTIEVNGAS---------PYEVTIGHNLFKDVAKSMSQLGANQ
AROB_CUTAK            ----------------MNLVEVATTK---------PYRVRIGSGAVHELAGLVAGR---R
AROB_TROWT            ---------------MMKKYSLTTHS-------------TETCQILFTSVSNVFKYIPSG
AROB_TROW8            ---------------MMKKYSLTTHS-------------TETCQILFTSVSNVFKYIPSG
AROB_DEIGD            -----------MLPINRHRIEV---------GGPQPYAVEIGSGLLARVRVPERQV----
F0RLU4_DEIPM          -----------MGPTDLTALPELPPLHVPWPGQARSTTVEVGSGLLGQISVPETQV----
L0A5T3_DEIPD          ----------------MKRIDV---------QASVPYTITVGRGLLSAVDMPESRR----
P83703_THETH          ----------------MQRLEV---------REPVPYPILVGEGVLKEVPPLAGPA----
AROB_THEVO            --------------MDTQRFVITMN--------GDNISFIVGDNAINHLSEEAGKYDSIV
                                                                                  

AROB_BACSU            T-----------RIMFVTDEEVDRLYGDEMLHLLQEKWP---VKKVTVPSGEQAKSMDMY
AROB_BACP2            T-----------KLLIVTDTAVDAIYGDEMVRLLEQKWS---VHKVVVPSGEQSKSFAEF
AROB_OCEIH            T-----------KLFIITDDQVGSRYLKDVLHGYPSEEN---ICHFTIPSGESSKSIDNF
AROB_BACAN            S-----------NIMIISDEAVASLHLQTVVDALQIDQK---VFSFVVPSGEKEKSFENF
AROB_BACCR            S-----------NVMIISDEAVASLHLQTVIDALQVEQH---VFSFVVPSGEKEKSFENF
AROB_LISMO            S-----------HVFVLTDGHVAELHKAKLDAVLADLPV---VTYYVAPNGEEAKTFRVY
AROB_STAEQ            -------------RFFIIDKQVYNLFVDKLEALAQKFD----AKCIVIPSGETSKSFEHY
AROB_STAS1            -------------VVLVVDEHVNHDWHELLDFITSENN----AHKLIIPSGETTKTLSFY
AROB_STACT            -------------VVFIVDKNVEFALPEKIQQALSSTSSEQFTHILKVEGNETTKTFAVY
AROB_MACCJ            -------------RIALIDESVYRLHQQKIDLFLNKHS----IFKLLIPGGEQVKTMHHY
AROB_EXIS2            ------------RFWIITDQTVADLHMASIRRQLENVFPVTAQHVSTVEPGEGSKSLSVY
AROB_EXISA            ------------MLWVVTDKHVESLYGESFRSTLKLTHPHVVS--SVVEAGDASKSLSQL
AROB_PELPD            R-----------VAV-ISNPAVAELYAEQVRASLVESG--NQVTLILIPEGEEHKNAATL
AROB_GEOSL            R-----------VAV-VTNTTVGPLYADGVVDSLTAAG--FTVLRIDIPDGEEHKTSVTL
AROB_PELTS            K-----------VLL-ISNPTVFSLYGEKAAESLARAG--FTVAVAEIGDGEEHKTLATA
AROB_THEP3            K-----------TFI-ITDFNVYPLYFEKLNESLKKSR--FDVSYEVIPAGETSKTMEMA
AROB_HUNT2            K-----------MVL-ITDTNVDKYQAEECVKAFSDAG--YEVSKFVIPAGEENKNLDTT
AROB_PELUB            N-----------QCLLVIDKNIPKNLVKDTLKSLP-KG--S-VSIHYFNASEKNKNLKSV
A0A1V6INJ9_9EURY      N-----------VAI-ITDSNIEKIYRDNIYQALN-KK--TNVFVISFKAGEESKNRKTK
F8C417_THEGP          K-----------IAI-VTDHIVEDLYAKRLYENLKKNQ--IKAEIFSFPAGEASKNIDTV
F8AD96_THEID          R-----------YAL-ISDSQVADLLAEDLLRLLREAG--LSAELFVFPAGEASKNMDTI
AROB_LEPIN            S-----------VFL-ITEKSIHSIYSKYLERELS--S--LPIKTIYIKGGEKSKHINRT
AROB_UNCTG            M-----------FFV-ITDKNVEKLHLKYFTVLLKRKG--FNVKTAVISAGEIGKNIKSL
AROB_STRGC            K-----------LVV-ITDNRVARLYAEKVKLSLEAAG--FKVFTFDFLEGEASKNLTTV
AROB_STRT2            K-----------IAL-ITDNHVRGLYAEKVKLSLENEG--FEVVVFDFLEGEASKNLKTV
AROB_CLOK5            N-----------IVV-ITDTNVEKFYMETLKNSLLESG--FTMKIISIEPGEKSKNLATL
AROB_LEUCK            R-----------IAL-LTDSHVGPLYLTAVQQQLEMSG--FEVLPLQVPAGESSKSLKTV
AROB_LEUMM            K-----------ISL-LTDSNVGPLYLKDTAKQLREVG--FDILELEVPAGESSKSLSVA
AROB_DEHM1            R------------VVVITNIDINRLYGKKLKKHLESKG--IGSLFLELPEGEIHKSLDMA
AROB_ALKOO            T------------VFLLTEDNVFKYYGNPLLEKLKSSR--FKYHIIES--GETSKSIDTY
AROB_NATTJ            I------------VIDSRIARLHRDKITRLIEFLTESR--TVNQIIIP-GEEDSKSLSVS
AROB_VIBPA            NT--------NQKVVVISNVTVAPLYADKILHQLKQLG--CDASLLELPDGEQYKNLDVF
AROB_VIBVY            -----------QKVVVITNVTVAPLYADKILSLLQSLG--CQASLLELPDGEQYKSLDTF
AROB_ALIF1            -----------KRVVVISNVTVAPLYAQQIIDTLNTFE--CQVSLLELDDGEQYKNLDTF
AROB_PSYIN            -----------KRVMIVSNEIVAPLYLACCKETLIDF----QIDEIILPDGEKFKNLHTF
AROB_SHEWM            -----------KKILIVTNETVAPLYLEKLELQLSSFD---CVEPVILPDGEQYKTLAQM
AROB_SHEDO            -----------KKVFIVTNDVVAPLYLTQVKAALADCA---SVDVFVLPDGEKNKDLAHL
AROB_SHIDS            -----------EQVMLVTNETLAPLYLDKVRGVLEQAG--VNVDSVILPDGEQYKSLAVL
AROB_ECOLI            -----------EQVMLVTNETLAPLYLDKVRGVLEQAG--VNVDSVILPDGEQYKSLAVL
AROB_SALTY            -----------DQVMLVTNETLAPLYLDKVRGVLERAG--VNVDSVILPDGEQYKSLTVL
AROB_KLEP7            -----------DQAMLVTNETLAPLYLDTVRSVLEQSG--VNVDSVILPDGEQYKSLAVM
AROB_ERWT9            -----------EQAMLVTNQTLAPLYLDTLCARLEGAG--VIVDRVILPDGEQYKTLAVM
AROB_PHOLL            -----------QQVMLVTNQTLAPLYLAKVKATLQQAR--IRVDEVILPDGEQYKSLSVL
AROB_HAMD5            -----------DQGMLVTNQTLAPLYLSSIRTVLEQGG--VRLDHIILPDGEKYKSLASI
AROB_HAEIN            -----------DRVMIVTNPTVAQFYLDTVIYALEKRG--CVVDHVLLPDGEKYKTLESL
AROB_BLOFL            -----------DLVVIITNDRVAPIYLNRLYNSFNACE--IVTDQCILPDGEQNKSLSML
AROB_PSEPK            ------------QVAIVSNETVAPLYLERLSKAL--GA--YSVLPVVLPDGEAHKNWETL
AROB_PSEU5            ------------QVAIVTNETVAPLYLDRLTSTL--SG--YSVTPIILPDGESHKNWETL
AROB_METCA            ------------QVLVVTNEVVAPLYLDRMLASL--AG--KDTGSVVLPDGEAHKTLDSA
AROB_AROAE            ------------RVAIVTNDVVGPLYLARLQRALEADG--VRVDVVTLPDGESHKNWQTL
AROB_THIDA            ------------RVMVVTNTTVGPLYLAQLKAALEAAG--VRVAEVVLPDGEAYKNWETL
AROB_SACD2            ------------QVLVVTNTTIDALYGDSFFSLFE-GM--DKAHKVVLPDGESYKNLEAL
AROB_TERTT            ------------QVLVVTNTTVAPLYLAQLKATLS-HC--DKLDSVVLPDGEQHKTLGVL
AROB_HALHL            ------------RALLVSNETVAPLYAERLAVPG------AEVQSVTLHDGERYKTLQTC
AROB_CUPNH            ------------HAVIVTNETVGPLYAARVEAALAALG--KTVRTVTLPDGEAFKHWETL
AROB_CUPMC            ------------HAVIVTNETVGPLYAARVEAVLAGLG--KTVRTVVLPDGERFKHWETL
AROB_RALPJ            ------------RAVIVTNETVAPLYAAKVEEAIRSLG--KAVDTVVLPDGESFKKWDTL
AROB_RALSO            ------------RAVIVTNETVAPLYAARVEAAIRSLG--KTVDMVVLPDGESFKTWETL
AROB_BURCJ            ------------SVTIVTNTTVDPLYGDALRAALAPLG--KRVSTVVLPDGEAYKNWETL
AROB_BORPE            ------------AIAVVTNPTVAGLYGARVEAALARTG--KRVLRIELPDGEAHKDWQTL
AROB_NITEU            ------------KAAIVTNTTIAPLYLEKLRSALAEHH--VETFAITLPDGERYKHWETL
AROB_IDILO            ------------QLLVITNPTISQYYLKPLLKSLA--G--HQVKVFEMRDGEQFKSLDSY
AROB_DICNV            ------------HIAIITNETVAPLYLSSLKAALT--D--KKVIDIILLDGECHKNLATY
AROB_RHIME            R-----------KMAVITDENVAPRYLEPLMASLGESG--IEAVSLILPAGEKTKSFEHL
AROB_RHIEC            R-----------KAAIITDENVAPLYLDALVASLDAAG--IVSAEVVLPAGEKTKSFEHL
AROB_BRADU            V-----------RTAVVTDRTVAKHWLEPTEASLAAAG--IPTSRIVVEEGEISKTYAGL
AROB_RHOPB            A-----------RTAIVTDRNVATCWLAQTQAALDDVG--IVSMPIVVEGGEGSKSYAGL
AROB_RHOS4            P-----------KVAILTDETVAGLHLDPFRQALAEAG--IASSALALPAGEATKGWPQF
AROB_JANSC            P-----------KVWIVTEETVAALHMDALRAGLDAAN--IASEALVLPPGEATKSWPHL
AROB_PARDP            R-----------RVAILTDETVAALHLPALRESLAGQG--IEAPALALPAGEATKCWAEL
AROB_RHORT            P-----------RVFVVTDATVAALHLDPLLASLGAAG--IAHDHVVLPAGEATKSFSQL
AROB_CAUVC            K-----------RVAVVTDAHVGAHHGERLSAALQGAG--ITVDLITIAPGEESKSFEGL
AROB_CAUSK            K-----------RVAIVTDTIVGEHHGERLANALEHAG--VATDVILVPPGEETKSFEGL
AROB_HYPNA            P-----------RAFVLTDETVARHHKDALEAAVKSAG--IRLDWLSLPPGEKTKSFSQL
AROB_ZYMMO            R-----------RFIVITDENVARCQLPEFEKSFHEAG--VTVDSIILPAGEATKSWHHL
AROB_XANOR            R-----------HALLLSDSQVAPHYAAGVRAALLSARPDLQIGELVIAAGEASKTLDTF
AROB_OPITP            R-----------KVAVFTDEQVASAQVGALEAMFGSSP------RLAFAPGESAKSLASF
AROB_ACIC5            S-----------RIFIVTSPEIWALWGKKLLSGFGKS----SPEVLFLPAGEAHKRMASV
AROB_DICTD            S-----------SSFLITHPFLREIYKEDL----SIP----EENVIYVPVGEKSKSFQEV
AROB_CHLCH            N-----------TRKLFGDVVLEALRAEGF-----------QLVELVIPAREASKSFSVA
AROB_PELLD            N-----------TRKLFGEQVLRTLADEGF-----------MVHELVVPAREASKSFSTA
AROB_GLOC7            L---------GKKVLLVSNPEIYDYYGEIAVNSLKTAG--FEVATHLIPEGEIYKTLDSI
AROB_RIPO1            L---------GQKILIISNPEIFNYYGDVVVNSLKKSG--FEVFTHLIPAGEAYKTLDSI
AROB_MICAN            L---------GKKVLLVSNPEIFDYYGQIAVNSLEKAG--FAVFTHLIPAGENYKTLDAI
AROB_NOSP7            L---------GKKVLLVSNPTIFKHYGERAITSLKSAG--FEVASCTLPPGERYKNLNSI
AROB_SYNP2            L---------GQKVLIVSNPEIYGHYGETVVNSLQAAG--FSVDTHLIPAGEQYKNLASI
AROB_THEEB            P---------KAPALIVSNPQIWRHYGTDVQGALTQAG--WQVTPCILPAGERYKTLRTV
AROB_PROMA            IRT-------GEKILIVTNPDVSKPYSRRFITSLKEAG--YDANLLILEAGENKKNYESI
AROB_PROMP            INS-------NRKILIVSNKEISTLFGRKLLNNLKKNN--FNAEIFNIKAGESHKNFASL
AROB_HELHP            Y---------AHKVLLVSNPKVAGLHLKYVLERIKAP----EVYVCIVPDGEQYKDMKSI
AROB_HELPY            L---------KQKALIISDSIVAGLHLPYLLERLKAL----EVRVCVIESGEKYKNFHSL
AROB_CAMC5            I---------KGKTAIVTNPKIAGLHLNTLLNSLKCD----EYFIISVPDGEEYKNLATI
AROB_CAMHC            I---------KGNVAIITNPKVGGLWLEFLLKNLKCD----KKFIISVPDGEEYKNLNTI
AROB_PARUW            Y----------SKVVIITHPQLWVMYEQKITEQLFKLS--WNFSVLLIPEGETSKSLKQT
AROB_STRS7            L-------------LFITDQTVFDLYQPLFRRFQQDYD----SYLHIAAPGGQSKSLEEV
AROB_PYRFU            LEE-----------------VLTWLKEFKPQTIVVPDG-------------EKYKDLDTV
AROB_PYRAB            LDK-----------------IIELLGG-DVFPIVIPDG-------------EEYKTIETA
AROB_THEKO            LEK-----------------AAEGIEE--PIRIVIPDG-------------EKYKSLETA
AROB_SULTO            YSQ------------KIDPSRVKSHLKS-FIEIPIIDG-------------EGAKDIQYA
AROB_SULAC            YSS------------SVNIDFIKPHLEGEYTLVPIKDG-------------EEAKDIQYS
AROB_SACS2            YSR------------KISIADKINKYLPNAYFIPINDG-------------ESTKELSSV
E0SS73_IGNAA          RQR------------VIDPNRIVNILRDRNIYEVVLDGG------------ERDKDISNV
A8MCY5_CALMQ          IIT------------PSSVSSLVNFSKC--PRIIIKDG-------------EEGKGIETV
AROB_PYRNV            EEG------------LRP-------PIPGAPTLALRGG-------------EEVKSLEVL
AROB_PYRIL            EEG------------LRP-------PIPGAPTLVLRGG-------------EEVKSLEVL
AROB_PYRAE            EEG------------LEN-------PLPNAPALALKGG-------------EGVKSLEAL
AROB_PYRCJ            EEG------------LPS-------PLEG-PSLRLRGG-------------EEVKSFDSL
G4RLC8_THETK          IDE------------KSN-------FKAEGDCLVLSGG-------------EEIKGLDTL
A8A8F0_IGNH4          LAVVG-------EGVAKGARWVLKEASAVFPHWEILKDG------------EAAKDLSVA
G0EHA3_PYRF1          PLNCLVAYPQPLEWLANTVVQGLSSFCTHVYKFALPDG-------------EDAKRLEKV
AROB_STRAW            V--------------AVVHPEALAETGEALRADLAEQG--YEAVAIQVPNAEEAKTVEVA
AROB_STRCO            V--------------AVIHPEALAETGDALRADLAAQG--YEAIAIQVPNAEEAKTAEVA
AROB_THEFY            V--------------AVIHPDTLEEKARPVCEILRTAG--YDVFPLPVPDGEAAKDVSVA
AROB_ARTS2            V--------------LVIHPRALRLTGDTVRDELASAG--FTALTAEIPDAEEGKHIQVA
AROB_LEIXX            V--------------LVVHPPTLGAAAAELRESLAGQ---YEVLLTEVPDAEAAKRIEVA
AROB_MYCTU            V--------------AVVHQPGLAETAEEIRKRLAGKG--VDAHRIEIPDAEAGKDLPVV
AROB_MYCLE            V--------------AILHQPVLTQTAEAIRSHLAGKG--VDAHRIEIPDAEAGKDLSVM
AROB_SACEN            V--------------ALVHQPSITTTVETVRDELAAAG--LDAHRVEVPDAEDGKSLAVA
C6W902_ACTMD          A--------------AIVHTAVLAETADAVLEELRGAG--VDAHRVEVPDAEDGKDLRVA
AROB_CORGL            V--------------AILHQPSMDDIASELDAALVAAG--LKVLHLNVPDAENGKSLEVA
AROB_COREF            V--------------ALLHQPALAEVAADIDGALQAAG--LQVLHLEVPDAESGKTLAVA
AROB_CORP2            A--------------AIITQPVMGETAKKLVGAIEALG--KEATIITVPDAEDGKNLNVA
AROB_CUTAK            A--------------AVVCPQTLVHLVPRFGID--------DLVVIEVPDAEAAKTPEVL
AROB_TROWT            T--------------RRILIMYQDSVSQVLPIFSAASG--VQCYRYLIPDSESAKQLGVA
AROB_TROW8            T--------------RRILIMYQDSVSQVLPIFSAASG--VQCYRYLIPDSESAKQLGVA
AROB_DEIGD            ------------------ALIHPADLPSAFVTAVRAAL--SPAVTVQVPSRDDCKTLPVF
F0RLU4_DEIPM          ------------------ALLHDRALPTEWVSRARQAL--NPALVLPVSSGESGKTLDEV
L0A5T3_DEIPD          ------------------VLIYDEGLPGSLVEHVRRRL--QTELNLAVPSGDACKTLDVY
P83703_THETH          ------------------ALLFDRRVEG-FAQEVAKAL--GVRHLLGLPGGEAAKSLEVY
AROB_THEVO            I---------------MISKTVEEMYANHIPDVGSFGN---SVVKISLNDGESLKSLRNY
                                                                            *     

AROB_BACSU            TKLQSEAIRFHMDRSSCIIAFGGGVVGDLAGFVAATFMRGIDFIQMPTTLLAH-DSAVGG
AROB_BACP2            EHIHTKAIQFQLDRSSCIIALGGGVIGDLAGFVAASYMRGIDFIQVPTTLLAH-DSAVGG
AROB_OCEIH            YRLQTEALQNGLDRHSLIIALGGGVVGDLAGLVAATFMRGIDYIQVPTTILAH-DSSVGG
AROB_BACAN            YAAHTSALENKLDRNSLIIALGGGMIGDLAGFVAASFMRGIRFVQVPTTLLAH-DSAVGG
AROB_BACCR            YAAHTSALENKLDRNSLILALGGGMIGDLAGFVAASFMRGIRFVQVPTTLLAH-DSAVGG
AROB_LISMO            EDVMTKMIETGLDRKAVLIAFGGGVIGDLGGFVAATYMRGIPFYQVPTTVLAH-DSAVGG
AROB_STAEQ            HRTIEYLLSHQLTRQTCIVAIGGGATGDFAGFIAATLLRGVSFVQVPTTILAH-DSSVGG
AROB_STAS1            EKTIESLLAKQLTRDTCLIAIGGGATGDFTGFLAATLLRGVDFIQVPTTILAH-DSSVGG
AROB_STACT            QHIIEELLEQSITRNTCIIAIGGGVIGDFAGFVAATILRGVDFIQVPTTILAH-DSSVGG
AROB_MACCJ            STVVEKLLSMHVTRHSCLFAIGGGATGDFTGFVAATLLRGIHFIQVPTTILAH-DASIGG
AROB_EXIS2            QRLLEEGIEQGATRKTMILAVGGGMIGDLAGFVAATFLRGVPFLQIPTTLLAH-DSSVGG
AROB_EXISA            EQLVAEGLRHGCDRETLIVAFGGGMIGDLAGFLASVYMRGVPYIQVPTTILAH-DSAVGG
AROB_PELPD            NLVYDQLIQAGLDRNSYIVALGGGVVGDLAGFAAATFLRGIPFVQVPTTLLAQVDSSVGG
AROB_GEOSL            TSVYDELIKGGLTRDSLLVALGGGVVGDLAGYAAATYLRGVPFVQVPTTLLAQVDSSVGG
AROB_PELTS            GRLYDRAFEAGLDRRSSIVALGGGVVGDVAGFVAATYMRGISFVQVPTTLLAQVDSSVGG
AROB_THEP3            QRLLEKAYDYGLLRDSSVIALGGGVVGDIAGFVAATYMRGIDFVQIPTTLLAQVDSSVGG
AROB_HUNT2            RDIYKYLLGLKLDRSATLMALGGGVVGDITGFAAATFLRGINFVQIPTTLLAQSDSSVGG
AROB_PELUB            NEITSILLKKSFNRNDCLISIGGGITGDVSGFAASTFKRGLKFVNIPTTLLSQVDSSIGG
A0A1V6INJ9_9EURY      EELEDRLFEFGFGRDSLIIALGGGVTGDLAGFIAATYMRGIPFIQIPTTLLSQVDSSIGG
F8C417_THEGP          ISLARALIQKNFDRKDIIIALGGGVVGDVAGFLASIYLRGIPYIQIPTTLLAQVDSSVGG
F8AD96_THEID          VNLARQMLQKGFDRKCAIIALGGGVTGDLAGFLASIYLRGVPYVQIPTSLLAQVDSSVGG
AROB_LEPIN            GEVYNQLIEYGADRKSLILAFGGGVVGDFAGFIASTYLRGIRFVQIPTTLLACVDSSVGG
AROB_UNCTG            SFLYDKALEAGIDRKSCAIALGGGVIGDVAGFFAATYMRGINYIQVPTTLLAMTDSSVGG
AROB_STRGC            NKAYEFLAKVGLTRSDGIVALGGGVVGDLAGFVASTYMRGIHFVQIPTSLTAQVDSSIGG
AROB_STRT2            NKAYEFLIKNGMTRSDGIVALGGGVVGDLAGFVASTYMRGIHFVQVPTSLTAQVDSSIGG
AROB_CLOK5            ERVYEKLCEFQIRRKDIIISLGGGVVGDLSGFAASTYLRGINYIQVPTSLLAQVDSSIGG
AROB_LEUCK            GELIGKMAEKGFTRDDGLIALGGGVIGDLGGVVASLYMRGIALIQIATSLTAQVDSSVGG
AROB_LEUMM            GELIAKMAAAGFTRGDGVIALGGGVIGDLGGVVASLYMRGIAFIQIATSLTAQVDSSVGG
AROB_DEHM1            SHIYPQLINHFAERNTPILALGGGVIGDLSGFVAATYQRGVPLVHLPTSLLSQVDSSIGG
AROB_ALKOO            GEIIHELTENKQDRDTIILALGGGVIGDLGGFVASTYMRGVDLIHIPTTLLAQIDSSIGG
AROB_NATTJ            ESLYEKAASLNLDRSSWFIGIGGGVVGDLTGFVAATYMRGANLLHVPTTLLAQVDSSVGG
AROB_VIBPA            NQVMNFLLEGSYARDVVIIALGGGVIGDLVGFASACYQRGVDFIQIPTTLLSQVDSSVGG
AROB_VIBVY            NQVMSFLLEGSFARDVVVIALGGGVIGDLVGFSAACYQRGVDFIQIPTTLLSQVDSSVGG
AROB_ALIF1            NQILTFLLEENHSRDVTIVALGGGVVGDVVGFASACYQRGVDFIQIPTTLLSQVDSSVGG
AROB_PSYIN            EIILTALLSNKHARDTTIIALGGGVIGDMAGFAAACYQRGVPFIQVPTTVLSQVDSSVGG
AROB_SHEWM            DSIFTSLLQQNSGRDTVLIALGGGVIGDMTGFAAASYQRGIDFIQIPTTLLAQVDSSVGG
AROB_SHEDO            EQIFSALLEKNYARDTTLLALGGGVIGDMTGFAAACYQRGVPFVQVPTTLLAQVDSSVGG
AROB_SHIDS            DTVFTALLQKPHGRDTTLVALGGGVVGDLTGFAAASYQRGVRFIQVPTTLLSQVDSSVGG
AROB_ECOLI            DTVFTALLQKPHGRDTTLVALGGGVVGDLTGFAAASYQRGVRFIQVPTTLLSQVDSSVGG
AROB_SALTY            DTVFTALLKKPHGRDTTLVALGGGVIGDLTGFAAASYQRGVRFIQVPTTLLSQVDSSVGG
AROB_KLEP7            DTVFTALLQKPHGRDTTLVALGGGVIGDLTGFAAASYQRGVRFIQVPTTLLSQVDSSVGG
AROB_ERWT9            DQVFSALLAKPHGRDTTLIALGGGVIGDLTGFAAASYQRGVRFIQVPTTLLSQVDSSVGG
AROB_PHOLL            NDVFSALLENSHSRDTTLIALGGGVIGDLTGFAAACYQRGVRFIQMPTTLLAQVDSSVGG
AROB_HAMD5            ELIFTELLKKWHGRHTTLIAFGGGVIGDLTGFAAACYQRGIRYIQIPTTLLAQVDASIGG
AROB_HAEIN            NLIFTALLQGNHGRDTTIIALGGGVIGDVAGFAAASYQRGVRLIQIPTTLLSQVDSSVGG
AROB_BLOFL            NKILTQLLSKNYDRDTILVALGGGVIGDLTGFAASVYQRGIRFIQVPTTLLAQVDASIGG
AROB_PSEPK            QLIFDGLLTARHDRRTTVVALGGGVIGDMAGFAAACYQRGVDFIQVPTTLLSQVDSSVGG
AROB_PSEU5            QLIFDALLGARHDRNTTVVALGGGVIGDMAGFAAASYQRGVDFIQVPTTLLSQVDSSVGG
AROB_METCA            MAVFDALLARRFGRNAAIVALGGGVIGDLAGFAAACYQRGVPFIQVPTTLLSQVDSSVGG
AROB_AROAE            NLVFDMLLATRCERSTTLIALGGGVVGDMAGFAAATYQRGMPFIQVPTTLLSQVDSSVGG
AROB_THIDA            NLVFDALLRERAERKTTLIALGGGVIGDMTGFAAACYQRGVPFIQIPTTLLSQVDSSVGG
AROB_SACD2            NQIFDALLEGKHNRKTTLVALGGGVVGDMTGFAAAAYQRGVGFIQVPTTLLSQVDSSVGG
AROB_TERTT            NTIFDTLIAQRHNRKTTLIALGGGVVGDMTGFAAACYQRGVNFIQVPTTLLSQVDSSVGG
AROB_HALHL            EQVYDALIEGRFDRSATVIALGGGVVGDMAGFCAATYQRGVGYIQVPTTLLAQVDSSVGG
AROB_CUPNH            NRIFDALLQAGADRKTTLVALGGGVVGDMTGFAAACYMRGVPFIQMPTTLLAQVDSSVGG
AROB_CUPMC            NLIFDALLQAGADRKTTLIALGGGVVGDMTGFAAACYMRGVPFVQMPTTLLAQVDSSVGG
AROB_RALPJ            NRIFDALLTAGADRKTTLIALGGGVIGDMTGFAAACYMRGVPFIQVPTTLLSQVDSSVGG
AROB_RALSO            NRIFDALLASGADRKTTLVALGGGVIGDMTGFAAASYMRGVPFIQVPTTLLSQVDSSVGG
AROB_BURCJ            NLIFDGLLTDHADRKTTLVALGGGVVGDMTGFAAACYMRGVPFIQVPTTLLSQVDSSVGG
AROB_BORPE            NLIFDALLENRLDRRAVLVALGGGVIGDMTGFAAAVYMRGIRFVQVPTTLLAQVDSSVGG
AROB_NITEU            NLIFDALLEHRCERRTPLIALGGGVIGDLTGFAAATYLRGVPFIQIPTTLLAQVDSSVGG
AROB_IDILO            AEAMDILIDAGFNRDCGIIALGGGVVGDLAGFVASTFQRGVDFYQIPTTLLSQVDSSVGG
AROB_DICNV            QHILTTLLEAHLGRDGLLIALGGGVINDITGFVAATYQRGICWITFPTTLLAQVDAAVGG
AROB_RHIME            IPVCEAILGARIERNDAVIALGGGVIGDLTGFAAGIVRRGSRFIQIPTSLLAQVDSSVGG
AROB_RHIEC            ITVCDKVLEARVERNDCVIALGGGVIGDLSGFAAGIVRRGVRFVQVPTSLLSQVDSSVGG
AROB_BRADU            EKVSEALIAAKIERNDLVIALGGGVVGDLAGFAAAILRRGVDFVQVPTSLLAQVDSSVGG
AROB_RHOPB            QQVCEALIAAKIERNDLVIALGGGVVGDLAGFAASIVRRGLDFVQVPTSLLAQVDSSVGG
AROB_RHOS4            ARAVEWLLEEKVERRDVVVALGGGVIGDLAGFAAAVLRRGVRFVQVPTTLLAQVDSSVGG
AROB_JANSC            QRIADWLLSERVERADIVIAFGGGVIGDLAGFAAAIHRRGIRFVQIPTSLLAQVDSSVGG
AROB_PARDP            GRAVEWLLAQRIERKDLVIALGGGVIGDLAGFAAAILRRGVRFVQIPTTLLAQVDSSVGG
AROB_RHORT            EELLDLLLAARFERSTTLLALGGGVIGDLVGFAAAILLRGVDFIQIPTTLLAQVDSSVGG
AROB_CAUVC            ADLSDRLLALNLERGDQIVALGGGVVGDLAGFAAAIYKRGIDFVQVPTTLLAQVDSSVGG
AROB_CAUSK            ADLSDRLLALGLERGDMVIAFGGGVVGDLTGFAAAIYKRGIDFIQIPTTLLAQVDSSVGG
AROB_HYPNA            EGVLDWLLAGGADRGDTLIAFGGGVIGDMGGLAASLMKRGMGFVQVPTTLLAQVDSSVGG
AROB_ZYMMO            AELCDQLIRRGVERRDAIIALGGGVIGDLVGFAAAILKRGCQFIQIPTSLLAQVDSSVGG
AROB_XANOR            GSAITALAELGATRDACVFALGGGVVGDLAGFAAACWMRGVDCVQLPTSLLAMVDSSVGG
AROB_OPITP            GRAMDFLAAQKVDRRGVVFAFGGGVIGDLAGFIAASWLRGIDFYQVPTTLLAMVDSSVGG
AROB_ACIC5            EKLATALSESGADRSSLLIAFGGGILGDLTGFLAAIYMRGIDYVQIPTTLLAQVDSSVGG
AROB_DICTD            IKISKELAKRMADRRSALFAFGGGVVGDLTGFIASIYMRGIKYIQIPTTLLSQVDSSIGG
AROB_CHLCH            YRLYGQMIEADVDRSWNLLAVGGGVVGDLGGFIAASYFRGIPVIQMPTTLLAMTDSAIGG
AROB_PELLD            YKLYGGMIEAGVDRSWNLLAVGGGVVGDLGGFIAASYYRGIPVIQLPTTLLAMTDSSIGG
AROB_GLOC7            TQIYDTAVENFLERSSTMIALGGGVVGDMTGFAAATWLRGISFVQVPTSLLAMIDAAIGG
AROB_RIPO1            AQVYDTALEHRLERSSTMIALGGGVIGDMTGFAAATWLRGINFVQVPTSLLAMVDASIGG
AROB_MICAN            AQVYDSALAHRLERSSTMVALGGGVIGDMTGFAAATWLRGVNFVQVPTTLLAMVDASIGG
AROB_NOSP7            QKLYDVALENRLERSATMVALGGGVIGDMTGFAAATWLRGINVVQVPTTLLAMVDSAIGG
AROB_SYNP2            EKIYDTAFKNRLERSSTLLALGGGVIGDMTGFAAATWLRGINFVQVPTTLLAMVDASVGG
AROB_THEEB            EKIYDAALSQRLERGSTLFALGGGVIGDMTGFAAATWLRGIAVVQIPTSLLAMVDAAIGG
AROB_PROMA            ALIHNAAYEHQLDRGSLIIALGGGVIGDMAGFAAATWLRGIDFVQVPTTLLAMVDASVGG
AROB_PROMP            SEIFNAAFEVGLDRNSLLIALGGGIVGDVTGFAAATWLRGIEYIQIPTTLLSMVDSSVGG
AROB_HELHP            EYILECAFTHRLDRKSLMIALGGGVIGDMVGFASGIYQRGIDFIQIPTTLLAQVDASVGG
AROB_HELPY            ERILNNAFEMQLNRHSLMIALGGGVISDMVGFASSIYFRGIDFINIPTTLLAQVDASVGG
AROB_CAMC5            ELILEQLFTSKLDRSSTLIAFGGGVISDMTGFAASIYERGINFINIPTTLLAQVDASVGG
AROB_CAMHC            EQILEQLFSSKCDRKTTLIALGGGVISDMTGFAASIFERGIDFINFPTTLLAQVDASVGG
AROB_PARUW            TRCWRHFIKHQLDRYSLVVALGGGVICDLAGFVASCYMRGIDTIYLPTTLLAMVDASIGG
AROB_STRS7            SRIYDRLIRANFSKKDVIVTVGGGVIGDLGGFVAATFYRGISYIQIPTTLLSQVDSSIGG
AROB_PYRFU            RYIWEKLLEMGFTRRSLLIGLGGGVITDIAGFVASTYMRGTYLGLVPTTLLAQVDAAIGG
AROB_PYRAB            IKIWDELVSFGFTRKSLLIGLGGGVITDIAGFVASTYMRGTLLGFIPTTLLAQVDAAIGG
AROB_THEKO            VAIWKRLQEEGFTRKSLLIGLGGGVVTDIAGFVASTYMRGTLLGLVPTTLLAQVDAAIGG
AROB_SULTO            LKLVKLLFENGFDRGDYVIALGGGTVTDVVGFVASIYMRGINLINIPTTLLGMVDAAIGG
AROB_SULAC            LELLKVLFDGGFDRGDYVIAIGGGSVTDTVGFIASTYMRGLNLINVPTTLLGMVDAGIGG
AROB_SACS2            ISLVEKLFEKNFDRGDYIIGVGGGTVTDVAGFLASIYLRGLNLINVPTTFLGMVDAAIGG
E0SS73_IGNAA          MNIVRILYEKGFQRRDHIVAVGGGTLTDVAGFVASIYLRGINLVNIPTTLLGMVDAAIGG
A8MCY5_CALMQ          LNIIKQSMDNSLDRSGVMIGIGGGSTLDVTGFAAAVYMRGVDYVNVPTTTLAMVDAALGG
AROB_PYRNV            TKVYGFLKEVGADRSTTLVAVGGGALLDLATFAAGTYMRGIRLVHIPTTLLAMVDAALGG
AROB_PYRIL            TKVYSFLKEVGADRSTTLVAVGGGALLDLATFAAGTYMRGIRLVHIPTTLLAMVDAALGG
AROB_PYRAE            SKVYVFLQEAEADRGSTLVAVGGGALLDLATFAAGTYMRGIGLVQVPTTLLAMVDAALGG
AROB_PYRCJ            LRVYQFLAEQGADRSSTLVAVGGGALLDLATFAAGTYMRGIGLVLVPTTLLAMVDAALGG
G4RLC8_THETK          TKVYQYLASRGVDRATYLVAVGGGALLDLATFAAGTYMRGIGLVLVPTTLLSMVDASIGG
A8A8F0_IGNH4          LNIIRKLWELKADRWCALGVIAGGSLGDTASFAASVYMRGIPLIQFPTTLLAMIDSSLGG
G0EHA3_PYRF1          LELVEFMHRLGFSRRDLVVVAGGGAASDSAGFAAAIYKRGVPYVNIPSTLLSMVDAAIGG
AROB_STRAW            AYCWKALGQSGFTRTDVIVGVGGGATTDLAGFVAATWLRGVRWIAVPTTVLGMVDAAVGG
AROB_STRCO            AYCWKALGQSGFTRTDVIVGVGGGASTDLAGFVAATWLRGVRWIAVPTTVLSMVDAAVGG
AROB_THEFY            ADLWARLGQAAFTRTDVIVGVGGGATTDLAGFVAATWLRGVRAILVPTTLLGMVDAAVGG
AROB_ARTS2            AFCWQVLGQNDFTRSDAVVAVGGGAVTDLAGFVAATWLRGVKVIHMPTSLLGMVDASVGG
AROB_LEIXX            SFLWCIMGQADFTRSDAVVGLGGGAVTDLAGFAAATWLRGVRLVQAPTTLLGMVDAAVGG
AROB_MYCTU            GFIWEVLGRIGIGRKDALVSLGGGAATDVAGFAAATWLRGVSIVHLPTTLLGMVDAAVGG
AROB_MYCLE            DFIWEVLGRIGIGRKDALVSFGGGAATDVAGFAAATWLRGVSIVHVPTTLLGMVDAAVGG
AROB_SACEN            GFCWEVLGKIGLDRDGVVVSFGGGAVTDVAGFVAGTWMRGVRVVHVPTTLLGMVDAAIGG
C6W902_ACTMD          GYCWDVFGQIGLGRQDVVVGLGGGAVTDLAGFVASTWMRGVRLINVPTTLLGMVDAAVGG
AROB_CORGL            GQCWDELGGAAFGRRDIVIGLGGGAATDLAGFVAAAWMRGVRVIQVPTTLLAMVDAAVGG
AROB_COREF            GECWDKLGAAAFGRRDIIIGLGGGAATDLAGFVAAAWMRGVRVIQVPTTVLGMVDAAVGG
AROB_CORP2            GDCWDVLGRKAFGRKDVIISLGGGAVTDLAGFVAACWMRGIAVIHVPTTLLSMVDAAVGG
AROB_CUTAK            VNGWRRLAEANMTRGDIIVGFGGGATTDVAGFLAATWMRGIDVIHVPTTVLAMADAAIGG
AROB_TROWT            EQCWRFLAQNNFTRSDLIVSCGGGAASDLSGFVASSYLRGIKVIHIPTTLVGMVDAAIGG
AROB_TROW8            EQCWRFLAQNNFTRSDLIVSCGGGAASDLSGFVASSYLRGIKIIHIPTTLIGMVDAAIGG
AROB_DEIGD            ADVLSRLAQVNLPRDAAVVGLGGGAVTDLAGFVAASYLRGVAFYTLPTTLLGMVDAAVGG
F0RLU4_DEIPM          GRLLSALAQGGLSRAGAVVGLGGGATTDVAGFVAASYLRGVAYYAAPTTLLGMVDAAVGG
L0A5T3_DEIPD          GTLLSRLAGAALARDAAVIGLGGGATTDLAGFVAASYLRGVAFYTLPTTLLAQVDAAVGG
P83703_THETH          GKVLSWLAEKGLPRNATLLVVGGGTLTDLGGFVAATYLRGVAYLAFPTTTLAIVDASVGG
AROB_THEVO            QKIVKVLLERKVDRRSLLVYIGGGTVGDLAGFVASTYKRGVMMIAVPTTLLAQVDSSIGG
                                   :       .**   *     :.   **      .::  .  *:.:**

AROB_BACSU            KVAVNHP-LGKNLIGAFYQPKAVLYDTDFLRSLPEKELRSGMAEVIKHAFIYDR------
AROB_BACP2            KTGINHP-LGKNLIGAFHQPKAVIYDTSMLETLSQTEMRSGFAEVIKHALISSE------
AROB_OCEIH            KVAINHH-LGKNLIGSFFPPVAVIYDIETLSTLPPHEIRSGYAEIVKEGLIANQ------
AROB_BACAN            KVAINHP-LGKNMIGAFHQPEAVVYHTPFLQSLPEKEWRSGYAEVIKHALIGDV------
AROB_BACCR            KVAINHP-LGKNMIGAFHQPEAVVYHTPFLQSLPEKEWRSGYAEVIKHALIGDV------
AROB_LISMO            KVAINHP-LGKNMIGNFYQPEAVIYDTQFFATLPERELRSGFAEMIKHALISDL------
AROB_STAEQ            KVGINSE-HGKNLIGAFYRPKAVIYDLDFLETLPYSEILSGYAEVYKHALLNGE------
AROB_STAS1            KVGINSK-HGKNLIGAFYRPKAVIYDLNFLETLPYTEILSGYAEVYKHALLNDI------
AROB_STACT            KVGINTP-QGKNLVGAFYRPTAVLYDLDFLNTLPYTEISSGYAEVYKHALLNGE------
AROB_MACCJ            KTGINAS-SGKNLIGAFKRPDMVLYDLDFLETLSQIEKLSGFAEIIKHVLLNANGHISKS
AROB_EXIS2            KVGLNLR-WGKNLVGAFYQPSAVLYDPAFLQTLSDREWRSGFFELLKHGLLARP------
AROB_EXISA            KVAVNHP-LAKNAIGSFYQPSGVYYNVTRLNTLSVQEVRSGLGELLKHAYLSRY------
AROB_PELPD            KTAIDHP-RGKNLIGAFYQPRLVLIDVETLTTLPQREFRAGLAEVIKYGVAMDLAF----
AROB_GEOSL            KTGINHP-LGKNLIGAFHQPRAVLIDVDTLATLPQREYLGGLAEVIKYGVVLDGKF----
AROB_PELTS            KVAVNHP-RGKNIIGAFYQPRLVLADVDTLKTLPVRQMRSGLAEVIKYGVIWSREF----
AROB_THEP3            KVAVNLK-KGKNIIGAFHQPKMVYIDTAVLNTLDKREILGGLAEIIKYGIIWDFSL----
AROB_HUNT2            KVGVDFE-GTKNIIGAFYQPKFVYINVNTLKTLPERELKAGLAEVVKHGVIMDEEF----
AROB_PELUB            KTGVNTK-YGKNLIGSFYQPSLVISDTNFLNSLPKREVVCGYGEILKHSLINGKKF----
A0A1V6INJ9_9EURY      KVGIDHP-YGKNLLGAFYPPSKVYIDMEFLNTLPKEEILNGFAEIIKAAIIKDNEF----
F8C417_THEGP          KTGVDLP-EGKNLIGTFYQPAKVYIDPLVLKSLPIEEIKNGLAEVIKYGCILKRRL----
F8AD96_THEID          KTGVDLP-EGKNLLGTFYQPWRVYIDYGVLSTLPFEHLKNGLAEVVKYGCISSPNL----
AROB_LEPIN            KVAVNAD-FGKNMIGSFYQPEFVFAPLSVLSTLPDREWKCGQAEIIKHSLLSGGEY----
AROB_UNCTG            KTAVNIK-GGKNIAGVFYQPDLVWINSAFLSTLTERHIKNGLAEIIKYAFTFDKKF----
AROB_STRGC            KTGVNTP-WAKNMVGTFTQPDGVLIDPEVLHTLGQRELIEGMGEVVKYGLIEDKEL----
AROB_STRT2            KTGVNTP-FAKNIVGTFAQPDGVLIDPNVLKTLGKRELIEGMGEVVKYGLIDDPEL----
AROB_CLOK5            KVAVDLP-WGKNLVGSFYHPDAVFIDPDVLLSLNDKFFSDGMGEVIKYGFIKDKSI----
AROB_LEUCK            KTAINLS-HTKNIAGTFYQPDLVLVDPTYLDTLADRDLVEGYAEVVKTSVLAGGSF----
AROB_LEUMM            KTAVNLG-NTKNIAGSFYQPDLDLVDVTYLNTLTDRDLVEGYAEVVKTSALANQDF----
AROB_DEHM1            KVAVNHG-GIKNIVGSFYQPRLVISDISCLKTLPEKEFACGMAEIIKSAAIGSSEL----
AROB_ALKOO            KTGINFG-AIKNLLGTFYHPRAVYMDLSTLDTLPKREYIAAFGEIIKYGLIGDYDL----
AROB_NATTJ            KVAINQS-GYKNLVGNFYQPKAVIIDTNFLDTLPIRELRAGLAEVFKYGILCDREL----
AROB_VIBPA            KTAVNHP-LGKNMIGAFYQPKAVIIDTNCLSTLPEREFAAGIAEVIKYGIIYDGAF----
AROB_VIBVY            KTAVNHP-LGKNMIGAFYQPKSVIIDTNCLKTLPEREFAAGIAEVIKYGIIYDAEF----
AROB_ALIF1            KTAINHP-LGKNMVGAFYQPKAVIIDINCLKTLPEREFAAGMAEVIKYGIIVDREF----
AROB_PSYIN            KTAVNHP-LGKNMIGAFYQPQSVIIDIDCLKTLPAREFSAGMAEVIKYGILYDQAF----
AROB_SHEWM            KTAVNHP-LGKNMIGAFYQPKLVVIDTDCLSTLPAKEFSAGMAEVIKYGIIWDSEF----
AROB_SHEDO            KTAVNHP-LGKNMIGAFYQPQCVIIDTQCLHSLPKAEFDAGMAEVIKYGIIWDAEF----
AROB_SHIDS            KTAVNHP-LGKNMIGAFYQPASVVVDLDCLKTLPPRELASGLAEVIKYGIILDGAF----
AROB_ECOLI            KTAVNHP-LGKNMIGAFYQPASVVVDLDCLKTLPPRELASGLAEVIKYGIILDGAF----
AROB_SALTY            KTAVNHP-LGKNMIGAFYQPASVVVDLDCLKTLPARELTSGLAEVIKYGIILDADF----
AROB_KLEP7            KTAVNHP-LGKNMIGAFWQPVSVVVDLNCLKTLPKRELASGLAEVIKYGVILDGEF----
AROB_ERWT9            KTAVNHP-LGKNMIGAFYQPAAVVVDLDCLDTLPARELSSGLAEVIKYGIILDGDF----
AROB_PHOLL            KTAVNHP-FGKNMIGAFYQPASVMVDLNCLQTLPARELSSGLAEVIKYGIILDSAF----
AROB_HAMD5            KTAVNHQ-LGKNMIGAFYQPASVIIDIDCLSHLPLRHFSSGLAEAIKYGIAFDFDF----
AROB_HAEIN            KTAVNHE-LGKNMIGAFYQPSMVIIDTLTLNTLPKREVNAGLAEVIKYGAILDYEF----
AROB_BLOFL            KTGVNHV-FGKNMIGSFHQPISVMVDLDCLCTLSEKEFRSGLSEIIKYAVALDSAF----
AROB_PSEPK            KTGINHP-LGKNMVGAFYQPKAVLIDTTSLKTLPARELSAGLAEVIKYGLICDKPF----
AROB_PSEU5            KTGINHP-LGKNMIGAFYQPRAVVIDTATLATLPSRELSAGLAEVIKYGLICDEPF----
AROB_METCA            KTAVNHP-RGKNMIGAFYQPRCVLADTDTLDTLPDRELSAGLAEVIKYGFIRDPEF----
AROB_AROAE            KTAINHP-LGKNMIGAFYQPRVVLADTATLDTLPDRELKAGLAEVIKYGLIRDPAL----
AROB_THIDA            KTGINHP-LGKNMIGAFYQPKLVLADAATLGTLPARELSAGLAEVIKYGLIWDVEF----
AROB_SACD2            KTGVNHP-LGKNMIGAFHQPNVVVIDTDVLKTLPDRELSAGMAEVIKYGLIADYEF----
AROB_TERTT            KTGVNHP-QGKNMIGAFYQPQAVVIDTQVLDTLPERELSAGLAEVIKYGIIADIPF----
AROB_HALHL            KTGVNHP-RGKNMIGAFHQPRAVVADTGVLATLPEREYNAGLAEVVKYGLIRDPAF----
AROB_CUPNH            KTGINHP-LGKNMIGAFHQPNAVIADIDTLRTLPARELAAGMAEVIKHGAIADAEY----
AROB_CUPMC            KTGINHP-LGKNMIGAFHQPNAVIADIDTLRTLPPRELAAGMAEVIKHGAIADADY----
AROB_RALPJ            KTGINHP-LGKNMIGAFHQPQAVLADIDTLRTLPARELAAGMAEVIKHGAIADADY----
AROB_RALSO            KTGINHP-LGKNMIGAFHQPQAVLADIDTLRTLPPRELAAGMAEVIKHGAIADADY----
AROB_BURCJ            KTGINHP-LGKNMIGAFYQPQAVIADIGALTTLPDRELAAGVAEVIKTGAIADAEF----
AROB_BORPE            KTAVNHP-LGKNMIGAFYQPVAVEIDTEVLGTLPAREVSAGLAEVIKYGLILDAGF----
AROB_NITEU            KTGINHP-LGKNMIGAFYQPQLVLTDSATLTTLPDRELRAGIAEIIKYGLIYDADF----
AROB_IDILO            KTAVNHP-QGKNLIGAFYQPKSVVIDIDCLQTLTERDYRSGLAEIVKYGVIYDADF----
AROB_DICNV            KTGVNHA-CGKNMIGAFYPPQAVLMDTATLSTLPPREFSAGLAEVIKYALIYDISF----
AROB_RHIME            KTGINSA-HGKNLIGVFHQPDLVLADTAALDTLSPREFRAGYAEVAKYGLIDKPEF----
AROB_RHIEC            KTGINSPRHGKNLIGVFHQPDLVLADTDVLNTLSEREFRAGYAEVAKYGLIDKPDF----
AROB_BRADU            KTGINSP-QGKNLLGAFHQPVLVIADTAVLDTLSPRQFHAGYAEVAKYGVLGDEAF----
AROB_RHOPB            KTGINSP-HGKNLVGAFHQPVLVIADTAVLDTLSPRQFRAGYAEVAKYGALGDEAF----
AROB_RHOS4            KTGINTA-QGKNLVGAFHQPSLVLADIGVLETLPPRDFRAGYGEVVKYGLLGDADF----
AROB_JANSC            KTGINAP-QGKNLIGAFHQPSLVLADIDVLGTLMPRDFLAGYGEVAKYGMLGDAPF----
AROB_PARDP            KTGINSP-QGKNLIGAFHQPALVLADIDVLTTLSPRDFRAGYGEVAKYGLLGDEGF----
AROB_RHORT            KTGINTA-YGKNLVGAFHQPRLVLADTTVLDTLPRRELLAGYGEVVKYGVIDDPAF----
AROB_CAUVC            KTAIDTP-RGKNLIGAFHQPRLVLADLDVLATLPARELACGYAEIIKYGLLGDFAF----
AROB_CAUSK            KTAIDTP-RGKNLIGAFHQPRLVLADLDILATLPARELACGYAEVIKYGLLGDFAF----
AROB_HYPNA            KTAVNTP-RGKNLIGAFYQPRLVIADTALLATLPARELKAGYAEIVKYGLINDAAF----
AROB_ZYMMO            KTAINCE-AGKNLIGAFHQPVFVLIDPDALQTLPARQLRAGYGEIIKYGLIDDPDF----
AROB_XANOR            KTAVDIP-QGKNLVGAFHPPRAVLADTDTLRTLPARELRAGLAEVIKYGAIRDPLF----
AROB_OPITP            KTGINIP-AGKNLVGAFHQPRGVFIGTDFLRTLPAREFAAGMAEVIKYGLLGDAAL----
AROB_ACIC5            KTGANLS-TGKNLIGSFHHPRAVFADVDVLHTLPPRELRAGLQECVKAGIIRDAAL----
AROB_DICTD            KTGINIR-EGKNLIGTFYHPDAVIIDIKTLDTLSEREYKSGIAEVIKYGMIMNYEF----
AROB_CHLCH            KVAINHP-LGKNLIGFFHLPELVLIDPATLASLPRREIYAGLAEVVKYGFIADANF----
AROB_PELLD            KVAINHP-LGKNLIGFFHLPELVLIDPSYLGTLPEREVYSGLSEVVKYGFIADSAL----
AROB_GLOC7            KTGVNHP-KGKNLIGAFHQPRLVLIDPQVLKTLPPREFRAGMAEVIKYGVIWDANL----
AROB_RIPO1            KTGVNHP-QGKNLIGAFYQPRLVFIDPSVLKTLPVREFRAGMAEVIKYGIIWDKAL----
AROB_MICAN            KTGVNHP-QGKNLIGAFYQPKLVLIDPDVLKTLPVREFRAGMAEVIKYGVIWDAEL----
AROB_NOSP7            KTGVNHP-HGKNLIGAFHQPRLVLIDPDVLKTLPMREFRAGMAEVIKYGVIWDAEL----
AROB_SYNP2            KTGVNHP-QGKNLIGAFYQPKFVLIDPTVLKTLPVREFRAGMAEVIKYGVIWDADL----
AROB_THEEB            KTGVNHP-QGKNLIGAFHQPRLVVIDPDVLATLPPREFRAGMAEVIKYGVIWDAEL----
AROB_PROMA            KTGVNHP-KGKNLIGAFHQPKLVLIDINTLKTLPQREFRSGMAEIIKYGVIKDLEL----
AROB_PROMP            KTAVNHP-KGKNLIGAFYQPKAVFIDPETLITLPTREFKAGMAEVIKYGVIKDKSL----
AROB_HELHP            KTGINNT-FGKNLIGLFHQPKAVYIDPFMLSTLPKREFGAGVAEIIKMAVCFDEAF----
AROB_HELPY            KTGINTP-YGKNLIGSFHQPKAVYMDLAFLKTLEKREFQAGVAEIIKMAVCFDKN-----
AROB_CAMC5            KTGVNNK-FGKNMIGSFYQPKAVYCESKFLRTLAFREFNAGLAEAVKMAVTFDKEM----
AROB_CAMHC            KTGVNNK-FGKNLIGSFHQPKAVFCESEFLNTLPPREFSAGVAEAIKMAVMFDKKF----
AROB_PARUW            KTGINTS-KSKNIIGSFHLPKKILIDPFTLKTLSKKHYQAGFAEIIKYGMIASPSL----
AROB_STRS7            KVGVHFK-GLTNMIGSIYPPNQIIVSAKFLDTLSEREFACGISEMIKIGFIHDRKL----
AROB_PYRFU            KTGINFYG--KNIIGTFYLPKFVLICRDFLKTLPMVEILNGLAEVVKYGI-LDKEV----
AROB_PYRAB            KTGVNFHG--KNMIGTFYLPNFVLISTETLSTLPRIELLNGMAEVIKYAI-LDKNV----
AROB_THEKO            KTGVNFNG--KNMIGTFYLPNFVLIAHETLSTLPEEEIRNGLGEVAKYAL-LDRKV----
AROB_SULTO            KTGVNFENV-KNVLGTFYQPTMIISDLNFLETLPLEEIKKGLAEVIKYGLVLDKDL----
AROB_SULAC            KNGVNFGRI-KNIIGTFYQPRAIIADLRFLISLPSEEVRKGLAEVIKYGLVLDKEL----
AROB_SACS2            KNGVNFNNI-KNLIGTFYQPSMIISDLEFLETLPIEELKKGLAEVIKYGLTLDKEL----
E0SS73_IGNAA          KNGVNLGDM-KNALGTFYQPSIIVSDLEFLDTLPDEEMVNGMAEVIKYAVVMDREL----
A8MCY5_CALMQ          KTGVNAAGL-KNIIGVVKQPSEIIVDLAFIKSLPASNYLDGFAEVLKYGVTMDKGL----
AROB_PYRNV            KGAVDWGPV-KNLIGVFYQPAAILCDLSWLGTLPERVYRSAFAEVVKYGLALDGDF----
AROB_PYRIL            KGAVDWGPV-KNLVGVFYQPAAILCDLSWLETLPERVYRSAFAEVVKYGLALDGDF----
AROB_PYRAE            KGAVDWGLV-KNLVGVFYQPKAILCDLEWLRSLPPRVYRSAFAEVVKYGLALDEEF----
AROB_PYRCJ            KGAVDVGPV-KNLVGVFYQPRAILCDLEWLQSLPDRVYRSALAEVVKYGVALDADF----
G4RLC8_THETK          KGAVDWGYV-KNLIGVIYQPDLIISDLRFVSSTPENVYRSAFAEVVKYGVVLDRGL----
A8A8F0_IGNH4          KTAVNFEGF-KNVLGSFYHPWLVVDDLRFLDTLPDRVFKSSMAEAIKYGITLNPEF----
G0EHA3_PYRF1          KVAVNHAGL-KNLLGTFYQPRAVIEDVSLLATLPKLEVLSGLGEIVKYAYTLSAEL----
AROB_STRAW            KTGINTA-EGKNLVGAFHPPAGVLCDLAALDSLPVNDYVSGLAEIIKAGFIADPAI----
AROB_STRCO            KTGINTA-EGKNLVGSFHPPAGVLCDLAALDSLPVNDYVSGLAEVIKAGFIADPAI----
AROB_THEFY            KTGINTA-EGKNLVGAFHPPAGVVCDLDTLPSLPREDYIGGLAEVIKAGFIADPVI----
AROB_ARTS2            KTGINTA-EGKNLVGAFHPPAAVLADLDTLSTLPKNELISGMAEVIKCGFIADPAI----
AROB_LEIXX            KTGINTA-EGKNLVGAFYAPAAVVCDLDMLISLGRNELLAGFAEVVKYGFIAEPEI----
AROB_MYCTU            KTGINTD-AGKNLVGAFHQPLAVLVDLATLQTLPRDEMICGMAEVVKAGFIADPVI----
AROB_MYCLE            KTGINTE-AGKNLVGAFHQPLAVLADLATLETLPRKEIASGMAEVVKAGFIADPII----
AROB_SACEN            KAGINTD-AGKNLVGVFHEPSAVLVDLATLEGLPRNELVAGMAEVVKAGFIADPEI----
C6W902_ACTMD          KTGINTD-AGKNLVGTFYEPTAVLADLTTLETLPRNELVAGMAEVVKGGFIADPAI----
AROB_CORGL            KTGINTA-AGKNLVGAFHEPDAVFIDTDRLATLPDAEIIAGSAEIIKTGFIADPEI----
AROB_COREF            KTGINTA-AGKNLVGAFHEPDAVFIDLDRLHTLPDEEIIAGSAEIIKTGFIADEEI----
AROB_CORP2            KTGINTS-AGKNLVGAFHEPSGVFIDLDMIATLPDREKISGSAEIIKTGFIADTKI----
AROB_CUTAK            KTGVNIP-AGKNLVGAFHEPIGVLCDTELLTTLPAREVRSGLAEIVKCGFIKDPVI----
AROB_TROWT            KTGINLK-EGKNLVGSFYSPYIVLCDPSMLTTLNEEHLKSGLAEIIKCGFIQDESI----
AROB_TROW8            KTGINLK-EGKNLVGSFYSPYIVLCDPSMLTTLNEEHLKSGLAEIIKCGFIQDESI----
AROB_DEIGD            KTGVNLP-EGKNLVGAFWPPRAVWCDTETLATLPHPVFAEGAAEAYKHGLIADPTL----
F0RLU4_DEIPM          KTGVNLP-EGKNLVGAFWPAQAVWCDTETLDTLPPRDFRSGAAEVFKHGLLARPEL----
L0A5T3_DEIPD          KTGLNLP-EGKNLVGAFWNPRGVWCDVDTLESLPEHIFREGASEVFKHGLLTSGAL----
P83703_THETH          KTGINLP-EGKNLVGAFHFPQGVYAELRALKTLPLPTFKEGLVEAFKHGLIAGDEA----
AROB_THEVO            KNGLDFS-DVKNVIGTFYNPYMVIDDTVFLKNNS-FIIREGMSEVIKYAIISGGDM----
                      * . .     .*  * .  .         .          .  *  *             

AROB_BACSU            -AFLEELLNI-HSLRDIT---------NDQLNDMIFKGISIKASVVQQDEKEE------G
AROB_BACP2            -DFLKELMSI-RSLDECS---------KSELAHMLYQGIEVKASIVQKDEREQ------G
AROB_OCEIH            -KMFLSLLD--HSLASIK---------PHQLEIYLKAGIQVKSRIVEQDEKEA------N
AROB_BACAN            -KLYHWLKEEVQTLADLR---------DEKLIHILMKAIPVKANIVAQDETEK------G
AROB_BACCR            -ELYHWLKEEVQTLADLH---------DEKLIHILTKAIPVKANVVSQDETEK------G
AROB_LISMO            -TLLRALMDTFTEPKDFY---------TKDLTPFLQRGIEIKANIVAQDETEQ------G
AROB_STAEQ            KSTKNIESNFTSNKVLQA---------LKNLDYYLFEGIKTKLNIVVEDEKEK------G
AROB_STAS1            TSVNNIEAQYPNEQALAS---------LKDIEYFLYKGIETKLNIIVQDEKES------N
AROB_STACT            EAQLEIETAFPDKKALES---------LVSLDKFLLKGIQTKLNIVIEDEHEQ------G
AROB_MACCJ            ETVLEIMHDVKDEVCLSE---------LHAIDKWITFGIQTKMKVVHDDEFES------G
AROB_EXIS2            TFA---EELIGLGLSDIK---------QLPLADWISAGIQVKQHIVEQDERET------G
AROB_EXISA            VLESSFEDDLFLDLNENE---------PLDWVSWLARGIRVKQAIVETDEREQ------G
AROB_PELPD            YELLERDS---GRILEMD---------ADCLERIVLRCCELKARVVEQDEKE------SG
AROB_GEOSL            FAFLEQNV---SALLGRD---------RQTLVRAITRCCALKAWVVEQDERE------TG
AROB_PELTS            FAWLEQNI---EALLNGE---------AGALAYAVRESCRIKAQVVEQDETE------QG
AROB_THEP3            FEYIESNI---YEILDLE---------EDKLRHIIKKSCEIKGKIVSLDEKE------EN
AROB_HUNT2            YEYIDYNV---HKILNHD---------EAVLQYIAKRNCSIKASVVEKDEKE------GG
AROB_PELUB            FYFLNKNG---KKIIQLK---------SPFIQTAIHQSCLIKKKVVEADEKE------LG
A0A1V6INJ9_9EURY      FGYLESNI---DRIINLE---------NGYIDHAIISALKVKANVVETDEKE------SG
F8C417_THEGP          FSFLSKKG---KELYNLN---------SQDLEYIIFESTSAKAYVVSKDEKE------KD
F8AD96_THEID          FEYLEERS---QKLLNYD---------AESLEHIIYESCRLKAEVVSRDEKE------GG
AROB_LEPIN            WEKVKTHS---FKDLNVD---------STILPYLIAESVRFKANVVSSDEKE------TG
AROB_UNCTG            YSYL-SDT---LENGTVP---------PKDFEYIIYQSCSYKARVVEKDEKEI-----TG
AROB_STRGC            WDELSEMD---GSPESIL---------E-HAESIIYHSCDVKRKIVIEDELD------NG
AROB_STRT2            WQLLDNID---GSVHSIL---------E-NSETIIYRSCNVKRKIVVEDEFE------GG
AROB_CLOK5            LNLLDSCK---DK-DEVL---------Q-YIEDIIYKCCSIKKHLVEKDERD------LG
AROB_LEUCK            FDLTGRIY---GV-TDIR---------D-NAEELSTRAVAYKAQVVMADEKE------AG
AROB_LEUMM            FDFTGQIK---SV-ADIR---------H-HAQELSKRAIAYKASVVMADEKE------AG
AROB_DEHM1            FKQLETNTPAIK---DRS---------PEIMEDIISQTAAIKAGIVCQDETDR------G
AROB_ALKOO            LLDLDQHHRAYL---DRT----------RSVDDLILKCIRMKENIVLKDERDS------G
AROB_NATTJ            FLTVKSLFEDCEPLNNVS---------WERYSYLIHKSCEIKADIVSQDEIDT------G
AROB_VIBPA            FDWLEEN---LDRLYTLD---------EDALTYAIARCCQIKAEVVAQDEKE------SG
AROB_VIBVY            FTWLDEH---LDALYSLD---------EQALTYAIARCCEIKAEVVAQDEKE------SG
AROB_ALIF1            FDWLDEN---MDKLYALD---------HDALIYAISRCCQIKADVVAKDEKE------SG
AROB_PSYIN            FIWLEEN---VTAIKTLQ---------PAAITYMIKRCCEIKAEIVSLDEKE------GG
AROB_SHEWM            FSWLENN---VERLKTLD---------DEALAYAIGRCCEIKADVVAEDETE------QG
AROB_SHEDO            FLWLENN---IAALKALD---------TQALTYAIAKCCAIKADIVSQDETE------QG
AROB_SHIDS            FNWLEEH---LDALLRLD---------GPAMAYCIRRCCELKAEVVAADERE------TG
AROB_ECOLI            FNWLEEN---LDALLRLD---------GPAMAYCIRRCCELKAEVVAADERE------TG
AROB_SALTY            FTWLEGN---LDALLRLD---------GPAMAYCIRRCCELKAEVVAADERE------AG
AROB_KLEP7            FSWLENN---IDALLALD---------DTAMAYCIRRCCELKAEVVAADERE------TG
AROB_ERWT9            FSWLEKN---LDALLALD---------GTAMSRCIRRCCELKAEVVAADEHE------HG
AROB_PHOLL            FSWLEDN---MDKLLALD---------NQAMAHCIRRCCELKAEVVAADEKEL-----SG
AROB_HAMD5            FCWLEAN---MDSLLRRD---------VDALSHCISRCCQIKSKIVMEDERDE-----NG
AROB_HAEIN            FEWLEQH---IDELVALH---------PEALQHCISRCCQIKADVVARDETE------KG
AROB_BLOFL            FNWLENN---LDYLLMLN---------PQSLMYCVYRCCELKRSIVIMDEFD------QG
AROB_PSEPK            LAWLEDN---MQALRALD---------SAALTEAIRRSCAAKAAVVGADERE------SG
AROB_PSEU5            LTWLEAN---IDRIRSLD---------SLALTEAIHRSCAAKAKVVNADERE------SG
AROB_METCA            LAWLEAN---VERLLQRD---------PEALAYAIERSCINKAEIVAEDETE------TG
AROB_AROAE            FDWLEAH---IERVLARE---------PEALAFAIERSCANKAEVVAADETE------QG
AROB_THIDA            LAWLEAN---MDRLRALD---------AEAISHAIYRSCEIKAQVVAEDERE------GG
AROB_SACD2            FCWLESN---VKALMARD---------VDALEYAIERSCQIKADVVAQDETE------SG
AROB_TERTT            FEWLETN---MPALLARE---------SEALAYAIEVSCAIKARVVAQDEKE------SG
AROB_HALHL            FDWLEAH---VDALRRRD---------PEALAHAVAESCRNKAEVVAADERE------AG
AROB_CUPNH            FGWIERN---IKPLNACD---------PDLMALAVQRSCEIKAGVVAQDERE------GG
AROB_CUPMC            FAWIEDH---IAGLNACD---------TGLMAEAVRRSCEIKASVVAQDERE------GG
AROB_RALPJ            FAWIEQN---IRGLNDCD---------TDLMTEAVRGSVRIKAAVVAQDERE------TG
AROB_RALSO            FAWIERH---IAGLNACD---------ADLMAGAVRGSVQIKAAVVAQDERE------SG
AROB_BURCJ            FDWIEAN---VEALNRRE---------PAALAHAVKRSCEIKASVVAADERE------GG
AROB_BORPE            WQWCEDN---VGALRALE---------PRALAYAIRRSCELKAQVVGQDERE------SG
AROB_NITEU            FDWLEQH---MNSLLARD---------PAAVNYAIRRSCEIKAEIVSLDERE------SG
AROB_IDILO            FQWLEQH---AKELNQQD---------PAALTYAIQRSCEIKAEVVALDERE------KG
AROB_DICNV            LSWLEQH---MDAVLRKE---------KISLENMIMNCCRYKSEIVCADERE------QG
AROB_RHIME            FEWLEKN---WQAVF-AG---------GPARIEAIAVSCQAKADVVAADEREN------G
AROB_RHIEC            FTWLEAN---WRSVF-TG---------GSARIEAIAASCQAKADVVVADEREN------G
AROB_BRADU            FTWLEKN---HSDIF-KG---------GSAREHAIATSCRAKAGIVSRDERET------G
AROB_RHOPB            FAWLEAN---HAEIV-RG---------GSAREHAIATSCRAKAAIVARDERET------G
AROB_RHOS4            YEWLEEA---GPRLA-AD---------AEARQRAVRRSVEMKAEIVARDETEE------G
AROB_JANSC            FEWLEAN---GPAMAKGD---------PALRQEAVRRSVQMKADIVARDETEQ------G
AROB_PARDP            FEWLEAN---AAGLA-SD---------PALRQRAVRHSVEMKAGIVQRDETEQ------G
AROB_RHORT            FDWLEEH---GSALIAGD---------GGARIHAVLTACRAKARVVAEDEREG------G
AROB_CAUVC            FEWLETN---VQAVLDRD---------VDALVRAVGRSVEMKAEIVAEDEKEA------G
AROB_CAUSK            FEWLEAN---VHAVLERD---------TAALVKAVGRSVEMKAQIVAEDEREV------G
AROB_HYPNA            FDWLAVN---GQKVLALE---------PEAARYAVARSCAAKAAIVAEDETET------G
AROB_ZYMMO            FAWCEEH---GAALIEGD---------KASRLYAIEHSIRAKALIVADDEKEIS-----G
AROB_XANOR            FQWLHAE---RHALLDSD---------PAALAQAIARSCEHKAEIVARDPLE------KG
AROB_OPITP            LELLERA---PLSFVSPE------------LAGVIRQCCALKAAFVQADERELAP---EG
AROB_ACIC5            FSYMERN---AETILAAD---------DAALTRVIAAAVRMKADVVQQDERE------GG
AROB_DICTD            FKFLEKN---VDSILSKD---------VDKLLYVIKESLLCKKYVVEKDEKE------SS
AROB_CHLCH            FDMLEAH---FSEVATLQ---------EPYLTEAVKTSALIKQDVVTRDFREL-----DG
AROB_PELLD            LERLRSH---FSSIVALE---------EPYLTDAIRRSAEIKEAVVREDFREM-----SG
AROB_GLOC7            FSQLEAAK-KLDEFSDLD---------EDLLQTIITRSCQAKADVVSKDEKEA------G
AROB_RIPO1            FEQLEQAK-TLDHLNSLN---------DELLQTIITRSCQAKVDVVSQDEKES------G
AROB_MICAN            FQQLEDSD-NLASFSQID---------GELLQTIITKSCQAKADVVSKDEKEA------G
AROB_NOSP7            FAQLEASK-RLDQLRYVK---------PELIDSILTRSCQAKADVVGKDEKEG------G
AROB_SYNP2            FTKLEAAE-QIDSYATID---------PDLLDLILERSCRAKAEVVSQDERES------G
AROB_THEEB            FHLLSQLP-RLDCMGALP---------SEQFIQVLRRSCQAKVDVVSKDEREA------G
AROB_PROMA            FNKLENEE-DLSNIYSIK---------ECVLLELIKISVSIKARIVEKDEKES------G
AROB_PROMP            FEYLENEK-NRDKILNLE---------NESLIKIINKSIKTKACIVSEDEKEN------G
AROB_HELHP            FILLQEQI-LS----IND---------NDFLTRAIAKSVAIKAQVVNADEKEQ------G
AROB_HELPY            ---LVERL-ET----KDL---------KDCLEEVIFQSVNIKAQVVVQDEKEQ------N
AROB_CAMC5            FEWLENVT-LD----EEQ---------N--LAKLVERSVLIKARVVEADEKER------G
AROB_CAMHC            FEFFENST-LK----SSD---------E--IAKMVQTCVKIKADVVVKDEKET------G
AROB_PARUW            FEFLENSW-SLIE--QRD---------EGLLEIIIQQSCAIKKKYVEADFKDL------G
AROB_STRS7            FQQLLVFP------KDRN---------QEQLRQMIFQAICHKKRVVEKDEFEG------N
AROB_PYRFU            ---YNAIKTMN---SPRE---------IVEREDIIKKSVAVKLRIVEEDLKEN------G
AROB_PYRAB            ---YRLLQDVK---NVEE---------IRNREDIIRESVNVKVRVVEEDLKES------G
AROB_THEKO            ---YALARNFE---GIS--------------ETLIRECALFKVEVVEKDLGES------G
AROB_SULTO            ---YDYLAMNKEKIFAKD---------ESALEEIIYKSSVDKFSVVKADERETK-----G
AROB_SULAC            ---YDFLALNKNSVLSKD---------PESLEYVVQRSIQDKLSVVKEDERETK-----G
AROB_SACS2            ---YDYLSLNKEKILNKD---------KQALEDIIFRSTLDKLSIVKEDERETK-----G
E0SS73_IGNAA          ---YTFLKKSYDRFFNRD---------YDVIEDIVYRSAIDKLSIVKQDPYELK-----G
A8MCY5_CALMQ          ---FDKLSSNVDKVMNRD---------EGLLEDLIYGSLVNKAHVVEADEYDTL-----G
AROB_PYRNV            ---YSWVRENAKALLARD---------GGALEYAVYRSLQLKAGVVEVDEFEER-----G
AROB_PYRIL            ---YSWVRENAKALLARD---------WGALEYAVYRSLQLKAGVVEVDEFEER-----G
AROB_PYRAE            ---YSWLRQSTTALLNRG---------EDALEEAVYRSLKLKASVVEADEFEER-----G
AROB_PYRCJ            ---YQWLAENVDEVLRRG---------ERAVEEVVYRSLKIKASIVEVDEFEER-----G
G4RLC8_THETK          ---FEYLRSHRAELLSRD---------AGALEEVVFRSAQIKSSIVEIDEFETK-----N
A8A8F0_IGNH4          ---LKYLKDNSSKILARD---------DEYVSKVIAESVKTKLEVVRKDPRERK-----G
G0EHA3_PYRF1          ---HDMLVKHGTKVVE-E---------PNLLAEAVSYSVNSKARIVELDEREEY-----G
AROB_STRAW            ---LELIEADPQAARTPA---------GPHTAELIERSIKVKAEVVSGDLKESGL-----
AROB_STRCO            ---LDLIEADPQAARTPA---------GPHTAELIVRSIKVKAEVVSSDLKEAGL-----
AROB_THEFY            ---LDLVEADPEAATRPD---------GAHTRELIERAIAVKAEVVSADLRESGR-----
AROB_ARTS2            ---LDLVEKDPSAVTDPQ---------SAFLRELIERAIAVKADVVSEDLKETGR-----
AROB_LEIXX            ---LDIIERDVDAATDPE---------SAEFRRVVELSIGIKARVVGEDFTEQGL-----
AROB_MYCTU            ---LDLIEADPQAALDPA---------GDVLPELIRRAITVKAEVVAADEKESEL-----
AROB_MYCLE            ---LDLIEADPQASLDPM---------GGVLPELIRRAVTVKAGVVSADEKESEL-----
AROB_SACEN            ---LRLVEADPQGALDPA---------GEVIAELVRRAIQVKADVVASDLRESHL-----
C6W902_ACTMD          ---LDLIEADPAAALDPS---------GDVLAELVRRKIQVKADVVSSDLRESNL-----
AROB_CORGL            ---LRLYETDPAACLKKEVE-------GSHLPELIWRSVTVKGSVVGQDLKESSL-----
AROB_COREF            ---LRLYESDASACLQREID-------GSHLPELIARSVRVKGSVVSADLKESNL-----
AROB_CORP2            ---LSLYEEDPEACFNVE----------GYLPELIARSVAVKARVVASDLREAGQ-----
AROB_CUTAK            ---LDVISNHPRLALDVT---------SQTFVEVLTRAITVKAGVVSADLHERTSSREEV
AROB_TROWT            ---LSILEHNAQDHMDCSQRVCAETLPPKLLEELIHKAVSVKITMVDSDFRDTHK-----
AROB_TROW8            ---LSILEHNAQDHMDCSQRVCAETLPPKLLEELIHKAVSVKITMVDSDFRDTHK-----
AROB_DEIGD            ---LPRILSPDFRPGGPG------------LEDTLADAIAVKAGVVTRDLTEQGE-----
F0RLU4_DEIPM          ---LAQVLPSTLSAAGLTRF-------SEWLPQLVRSAVEVKAEVVARDPTEQNE-----
L0A5T3_DEIPD          ---CEQVLAPGFGASASN------------LAEVVADAVQVKVDVVVRDPTEQGE-----
P83703_THETH          ---LLKV--EDLTPQSPR------------LEAFLARAVAVKVRVTEEDPLEKGK-----
AROB_THEVO            -----YDTLNRCSIDNFD----------ACATNIIKLSVKIKSEIVNRDFYDRT-----G
                                                               *      *  :        

AROB_BACSU            IRAYLNFGHTLGHAVEAEYGYGQ-----ITHGDAVALGMQFALYISEKTV--GCEMDRKR
AROB_BACP2            VRAFLNLGHTLGHAIEAEYGYGV-----ITHGDAIAIGMQFALYVSEKKL--GLSLHRTE
AROB_OCEIH            IRKFLNLGHTLGHALETIHGYGN-----ITHGEAVANGLLFALHVSEYEF--EIQLPFYQ
AROB_BACAN            VRAHLNFGHTLGHALEKELGYGN-----ITHGDGVAVGMLFAIFLSEQVY--KVNLAYEE
AROB_BACCR            VRAHLNFGHTLGHALEKELGYGN-----ITHGDGVAVGMLFAIFLSEQVY--KVDLAYED
AROB_LISMO            VRAYLNFGHTFGHALEAYGNFGK-----WLHGEAITYGMIYALTMSETIY--GLDFDLAE
AROB_STAEQ            KRKFLNLGHTFGHAIEYEHK--------IPHGHAVMIGILYQFIVANHLF--ETNYNIQH
AROB_STAS1            VRKYLNLGHTFGHAVEYQFK--------IPHGHAVMIGIIYQFIVSNIIL--NTHYDISH
AROB_STACT            KRKFLNLGHTFGHAIEYNQK--------IPHGHAVMIGILYQFIVANELL--NTQFDIMH
AROB_MACCJ            VRKFLNFGHTFGHAIEFHHK--------LPHGIAVMHGMIYALLLSDV-----TESDIMS
AROB_EXIS2            IRAFLNYGHTFGHAVEYASE--D-----LSHGEAVGIGLVFVSILEGN------EYQTNR
AROB_EXISA            IRAWLNFGHTFGHALESVEAY-R-----IPHGEAVLHGMVFAFLVSGD------EVRAMR
AROB_PELPD            LRAILNYGHTLGHAIETLAGYGT-----LVHGEAVAIGMVLAARISLAGG-YCSEGDVSR
AROB_GEOSL            LRAVLNYGHTFGHAVEALTGYTA-----VLHGEAVAIGMVRAAVLAEARG-HSSAGDTRR
AROB_PELTS            LRAVLNYGHTVGHAVEALTHYRV-----YTHGEAVGIGMAVEAGLAVALG-MLKRSEGGR
AROB_THEP3            LRSILNFGHTIGHAIEALTGYER-----YIHGEAVAIGMVYACKLALNLG-YIDEKYFER
AROB_HUNT2            LRAILNFGHTIGHAIETVMNFE------LLHGECVSLGMVGAMRMALYLE-MIDEQSVNR
AROB_PELUB            IRKILNFGHTFAHAFEATLRYSAK----LNHGEAVILGVKTAARFSLLNK-ILNKKEFEL
A0A1V6INJ9_9EURY      QRKILNFGHTIGHAIEILSNFD------ISHGRAVGIGMAVETLISHRLG-ILTSDEKEQ
F8C417_THEGP          LRRILNFGHTIGHAIETELNYS------IPHGLAVAVGMVIEAKISEILG-IAEESVSEP
F8AD96_THEID          LRRILNFGHTLGHAIEAAANYE------ILHGFCVSIGMVAAAILSERLG-VAEEEISLR
AROB_LEPIN            LRKILNLGHTTAHAIESVTKYKK-----YSHGEAVAIGLVTALLLSEQHS-ELDPVTTKE
AROB_UNCTG            LRAVLNFGHTFAHALETATKYKK-----FLHGEAVAVGMLFAVKLSLKLR-ICKPETYKE
AROB_STRGC            VRLYLNFGHTIGHAIEATAGYGQ-----VMHGEAVAIGMVQVSRVAEKQG-LMPAGITED
AROB_STRT2            VRMYLNFGHTIGHAVEQTAGYGK-----VMHGEAVAIGMVQISRVAEKKK-LMPQGITRQ
AROB_CLOK5            ERMMLNFGHTLAHGIEKYYNYGK-----YSHGEAVAIGMTYMTNITERMD-ITKKGTHDY
AROB_LEUCK            QRQFLNFGHTIGHAIELLA-HGE-----LRHGEAVAIGMIAMSSRMTRDG-LTPASLTAA
AROB_LEUMM            DRQFLNFGHTFGHAIELLA-HGE-----LRHGEAVAIGMIAISSRFEQHG-IMPRGLTTE
AROB_DEHM1            IRNILNFGHTLGHALESTSSFSQ------SHGAAVAIGMCFASRLSVKLG-LCENETVLR
AROB_ALKOO            MRQVLNLGHTFAHGLESSTNFQKF-----LHGEAVALGLIFASNLSLKLK-FIAEEYHQF
AROB_NATTJ            IRMLLNLGHTFAHALEGATSYNYF-----KHGEAVMWGLAMSAELSYKLN-KLTYKDYQA
AROB_VIBPA            IRALLNLGHTFGHAIEAELGYGN-----WLHGEAVSSGTVMAAKTSLLRG-LISEEQFER
AROB_VIBVY            IRALLNLGHTFGHAIEAELGYGN-----WLHGEAVAAGTVMAARTAQLQG-MIDQQQFDK
AROB_ALIF1            MRALLNLGHTFGHAIEAEMGYGN-----WLHGEAVSAGTVMAAVTAQKEG-LISQSDVER
AROB_PSYIN            IRALLNLGHTFGHAIEAEQGYGN-----WLHGEAVASGMVLAAKTALNLG-LIESAQIEQ
AROB_SHEWM            VRALLNLGHTFGHAIEAEMGYGV-----WLHGEAVAAGTVLAASTASRMG-LIDGSIVCR
AROB_SHEDO            VRALLNLGHTFGHAIEAQMGYGN-----WLHGQAVAAGSVLAAKTALALG-LLDALSVQR
AROB_SHIDS            LRALLNLGHTFGHAIEAEMGYGN-----WLHGEAVAAGMVMAARTSERLG-QFSSAETQR
AROB_ECOLI            LRALLNLGHTFGHAIEAEMGYGN-----WLHGEAVAAGMVMAARTSERLG-QFSSAETQR
AROB_SALTY            LRALLNLGHTFGHAIEAEMGYGN-----WLHGEAVAAGIVMAARASERLG-QFSSADTQR
AROB_KLEP7            LRALLNLGHTFGHAIEAEMGYGN-----WLHGEAVAAGMVMAARTSERLG-QFRAQDTQR
AROB_ERWT9            LRALLNLGHTYGHAIEAHMGYGN-----WLHGEAVAAGMVMAARTAERLG-QFNPQDTDR
AROB_PHOLL            LRALLNLGHTFGHAIETEMGYGV-----WLHGEAVSAGMVMAARTAQLID-NFSEQDTQR
AROB_HAMD5            LRALLNLGHTYAHAIETETNYIF-----YLHGEAVSIGMLMAAQTAQKLG-LFSKTDIIR
AROB_HAEIN            DRALLNLGHTFGHAIETHLGYGN-----WLHGEAVSTGMMMAAALSEELG-DISIADVSR
AROB_BLOFL            IRSVLNLGHTYGHAIESYLGYSQ-----WSHGEAIAAGLMMAVSTALHIGGLISFHDAIR
AROB_PSEPK            LRATLNLGHTFGHAIETHMGYGV-----WLHGEAVAAGTVMALEMSMRLG-WIDQAERDR
AROB_PSEU5            VRATLNLGHTFGHAIETHMGYGV-----WLHGEAVSAGTVMALEMSSQLG-WIGQADRDR
AROB_METCA            VRATLNLGHTFGHAIETGMGYGV-----CLHGEAVAIGMCQAADLSRRLG-WIGDDEVAR
AROB_AROAE            ERALLNLGHTFGHAIETGMGYGN-----WLHGEAVAAGTMMAAELSRRLG-WLSAADVAR
AROB_THIDA            LRAILNLGHTFGHAIETGMGYGA-----WLHGEAVAAGMVLAAETSQRLG-WLGEADVAR
AROB_SACD2            IRAILNLGHTFGHAIESDQGYGN-----WLHGEAVGAGMVMACELSCRMG-WIDKPFCER
AROB_TERTT            IRAILNLGHTFGHAIESHQGYGD-----WVHGEAVGAGMVLACELSSRLG-WLDAKECDR
AROB_HALHL            ERALLNLGHTFGHAIETYTDYCT-----WLHGEAVAAGMVMAARMSVRLG-WLQRNGLER
AROB_CUPNH            LRAILNFGHTFGHAIEAGMGYGA-----WLHGEAVGCGMVMAADLSHRLG-FIDTETRAR
AROB_CUPMC            LRAILNFGHTFGHAIEAGMGYGE-----WLHGEAVGCGMVMAADLSHRLG-FIDVETRAR
AROB_RALPJ            LRATLNFGHTFGHAIEAGLGYGE-----WLHGEAVGCGMVMAADLSHRLG-FIDIDTRNR
AROB_RALSO            LRAILNFGHTFGHAIEAGLGYGE-----WLHGEAVGCGMAMAADLSHRLG-FIDIDTRNR
AROB_BURCJ            LRAILNFGHTFGHAIEAGLGYGE-----WLHGEAVGCGMVMAGDLSVRLG-LLDEASRQR
AROB_BORPE            LRAILNLGHTFGHAIESGLGYGE-----WLHGEAVGCGMVQAAELSTLAA-GFPAADVQR
AROB_NITEU            LRALLNLGHTFGHAIENAMGYGA-----WLHGEAVAAGTLMAADLSRRLQ-RITSQEVDR
AROB_IDILO            LRALLNLGHTFGHAIEAATEYGA-----WTHGEAVAAGIIIASKLSEVTQ-RLNSSDFRR
AROB_DICNV            MRALLNFGHTFGHALETITAYRH-----WLHGEAVAIGMRMAAELSEMRG-LISADEKAR
AROB_RHIME            RRALLNLGHTFGHALEAATDYDSKR---LVHGEGVAIGMVLAHEFSARMN-LASPDDARR
AROB_RHIEC            QRALLNLGHTFGHALEAATAYDSRR---LVHGEGVSIGMVLAHEFSARMN-LASPDDARR
AROB_BRADU            ERALLNLGHTFGHALEAATGF-SDR---LFHGEGVAIGMTLAAQFSAKLG-MIGEADAAR
AROB_RHOPB            ERALLNLGHTFGHALEAATGF-SER---LFHGEGVAVGMVLAAQFSAERG-MLSNDAAAR
AROB_RHOS4            DRALLNLGHTFCHALEKATGY-SGR---LLHGEGVAIGCALAFELSQRLG-LCAQEAPSR
AROB_JANSC            DRALLNLGHTFCHALEAATGY-SDR---LLHGEGVAIGCALAFELSARLG-LCSQEDPSR
AROB_PARDP            ERALLNLGHTFGHALESATGY-SDR---LLHGEGVAIGCALAFELSAKMG-LCSQEAPSR
AROB_RHORT            RRALLNLGHTFGHALEAETGF-GPT---LLHGEAVALGMVMALDLSVRLG-LCPPADAAR
AROB_CAUVC            RRALLNLGHTFGHAIEAEMGF-GEA---LKHGEAVGVGMAQAFRFSARLG-LCPSQDAVR
AROB_CAUSK            RRALLNLGHTFGHAVEGEMGF-GDA---LKHGEAVGLGMAQAFRFSVRQG-LCSAQDAAR
AROB_HYPNA            VRQLLNLGHTFGHAFEAANEY-REN---LLHGEAVALGMALAFRYGAASG-ITPAADAAR
AROB_ZYMMO            KRALLNLGHTFGHALEADTGF-SDK---LFHGEAVAAGSALAFGFSYVKN-LASKEDIQR
AROB_XANOR            ERALLNLGHTFGHAIETEQGYGAPGNDNLNHGEAVAVGMVLAARLSATLG-MSDAQDTEA
AROB_OPITP            GRALLNLGHTFGHAIEQVTGYGV-----YLHGEAVAIGMCAAARLSAKLG-HLGGADVAR
AROB_ACIC5            LRMILNYGHTLGHAIETVTHYRG-----LLHGEAVGWGMLAATELSRMRG-LLTAAQSER
AROB_DICTD            LRMILNFGHTFGHAIEAKGGYRR-----FLHGEAVAIGMLLATYLGYKLG-FCNYEVLER
AROB_CHLCH            LRATLNFGHTFAHGLEKLADYRH-----LRHGEAVTMGLVCALYLSHRLG-FLDAPSLER
AROB_PELLD            LRATLNFGHTFAHGLEKLADYRF-----IRHGEAVTIGMAAALSLSRRLG-FLDRPSLEQ
AROB_GLOC7            LRAILNYGHTIGHGIESLTGYS-----QIIHGEGVAIGMVAAGTIAVKLQ-LWSEQEANR
AROB_RIPO1            LRAILNYGHTIGHAIESLTGYE-----TINHGEAVAMGMVAAGKIAIKLS-LWTQEETIR
AROB_MICAN            LRAILNYGHTIAHGIESLTGYT-----SVNHGEAVALGMVAAGAIAVKLG-MWTAGENQR
AROB_NOSP7            LRAILNYGHTIGHAVESLTGYR-----LVNHGEAVAIGMVAAGQIAVELG-MWQKEDTER
AROB_SYNP2            LRAILNYGHTLGHAVESLTHYE-----TFVHGEGVAIGMALAGAIATRMN-LWTTAETQR
AROB_THEEB            LRAILNYGHTIGHALESIGNYR-----LLNHGEAVAIGMIAAGELAVALG-YWSAEAAAA
AROB_PROMA            LRAILNYGHTFGHVIETLCGYG-----HWLHGEAVSMGMVLIGQLALRKN-LWNVDDALR
AROB_PROMP            IRAILNYGHSFGHVIENLCGYG-----EYLHGEAISIGMKIAGDIATEKN-LWSKEHSLR
AROB_HELHP            IRAALNYGHTFGHIIENLTQYS-----QFLHGEAVSIGMCMANALSCKLG-LLTKEQKDA
AROB_HELPY            IRAGLNYGHTFGHAIEKETDYE-----RFLHGEAIAIGMRMANDLALSLG-MLTLKEYER
AROB_CAMC5            LRALLNYGHTFAHVIENETGYK-----KYLHGEAVAIGMNMANSLSVKLG-LMSEKDALR
AROB_CAMHC            IRAVLNYGHTFAHVIERITDYK-----EFLHGEAVSIGINMANNLALRLG-FLSKNEVFK
AROB_PARUW            IRAQLNYGHTFGHVIEMMSRY------QYLHGEAVSIGMSCAAYLSCQMG-LTTQETMQR
AROB_STRS7            LRMSLNFGHTLGHAIEALCHHEL-----YRHGEAIAIGMVFEAKLAVQQQ-LLSQQDLEA
AROB_PYRFU            KRRVLNLGHTVGHAIEKISD------YKIKHGFAVSMGLVVEAKIGEILY-GFD---SGK
AROB_PYRAB            KRRILNLGHTVGHAIEKLSG------YKIKHGFAVSVGLIAAAKLGEKLY-NFD---SGK
AROB_THEKO            LRRILNLGHTAGHAIEKLSN------YRIKHGLAVSMGLMVASKVGEELY-GFD---SGK
AROB_SULTO            IRIVLNFGHTIGHAIEAGSN------FTVPHGYAISVGMVCEAKMAEEVG-YAEEGVVED
AROB_SULAC            VRIVLNFGHTIGHAIEAGSG------FSIPHGYAISVGMVCEAKIAEEMG-YSEEGVVED
AROB_SACS2            IRIVLNFGHTIGHAIEAGSS------FNVPHGYAISVGMVCEAKMAEELG-YAEEGVVED
E0SS73_IGNAA          IRSVLNFGHTIGHAIEVSTK------FSISHGKAVAIGMVCESMLGIELG-VSPKDILEE
A8MCY5_CALMQ          IRIVLNYGHTIGHALESASG------FSISHGKAVGLGMICESTIGVKLG-YTNPDIPGY
AROB_PYRNV            VRQVLNVGHTVGHAVERV--------LGLLHGEAVAVGMVAELRLSSELG-YLRESHVAE
AROB_PYRIL            IRQVLNVGHTVGHAVERV--------LGLLHGEAVAVGIVAELRLSSELG-YLRESHVAE
AROB_PYRAE            IRQVLNVGHTVGHALERV--------LGLLHGEAVSLGIAAELRLSAELG-YLREKYVEE
AROB_PYRCJ            IRQVLNVGHTVGHAVERV--------FGLLHGEAVSVGIVAELKMAEELG-YLTRGTSEE
G4RLC8_THETK          IRQVLNFGHTVGHALERV--------LNLLHGEAVSLGMIAEGKMAVEMG-YFKESHLGQ
A8A8F0_IGNH4          VREVLNFGHTVGHALESASK------FELLHGEAVALGMVVETLYAERVG-ACS-SCYEA
G0EHA3_PYRF1          LREILNFGHTFGHALEEAAK------GEVKHGIAVAWGCVVESWAGVHLG-FTPRWVAEE
AROB_STRAW            -REILNYGHTLAHAIEKNERYKW------RHGAAVSVGMHFAAELGRLAG-RLDDATADR
AROB_STRCO            -REILNYGHTLGHAIEKNERYKW------RHGAAVSVGMHFAAELGRLAG-RLDDATADR
AROB_THEFY            -REILNYGHTLGHAIERAENYTF------RHGYAISIGMVFAAELARLDG-RIDAALVAR
AROB_ARTS2            -REILNYGHTLGHAIELVERYSW------RHGAAVSVGMMFAAELARSVG-RLSDADADR
AROB_LEIXX            -REILNYGHTLGHAIEHAERYQW------RHGAAIAVGMVFAAELGRLSG-RLSDDAVER
AROB_MYCTU            -REILNYGHTLGHAIERRERYRW------RHGAAVSVGLVFAAELARLAG-RLDDATAQR
AROB_MYCLE            -REILNYGHTLAHAIERRERYEW------RHGAAVSVGLVFAAELARVAG-RLDDATAQR
AROB_SACEN            -REVLNYGHTLAHAIERRERYRW------RHGAAVSVGLVFAAELARLAG-RLDDETADR
C6W902_ACTMD          -REILNYGHTLGHALERRERYRW------RHGAAISVGLVFAAELARLAG-RLDDATADR
AROB_CORGL            -REILNYGHTFAHAVELRENFRW------RHGNAVAVGMMFIANLSHKLG-LIDAPLLER
AROB_COREF            -REILNYGHTFAHAVELREDFQW------RHGNAVAVGMMFIANLSYNLG-LIDADLLER
AROB_CORP2            -REILNYGHTFGHAVELKEKYEW------RHGNAVSVGMMFVAALARNRG-LITDELYLR
AROB_CUTAK            GRERLNYGHTLAHAIEAHKHFTW------RHGEADAVGMVFAAELSHRYL-GLSDEVVAR
AROB_TROWT            -RQFLNYGHTLAHALEAATSHKL------PHGQAVSIGMVYAAQVAFAKG-LIGRNILTR
AROB_TROW8            -RQFLNYGHTLAHALEAATSHKL------SHGQAVSIGMVYAAQVAFAKG-LIGRNILTR
AROB_DEIGD            -RAFLNFGHTLAHALEAATDHTV------PHGEAVGYGMHYAALLSRALG---GADLTGH
F0RLU4_DEIPM          -RAFLNLGHTLAHALEALTRHRL------PHGEAVGYGLHFAALLSEAQG---ATNLSPH
L0A5T3_DEIPD          -RAFLNFGHTLAHALEAVTRHAL------SHGEAVGYGMHFAALLSRAQG---GEDLTPL
P83703_THETH          -RRLLNLGHTLGHALEAQTRHAL------PHGMAVAYGLLYAALLGRALG---GEDLLPP
AROB_THEVO            IRSVLNLGHTIAHGIEGATKGSI------SHGKAVATGMLVEAHIGEKYG-NTNHEVIEA
                       *  ** **:  * .*              **     *                      

AROB_BACSU            LVSWLKSLGYPSQIRKETETS--------VLLNRMMNDKKTRGGK---------------
AROB_BACP2            LKEWMKKLGFPVQVTQDISTK--------TFVDRMIGDKKARGGT---------------
AROB_OCEIH            LYQWLKDNEYPILSFSEEEIT--------QLIELMKTDKKSVGGT---------------
AROB_BACAN            MKQWFLNYGYPKMPS-DLSVE--------RLVGLMKQDKKANAGT---------------
AROB_BACCR            MKQWFLKYGYPKMPG-DLNVE--------RIVQLMKQDKKANAGA---------------
AROB_LISMO            FKTWLEQLGYDTTFDASVPFS--------KILENMRHDKKTTFNE---------------
AROB_STAEQ            YINYMKKLKYPLSIIKQLHFE--------DTYHFMLLDKKNDYNG---------------
AROB_STAS1            YIQYLKSLNYPLEVIQSFEFN--------SLYGLMLKDKKNDQQG---------------
AROB_STACT            YINYFKNLDYPLEKVLDTNFE--------PLLALMSKDKKNDKSG---------------
AROB_MACCJ            LMRWMHRLG--LKKLVYDNFD--------IYYELMRQDKKNEANE---------------
AROB_EXIS2            LVELIHRLG--VVLPERQPFE--------RYLELMKRDKKN-DVS---------------
AROB_EXISA            LFDWMRSND--VTPIDWQPFD--------RYVEKMIRDKKNRHGA---------------
AROB_PELPD            IVALLGRFGLP---CIPPR------IDQGRLAETLLTDKKSRSGI---------------
AROB_GEOSL            IRALVEALGLP---TELPS------FDADSYRDVLLRDKKARDRG---------------
AROB_PELTS            IIRLIRQAGLP---EGLPEG-----LPPEKTVEKFYHDKKAVEGQ---------------
AROB_THEP3            IFSLIQRTGLP---TDYED------LHKEDIVEAIKLDKKSREAK---------------
AROB_HUNT2            VKNTLDKIGLP---TRLEG------IDVDKVYNQMFYDKKIKGSK---------------
AROB_PELUB            IDGHLNDLNLPRDINKFFSI-----KNLNTIISFMRKDKKNNTKK---------------
A0A1V6INJ9_9EURY      IIAFLKKSKLLEKYPKLSSD-----EIIKKTIS----DKKSRKGI---------------
F8C417_THEGP          LIKLLKSLDMPYEISHLSSN-----LDPSKLISHFSKDKKVWKGK---------------
F8AD96_THEID          LIKLLEDLGLP---TRIPQD-----LDTDEILSFLRADKKVWKGK---------------
AROB_LEPIN            TIESLKNYGLP-----FQTK-----LKSKQLAKHMLHDKKNVGGS---------------
AROB_UNCTG            VENLLQKADFT-----LSTK-----NNARQMLSLMKKDKKSIDGN---------------
AROB_STRGC            IIHMCQKFGLP----VDYQP-----WNENALYQALTHDKKARGNS---------------
AROB_STRT2            IAEMCVKFGLP----VDYEP-----WRVEELYTALTHDKKARGNS---------------
AROB_CLOK5            MKGILTKYGLP----VNMPD-----MDKQALVNSIALDKKSSGDR---------------
AROB_LEUCK            LRARLETVDLP----TTSDL-----IGTPAFFKHMVNDKKNRGGR---------------
AROB_LEUMM            LLSRLEAVGLP----THSHF-----IGTTDFFNHLINDKKNHDGI---------------
AROB_DEHM1            LEKLIADFGLPTRPQDIDPE--------KIIDAMHHD-KKVSDGR---------------
AROB_ALKOO            VNQLIYKYFSDRYILQLDTE--------GIVEAMTMD-KKNKEHR---------------
AROB_NATTJ            IAELPELTKVPEVPIQVKDP--------NIIEELLLRDKKKTGEE---------------
AROB_VIBPA            IVALLRRAKLPVHTPDSMSF--------DDFIKHMMRDKKVLSGQ---------------
AROB_VIBVY            IFSILSRAKLPVHTPESMTF--------DDFMTHMMRDKKVLSGK---------------
AROB_ALIF1            ICSILEKAKLPLKAPKEMTV--------DAFMKHMMRDKKVLSGK---------------
AROB_PSYIN            IILLIKQFDLPVNAPENMHY--------DQFFDHMQLDKKVLDGK---------------
AROB_SHEWM            ITKLFEAFDLPVSPPDSMNF--------EQFIKHMRRDKKVLKGQ---------------
AROB_SHEDO            IENLFRAFDLPIDGPQSMAF--------SDYMRHMRRDKKVLASK---------------
AROB_SHIDS            IITLLKRAGLPVNGPREMSA--------QAYLPHMLRDKKVLAGE---------------
AROB_ECOLI            IITLLKRAGLPVNGPREMSA--------QAYLPHMLRDKKVLAGE---------------
AROB_SALTY            IIALLERAGLPVNGPCEMSA--------QDYLPHMLRDKKVLAGE---------------
AROB_KLEP7            IIDLLKRAGLPVRGPQEMSA--------QAYLPHMMRDKKVLAGE---------------
AROB_ERWT9            IISLLQRAGLPVKGPESMTA--------EEYLPHMMRDKKVLAGE---------------
AROB_PHOLL            IIRLLERANLPVHGPQNMPP--------EAYLPHMMRDKKVIAGK---------------
AROB_HAMD5            IKKLLLRAKLPIQGFHQIDP--------KSCLLHMMHDKKVMNDK---------------
AROB_HAEIN            LEKLLARANLPTVSPDTMQP--------EDYLPHMMRDKKVLSGK---------------
AROB_BLOFL            IKLLLKRANLPICGPEEMKP--------QDYIKYMIRDKKSRLGR---------------
AROB_PSEPK            GIRLLQDAGLPVVPPQEMTP--------AHFMEHMAVDKKVLDGR---------------
AROB_PSEU5            AIRLLQRAGLPVVPPAEMQP--------QDFLEHMAVDKKVLDGR---------------
AROB_METCA            VIRLLERARLPVVPPRELDA--------DAFLEHMAVDKKNVDGG---------------
AROB_AROAE            IEALHVRAGLPVLGP-PLPV--------ATYLELMANDKKVEEGR---------------
AROB_THIDA            TRALIRAAGLPDVAP-NLGV--------DAYLEYMGHDKKVEGGK---------------
AROB_SACD2            AVALIAAAGLPIAPPESMSP--------EDFMKYMAVDKKVLDGG---------------
AROB_TERTT            AVALIAAAGLPTEPPSGMSP--------DAFMRYMAIDKKVLDGG---------------
AROB_HALHL            TIALLEAFGLPTRPP-AIPE--------ARFRELMSVDKKNRGGQ---------------
AROB_CUPNH            IRELTQAANLPVVAP-ELGA--------DRYIELMKVDKKAEAGS---------------
AROB_CUPMC            IRTLTQAAMLPVVAP-DLGI--------DRYIELMKVDKKAEAGS---------------
AROB_RALPJ            ITALTCAADLPTVAP-ALGV--------DRFIELMRVDKKAEAGE---------------
AROB_RALSO            VTALTRAANLPVVAP-DLGV--------ARFIDLMRVDKKAEAGE---------------
AROB_BURCJ            LDAVIAAAHLPTRAP-ALGD--------ARYMDLMRVDKKAEAGA---------------
AROB_BORPE            VRDLVREIGCPTVAP-DLGA--------ERWLALMQVDKKTEGGE---------------
AROB_NITEU            IRYLFENTGLPVKGP-RISP--------ERYLESMQLDKKVKEGA---------------
AROB_IDILO            IKDLLLALSLPTKGP-QMPW--------QDWLDYMQRDKKVKDGQ---------------
AROB_DICNV            VISLLQRAHLPTAIDIQLNC--------EDIYQTLFLDKKVRAGQ---------------
AROB_RHIME            VEAHLKTVGLPTRLADIPGA----LPPADRLMEAIAQDKKVKGGK---------------
AROB_RHIEC            VERHLREVGLPTRMSEIAGE----LPPAEVLMEAIAQDKKVKSGK---------------
AROB_BRADU            VERHLIEAGLPTRLQDIAGFSQEGLADADALMALMAQDKKVKRGK---------------
AROB_RHOPB            LSHHLAEVGLPTRLQDIAGFAQEGLADADALMALMAQDKKVKRGR---------------
AROB_RHOS4            LRAHLRAMGMKVDLRDIPGD----LPSAEALLALMAQDKKVVDGK---------------
AROB_JANSC            VRAHLAAMGTRRDLSDIPGD----LPDADALITLMGQDKKVVAGQ---------------
AROB_PARDP            VAAHLAAMGMPARIADIPGD----LPDDEALIGLMAQDKKVQDGR---------------
AROB_RHORT            LRAHLDHVGLPTDPRRLEGAP---AWNAERLLAAMDHDKKVEDGK---------------
AROB_CAUVC            AQAAIKAAGLPTTLADVRPE----PFSADALIAHCGQDKKAQGGK---------------
AROB_CAUSK            AEAAIKAAGLPTKLSDIRPE----PFSADALIAHTAQDKKAQGGT---------------
AROB_HYPNA            VTEVLGASGLPVSLEGFDPA----RFAADRLAALMQQDKKARAGR---------------
AROB_ZYMMO            IIKHLRETGLPASLEEAGVK-----ASGKELVAHMMHDKKMEAGR---------------
AROB_XANOR            LRALLHDFELPTDIPPGLPP--------EALLARMRLDKKNIAGR---------------
AROB_OPITP            VDAVVAAHRLPVKLRTPLVL--------MDLLAAMARDKKVRAGM---------------
AROB_ACIC5            MQRVILAYGPLPRFRAK----------AEALLEATARDKKNRAGT---------------
AROB_DICTD            LKELLMLFGFKIKSPYR----------IEDLMEYIKRDKKAYGGK---------------
AROB_CHLCH            GLRLLQQFVFPKNVVERYFLA----SNSALLLESMFSDKKKLDKK---------------
AROB_PELLD            GQSIIAEFRFPRGLLKKRFLD----IDAPALLENMLSDKKKLDSR---------------
AROB_GLOC7            QDALIKKAGLPTEVPPNVNI--------EAIIEALQTDKKVKAGK---------------
AROB_RIPO1            QDQLIDKVGLISTIPKTLDI--------DQVIESLQSDKKVKSGK---------------
AROB_MICAN            QTDLIEKAALETRMPP-LNA--------DEMVNALTADKKVKDGQ---------------
AROB_NOSP7            QNALIQKTGLPTQLPSGVDI--------EAIIDALQLDKKVKAGK---------------
AROB_SYNP2            QDALIKKAGLPTECPNNLAI--------EAILETLQSDKKVKSGK---------------
AROB_THEEB            QRALILKAKLPTTIPPHFDV--------EGLLALLQHDKKVQAQN---------------
AROB_PROMA            QEKLLTKAGLPISWPK-INN--------EDVLRTLKGDKKVDKGN---------------
AROB_PROMP            QDHLIESYGLPIQTPK-IKK--------NDVMKILMGDKKVRNGK---------------
AROB_HELHP            ISALLERYDLPTHFYI-QNA--------LDFYEKFSLDKKSVNAK---------------
AROB_HELPY            IENLLKKFDLIFHYKI-LDL--------QKFYERLFLDKKSENKT---------------
AROB_CAMC5            IKELLAKFSLPTHYVL-RDE--------SAFYEAFMLDKKTQEGS---------------
AROB_CAMHC            ISETLKKFNLPTTFKI-PNA--------DEFYELFFMDKKTQNSK---------------
AROB_PARUW            QDALCQQAQLPIHLPH-FPL--------TRFTYLMAKDKKGRNGS---------------
AROB_STRS7            LQAAFEAYQLPTTLEAKSMT-------AEALMTVLKTDKKNSGQH---------------
AROB_PYRFU            VVEILTKFGLPVKIPFD----------PYTTLQAMKIDKKAWYGK---------------
AROB_PYRAB            VIELVERFNLPTKLPYP----------PKDIIEAMKLDKKAWYGK---------------
AROB_THEKO            TEELLKKLGLPTGHPFR----------AEEILEEMRLDKKAWYGR---------------
AROB_SULTO            VTWILSQYELPLTVDSLNAKI-----DVKKAIDAITKDKKVRGGY---------------
AROB_SULAC            TVWILSHYNLPISIDELSSKI-----DLKEALFALSKDKKVRNGV---------------
AROB_SACS2            VLWLLQIYGLPYDISQIDAPV-----DLKLALNAINMDKKHRKDV---------------
E0SS73_IGNAA          VIHMLKLYRLPTNVKELGIDI-----DRDLALYAVTRDKKSRGAE---------------
A8MCY5_CALMQ          LTESLSELNLIQSI-----KV-----NADSALRAITGDKKRNGGF---------------
AROB_PYRNV            AAEVLSSLGLPTSVKAT--EQ-----QLAEAAALVKFDKKRRGGH---------------
AROB_PYRIL            AAEVLSSLGLPTSVKAT--EQ-----QLAEAAALVKFDKKRRGGH---------------
AROB_PYRAE            TKSLLKAFELPTEAGLS--SE-----QLAAAKGLIKYDKKRRRDY---------------
AROB_PYRCJ            VATLLTRIGLPTCIRAS--AE-----ELEKAKSLVKFDKKRRGEY---------------
G4RLC8_THETK          LAELLEGFGLPVKTCLS--GD-----SYKRARELVLFDKKRRGDK---------------
A8A8F0_IGNH4          LEGALSAYSLTQVKAPK---M-----TIEEYKAMILKDKKRVGDR---------------
G0EHA3_PYRF1          LESLVRRLGFPQPK-----LP-----EFDILTTLMAKDKKVHGDV---------------
AROB_STRAW            HRTVLESVGLPLHYRYDQWPK---------LLETMKVDKKSRGD----------------
AROB_STRCO            HRSILEAVGLPLHYRYDQWPK---------LVENMKVDKKSRGD----------------
AROB_THEFY            HRRILESVGLPVRYRADAWPA---------LRDTIRVDKKTRGA----------------
AROB_ARTS2            HRTILETLGLPITYRRDRWQG---------LLDGMRRDKKSRGD----------------
AROB_LEIXX            HRRILASLTLPTSYPLGRWQT---------LLAAMQRDKKARGS----------------
AROB_MYCTU            HRTILSSLGLPVSYDPDALPQ---------LLEIMAGDKKTRAG----------------
AROB_MYCLE            HHTILTSLGLPVSYDADALPQ---------LLEYMAGDKKTRAG----------------
AROB_SACEN            HKKVLDLLGLPTTYDPDALAQ---------LLEGMRVDKKTRSG----------------
C6W902_ACTMD          HRSVLTSLGLPVAYDPDALPQ---------LLEGMRSDKKNRSG----------------
AROB_CORGL            HRSILAAIGLPTSYEGGAFDE---------LYDGMTRDKKNRDG----------------
AROB_COREF            HRVILDSIGLPTTYQGGVFDE---------LYEGMTRDKKNRDG----------------
AROB_CORP2            HKNILSSVGLPTTYPEGHFAE---------LYQAMLRDKKNRDG----------------
AROB_CUTAK            TRTILSEIGLPVTCDEIKWAD---------LRKTMNVDKKTRVDPQTGR-----------
AROB_TROWT            HERILETYGLPICPPEVQWRN---------ITPYMQRDKKNMQSNDTDSDKDSREMPQIS
AROB_TROW8            HERILETYGLPVCPPEVQWRN---------ITPYMQRDKKNMQNNDTDSYKDSREIPQIS
AROB_DEIGD            TLAFLRWQRPRPLP-PLSFDT---------VWPYMARDKKADSD----------------
F0RLU4_DEIPM          TRAFLHWQNPEPLP-RLQLDT---------LWPFIARDKKADEL----------------
L0A5T3_DEIPD          TSRFLSYLKPSRLPEHLTWEH---------LEPFIARDKKADRS----------------
P83703_THETH          VRRLLLWLSPPPLP-PLAFED---------LLPYLLRDKKKVSE----------------
AROB_THEVO            IRDLMKRYGIEELNLKEIGPG--------NILRYISNDKKIMEGY---------------
                                                            **                    

AROB_BACSU            --IQFIVLNELGKVADHTFSRNELESWLNKWRLEETS------------------
AROB_BACP2            --VQFVLLKQVGDAVLQSFTKDDLHQWLDEWKREEGCL-----------------
AROB_OCEIH            --IQMVLLKEVEDPVTVSLDNSMMKQHLSTYLERMEKL-----------------
AROB_BACAN            --IHMVLMQEYGVVNVVSIPDETVHIALEAFQKDMVEK-----------------
AROB_BACCR            --IHMVLMQEYGVVNVVSISDETVHIALEAFQKDMV-------------------
AROB_LISMO            --ISMVLLEEIGKPVIFKADDDLIFETYKRVMRKGGNVI----------------
AROB_STAEQ            --IQMVLLKNLGKPVVTHVDKDTLLSAFEELQSYFK-------------------
AROB_STAS1            --VQMVLLNAIGDPQVKHVDKATLSQAFEIFTTHFEK------------------
AROB_STACT            --IQMVLLKEIGKPKVIHVNNEVLEKSFATLQNYLK-------------------
AROB_MACCJ            --INFVLYYENNGYKVEQVDVKRLRKAFERLRKLEGELL----------------
AROB_EXIS2            --IRFVVKG-QDGFSLEAIDQKRLKNAYDQTVRCLHWA-----------------
AROB_EXISA            --IRFVLL--RETITVESVQLEHLQQTFEQMKGWWER------------------
AROB_PELPD            --IRFICNR-GIGDCVVVNL-TAEQLLTLSGLEV---------------------
AROB_GEOSL            --LDFVLNR-GIGGHEIVRIENLSEVFGICGVGE---------------------
AROB_PELTS            --LTFVLPE-RIGRAVVKNGLAKNFLLEFLSAGYGLLERGAGRV-----------
AROB_THEP3            --INFVLLR-GLGKAEVTTVKEEEILKVLK-------------------------
AROB_HUNT2            --LTFVLPRKRIGEVIQCTIDDEDLIKRVIASLGE--------------------
AROB_PELUB            --ISLVLLK-RIGSPVYKLQFNEKTINLFLKKELTK-------------------
A0A1V6INJ9_9EURY      --VEYALIK-GIGTSVYGVRVDEKIVRESLKEMGFL-------------------
F8C417_THEGP          --LTMVLLK-KIGKAQFYEFSSFEEAKEVFLKCF---------------------
F8AD96_THEID          --LTFILLK-RLGEPVFYEEPPQQILKEIVEALKTQKATS---------------
AROB_LEPIN            --IRFVLLK-SPGSPIFDIPINSEDIILAIHKQKGI-------------------
AROB_UNCTG            --IKFILIK-DIGKAV-STYVKDNVVLNVLKNFTGENK-----------------
AROB_STRGC            --IKLVLVP-ELGSANIHQIPLEEMKEFLKK------------------------
AROB_STRT2            --IKTVIVP-EIGKAAINQIPLIEMKEYLEK------------------------
AROB_CLOK5            --INIIVIE-EAGICKIMKIKLREVYGFLFPEDII--------------------
AROB_LEUCK            --LNLVVLK-DIGQPMIVQKAIVDMPDFINENEGNNR------------------
AROB_LEUMM            --LNLVALE-KVGQPIIVKKKIADMPAFVEN------------------------
AROB_DEHM1            --IRFILLK-RPGEPLIAENILRAD----VISILEEMK-----------------
AROB_ALKOO            --ITFILPV-DKEKVEIFKNIPIEI----VEESLEEIKYGFRCK-----------
AROB_NATTJ            --LTVILPT-SIGSAEICKCPATAL----IKVILES-------------------
AROB_VIBPA            --LRLVLPT-GIGSAEVIADTSQEV----IQQAIDFGRNI---------------
AROB_VIBVY            --LRLVLPS-SIGTAEVVADVPQEV----IRQAIEDCRTIN--------------
AROB_ALIF1            --LRLVLPT-SIGSSEVVTGVSESV----LAEVIEQCKA----------------
AROB_PSYIN            --LRLILPT-SIGRCEIFDNVSETV----LRSVIES-------------------
AROB_SHEWM            --VRLVLPE-AMGQAGVYSEVSDEL----LEDVIRCA------------------
AROB_SHEDO            --IRLILPQ-AIGQAGIYSDVDEAL----LAQVINPS------------------
AROB_SHIDS            --MRLILPL-AIGKSEVRSGVSHEL----VLNAIADCQSA---------------
AROB_ECOLI            --MRLILPL-AIGKSEVRSGVSHEL----VLNAIADCQSA---------------
AROB_SALTY            --LRLVLPL-AIGKSEVRGGVSHEV----VLSAIADCQQA---------------
AROB_KLEP7            --MRLVLPL-AIGSSELRGGVPHDV----VLGAIADTQQAQQ-------------
AROB_ERWT9            --MRLVLPL-EIGRAELRRGVAHDI----VLASIRDCQ-----------------
AROB_PHOLL            --LRLVLPT-KIGKADLRSDIEHNC----VVDAILQCLPYENV------------
AROB_HAMD5            --LRLIIPT-AIGQSEIYEGIDNDI----VLASIKETLM----------------
AROB_HAEIN            --LRLVLLK-SLGQAYVANDTEHTL----VLNAIRRCTQTD--------------
AROB_BLOFL            --INLVLPK-SIGKTQVFVNVNTDV----ILNAIENIDI----------------
AROB_PSEPK            --LRLVLLR-QMGEAVVTDDYSKEI----LQATLSADYRAIVAQL----------
AROB_PSEU5            --LRLVLLR-QMGEAVVTGDFPRGV----LETTLSADYGAMTEHLGA--------
AROB_METCA            --LRLVLLK-SLGEATLPVAVDAGL----LRATLECYGR----------------
AROB_AROAE            --LRLVLLR-SIGKAVLHAGAAPDV----IGASIEARCG----------------
AROB_THIDA            --MRFVLLK-KLGEAVITDAVPADV----LTAVLTPPH-----------------
AROB_SACD2            --LRLVLPN-KPGSSIVTDSFDADA----LAATLGRTGQLG--------------
AROB_TERTT            --LRLVLQR-GLGNAVVTGDFDAVV----LQQLL-RDRCIG--------------
AROB_HALHL            --LRLVLLR-SVGDAVVTGEFAPEA----LTDTLVEAV-----------------
AROB_CUPNH            --IKFILLK-QLGEAFI-TTVPDAD----LRATLAHAVLKPPTEAPVA-------
AROB_CUPMC            --IKFILLR-KLGSAFI-TTVPDAD----LRETLRHAILKPPTEAPVA-------
AROB_RALPJ            --IKFVLLR-KLGQAFV-TTVPDAD----LRATLLHAVLRPPTEAPVA-------
AROB_RALSO            --IKFVLLR-KLGQAFV-TTVPDTD----LRATLQHAVLRPPTEAPVA-------
AROB_BURCJ            --IKFILLK-RFGDTLI-TQAPDEA----VFATLAQTTR----------------
AROB_BORPE            --IRFVLMP-RIGQALS-RAAPEAD----VRTALERTTR----------------
AROB_NITEU            --IRFILLD-SIGKASPGDTVPTPL----LLETLSACVADA--------------
AROB_IDILO            --LHFVLPV-AIGQAEVVSTVEHNT----VTAVITECC-----------------
AROB_DICNV            --LRFVLLS-GLGQAHVVDDVTETE----IFAVIAASRSENESFARF--------
AROB_RHIME            --LTFILTR-GIGQSFVADDVPSSE----VLSFLTEKHPR---------------
AROB_RHIEC            --LTFILTR-GIGQSFVADDVPASE----VLSFLREKHP----------------
AROB_BRADU            --LTFILLE-AVGRAVIAKDVEPAP----VRDFLKEKLAQKA-------------
AROB_RHOPB            --LTFILLE-AIGRAVIAHDVEPEP----VRDFLARKLADKT-------------
AROB_RHOS4            --LRFILAR-GIGQAFVADDVPGDV----VRTLLEDALAQR--------------
AROB_JANSC            --LRFILAR-GIGHAFVTADVPTDA----VKALLTDALAGR--------------
AROB_PARDP            --LRFVLAH-GIGRAFVTDAVDPAL----LRQVLAQSR-----------------
AROB_RHORT            --VTFVLAR-GIGRSLLWREADTAS----VLATLRAAVAP---------------
AROB_CAUVC            --LTFVLAR-GIGDAFVAKDVDRAA----LKAFLVEEGAV---------------
AROB_CAUSK            --LTFVLVR-AIGDAFVAKDVDRQA----LRAFLVEEGAV---------------
AROB_HYPNA            --VPLILAR-GIGAAYVHPDADLAS----VERFLASELA----------------
AROB_ZYMMO            --LPFLLAR-GIGKSFLDKEVNLEE----IAAFLDSPLARKGTI-----------
AROB_XANOR            --LRLVLWR-GIGKAEVVPDVEEAA----VLKILAG-------------------
AROB_OPITP            --PRFVVLR-KLGEAVTQDDVPAEL----AAECFREVGAS---------------
AROB_ACIC5            --RRFVLAE-KIGHATIVEDVTEAELRAVIAWLLQRVREAGQLREVGA-------
AROB_DICTD            --LRLILPR-EIGRVEIVEDIEEKD----IIKILKEGDDYGK-------------
AROB_CHLCH            --LRFVLLK-ELGQAFLFEESVEDS---EVLAAIESAKECFRQWQQK--------
AROB_PELLD            --LRFVLLK-ALGEAFLLEEDVDDR---EVLGAIEDAKTFFRKQ-----------
AROB_GLOC7            --VRFILPQ-QIGTVTITDQVTSDV----IREVLAQIQSKA--------------
AROB_RIPO1            --VRFILPT-SIGKVIISDQVSSEI----IKSVMIHQVNK---------------
AROB_MICAN            --VRFILPT-AIGQVTISDRVTPTL----VREVLSPTESGQ--------------
AROB_NOSP7            --VRFVLPT-EIGVVTVTDEVPSDI----IRQVLQGM------------------
AROB_SYNP2            --VRFVLPT-KIGEVLITDQVSADL----ITDVLAPALC----------------
AROB_THEEB            --VRFILPT-AIGHGQICDQVPAEL----IRETLHRLQA----------------
AROB_PROMA            --IRLIVPL-GIGMVEILNDVSENE----IKSLLESI------------------
AROB_PROMP            --MRFILPI-ELGEVDIFNDINESQ----FLKYFN--------------------
AROB_HELHP            --IMFVLPC-GIGNVSLRNDVPKAD----VLDVLSSFSKDSGK------------
AROB_HELPY            --IKFILPK-GVGAFEVASHIPKET----IIKVLEKWH-----------------
AROB_CAMC5            --VKFILSN-GIGSAVMKNDIKRDD----VIKILREFK-----------------
AROB_CAMHC            --IKFILAN-SIGEFKICTDIPKDV----VIATLKDFE-----------------
AROB_PARUW            --INLILPE-KVGKVTQIFDVDPHL----IKNTLSTKMTK---------------
AROB_STRS7            --IVLILPT-TKGYISFPIAKHDNHLLDWLRSLLDIA------------------
AROB_PYRFU            --IVIVVPVEIGKANIEEVDEKIILQALEEAKNA---------------------
AROB_PYRAB            --IVFVIPVEIGRISIEDVPEELLLQVLGEIR-----------------------
AROB_THEKO            --ITFVIPVEIGDVVVEEVDEAVLKRALEATRDDSGSGDCQKPGGSA--------
AROB_SULTO            --VMMPFPTRIGDWKRVDVPI-ETLKGFAEQCLR---------------------
AROB_SULAC            --LLMPFPTRIGDWKRVEVPI-ETLKGFAEQCLK---------------------
AROB_SACS2            --ILIPFPTRIGSWKKVEVPL-DTVKGFAEQCLKK--------------------
E0SS73_IGNAA          --ILMPLPVELGKWDLFRVDI-EFVKSVFIKCLG---------------------
A8MCY5_CALMQ          --LNLPIVTELGDWVKVRVKVDEYLRLVKESCMYLA-------------------
AROB_PYRNV            --IYIPLVVRPGRWILEKIAVEEVEKAVRYVLRQGG-------------------
AROB_PYRIL            --IYIPLVVRPGRWILEKIAVEEVEKAVRYVLHQGG-------------------
AROB_PYRAE            --VYLPLVIRPGKWILERLRVEEVARAVEYVVPQGRTA-----------------
AROB_PYRCJ            --VLMPVVVRLGKWVLEKVHVGEVERAVDFVKCSA--------------------
G4RLC8_THETK          --ILMPLPVGLGKWVLEEVPLEYAERGLDQFKCSA--------------------
A8A8F0_IGNH4          --LRLPLLEGVGRWRLELVPLDEFVETTFKIMEEVFWSEDF--------------
G0EHA3_PYRF1          --IRGVFPLAPGRGLVVDVRLKDYVEAVRRAAARVWRGE----------------
AROB_STRAW            -LLRFIVLDGLAKPTVLEGPDPAVLLAAYGEVGE---------------------
AROB_STRCO            -LLRFIVLDGLAKPTVLEGPDPAVLLAAYGEVGE---------------------
AROB_THEFY            -TLRFVVLDDVAAPAILAGPSDALLAQAYQAVSGVAPDAPDTD------------
AROB_ARTS2            -LLRFVVLDGIARPGILDVPDTSLLFAAYQEIAS---------------------
AROB_LEIXX            -LLRFIVLDDVARPTVLAGPDQSLLFAAYQEIAS---------------------
AROB_MYCTU            -VLRFVVLDGLAKPGRMVGPDPGLLVTAYAGVCAP--------------------
AROB_MYCLE            -VLRFVILDGLAKPGRLVGPDPGLLVTAYAGLSA---------------------
AROB_SACEN            -VLRFVVLDGLAKPGRLEGPDPSLIAAAYSALTGAPEQKSGGSGVLL--------
C6W902_ACTMD          -VLRFVVLDGLAKPGRLEGPDPSLIAAAYSAVAAEP--RTGGSILL---------
AROB_CORGL            -NIRFVALTAVGEVTRIEGPSKQDLQSAYEAISH---------------------
AROB_COREF            -NIRFVALTAVGEVTRIEGPDRGELIRAYEAISS---------------------
AROB_CORP2            -RIRFVALIGAGKTIRIEDADRAELIAAYETLNKGGV------------------
AROB_CUTAK            QVLRFVGIHKPGQVAMIVDPDEAALAECYDRCSAR--------------------
AROB_TROWT            TQSKLVLLREIANP-FISSVSHTVLLKAYEAMFPQ--------------------
AROB_TROW8            TQSKLVLLRDIANP-FITSVSHTVLLEAYEAMFPQ--------------------
AROB_DEIGD            -GVRFVLLHDLARPYLARVPAK-VLRREFDRWWKEVLDFAPVPSADTVPSADTVP
F0RLU4_DEIPM          -GPRWVLLHGLAQPYLARLPRE-QLGDVFETWRRDI-------------------
L0A5T3_DEIPD          -GMRFVLLRRIGQPYLERLGED-QLRDVFNLWRAQMRAVVQ--------------
P83703_THETH          -SLHWVVPLAPGRLVVRPLPEG-LLREAFAAWREELKGLGLLR------------
AROB_THEVO            --INMPVPSEIGKVITMKATERMISDGINTFIKENDAS-----------------