CLUSTAL format seed alignment for MF_00111

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

MURA_BORBU        --------------------MHSYIVEGGYK-IGGQITASGNKNAALPCILAALLTDE-E
MURA_TREPA        --------------------MSCYRVEGGFP-VSGCIRVCGNKNAALPCIAAAVLTQE-P
I0HYX3_CALAS      --------------------MASFIIEGRHP-LRGAIRPIGNKNAALPMLAACLLTDE-P
I4B6Y2_TURPD      --------------------MSEFHIIGGHK-IGGTITAQGNKNEALPVLCAALMNPA-G
MURA_BACFN        --------------------MASFVIEGGHR-LSGEIHPQGAKNEVLQIICATLLTAE-E
C6W0Z9_DYAFD      --------------------MASFKITGDRR-LKGEIVPQGAKNEALQIICAVLLTKE-P
A5FNP8_FLAJ1      --------------------MGIFKIEGGTP-LKGEITPQGAKNEALQILCAVLLTGE-K
G2Z3S2_FLABF      --------------------MGTFKIEGGKS-LKGAITPQGAKNEALQILCAVLLTPE-K
F6GG77_LACS5      --------------------MGTFIIEGGHQ-LQGEIQPQGAKNEALQILCAVLLTPE-K
MURA_THEFY        -----------------MGQEVRYRVRGGHA-LHGTAFIQGAKNAVLPMIGAALLASKGR
MURA_RHIME        --------------------MDRIRIVGGNE-LHGVIPISGAKNAALPLMIASLL-TDDT
MURA_AGRFC        --------------------MDRIRITGGNK-LNGVIPISGAKNAALPLMIASLL-TSDT
MURA1_RHILO       --------------------MDRIRIVGGNK-LAGSIPISGAKNAALPLMIASLL-TDDT
MURA_NITWN        --------------------MDRIRIVGGNR-LNGTIPISGAKNAALPLMIAALL-TEET
MURA_CAUVC        --------------------MDRIAIIGGAQ-LNGTIPVSGAKNSAIKLMAASLL-TDEP
MURA_RUEPO        --------------------MDSILVTGNGP-LNGQIPIAGAKNACLTLMPATLL-SDEP
MURA2_RHILO       --------------------MDRLRIVGGRR-LEGAVTISGAKNAALPQIAAALL-SPYP
MURA_PSEAE        --------------------MDKLIITGGNR-LDGEIRISGAKNSALPILAATLL-ADTP
MURA_PSEPK        --------------------MDKLIITGGAR-LDGEIRISGAKNAALPILAATLL-ADGP
MURA_HAHCH        --------------------MDKLLIGGSKP-LNGEIRISGAKNSALPILAATLL-ADEP
MURA_XYLFA        --------------------MSKIVVAGGTP-LCGDVRISGAKNAVLPILSATLL-ADAP
MURA_RALSO        --------------------MDKLLIEGNGP-LSGEIRVSGAKNAALPIMCAALL-TPEP
MURA_NEIMB        --------------------MDKLKISANGP-LNGEITVSGAKNAALPLMCAGLL-TSGT
MURA_ECOLI        --------------------MDKFRVQGPTK-LQGEVTISGAKNAALPILFAALL-AEEP
MURA_ECO57        --------------------MDKFRVQGPTK-LQGEVTISGAKNAALPILFAALL-AEEP
MURA_SALTY        --------------------MDKFRVQGPTT-LQGEVTISGAKNAALPILFAALL-AEEP
MURA_YERPE        --------------------MDKFRVQGRTR-LSGEVTISGAKNAALPILFAALL-AEEP
MURA_VIBCH        --------------------MEKFRVIGSTQPLQGEVTISGAKNAALPILFASIL-AEEP
MURA_HAMD5        --------------------MKKFRIQGPCS-LSGEVMISGSKNAALPILFSTLL-SEEP
MURA_HAEIN        --------------------MDKFRVYGQSR-LSGSVNISGAKNAALPILFAAIL-ATEP
MURA_PASMU        --------------------MQKFRVYGQSR-LRGSVNISGAKNAALPILFAAIL-AQEP
MURA_BUCAI        --------------------MEKLYVEGNKI-LNGHVIISGSKNAALPILFMTIL-TEGK
MURA_HELPY        --------------------MDFLEIVGQVP-LKGEVEISGAKNSALPILAATLL-SRQE
MURA_HELHP        --------------------MDYLQITKSPT-LQGSVSISGAKNSALPILAATLL-SQNE
MURA_ARCB4        --------------------MEYLKIVGGKD-ISGSVEISGAKNAALPLIACTIL-GKNE
MURA_PELUB        --------------------MKKLEVFGAAK-LKGQIRISGSKNASLPILAATLL-SNKK
MURA_RICPR        --------------------MQKLIIHGGKP-LEGSINISGAKNAVLPIMAASIL-TNK-
MURA_CHLT3        --------------------MEKLVIRGGKP-LSGTVSVSGSKNSALAIMAAALLPASGK
MURA_AQUAE        -----------MKNTTLYTYRDYFVIRGGKP-LTGKVKISGAKNAALPIMFATIL-TEEP
MURA_FUSNN        -------------------MVEAFKIIGGKK-IAGELKVDGSKNSTLPIMIATLV-EKGT
MURA_BDEBA        -----------------------MVVMGNGP-LKGTVATSGAKNAALPILFSTLL-AEGN
MURA_THEMA        --------------------MGKLVVQGGAV-LEGEVEISGSKNAALPIMAAAIL-CDEE
MURA_PSELT        --------------------MGKLIIEGPAR-LNGAVKISGSKNAALPIIAASLI-CDRG
MURA_DEIRA        ------------------MQLTPLHVTGGRQ-LGGEIAVQHSKNAALPIIVATLL-SSEP
MURA_DEIDV        ------------------MQLTPLHIQGGRE-LRGEIAVQGSKNAALPIIVASLL-SSEK
MURA_ANAMF        ------------------MVEASLRVSGSTNPISGRIVANGAKNSALPIMAACLL-LNGS
MURA_NOSS1        ---------------MTEADSSVLQIWGGHP-LQGHVKISGAKNSALVIMAGALL-CSGD
MURA_SYNY3        -------MLQVATPTATEETQTVIEIEGRAS-LKGEVRISGAKNSALAIMAGTIL-CSDD
MURA1_CLOAB       --------------------MNKFIIKGG-ETLNGEVDISCAKNSVLPIIAATILCGEK-
MURA1_CLOPE       --------------------MDKIVVKGG-KKLKGEVNINTAKNSVLPIIAGSILATDG-
MURA1_CALS4       -------------------MKTKFVVEKS-PPLKGTVKISGAKNSVLPIIAASLLSSDE-
MURA1_BACSU       --------------------MEKIIVRGG-QKLNGTVKVEGAKNAVLPVIAASLLASEEK
MURA1_BACHD       --------------------MEKIIVRGG-RQLSGSVKVEGAKNAVLPVIAASILASRGT
MURA1_LISMO       --------------------MEKIIVRGG-KQLNGSVKMEGAKNAVLPVIAATLLASKGT
MURA1_LACLA       -------------------MMDKIIVKGGQTKLQGEVEIEGAKNAVLPLLAATLLASEGE
MURA1_STRP1       --------------------MDKIIIEGGQTRLEGEVVIEGAKNAVLPLLAASILPSKGK
MURA2_CLOPE       --------------------MNRLIINGGKA-LKGSIEINGAKNAAVAILPAAILASKGE
MURA2_CLOAB       --------------------MDKLVVNGGNP-LFGSVEIGGAKNAAVAILPAAIMASEGI
MURA3_CALS4       --------------------MEKFVIRGGKP-LRGTVQISGAKNSAVAVLPAALLAD-SP
MURA2_BACHD       --------------------MEKLMIEGGTP-LEGTVQISGAKNSAVALIPAAILAD-ST
MURA2_BACSU       --------------------MEKLNIAGGDS-LNGTVHISGAKNSAVALIPATILAN-SE
MURA2_LISMO       -------------------MTDRLIIQGGKK-LSGTLQVDGAKNSAVALIPAAILAE-SE
MURA2_STRP1       --------------------MRKIIINGGKA-LSGEVAVSGAKNSVVALIPAIILAD-DI
MURA2_LACLA       --------------------MKKIVINGGKR-ISGTIPISGAKNSVVALIPATILAN-DV
MURA_LACJO        --------------------MKQMIIHGGKP-LKGDVWIGGAKNSTVALIPASILSR-TP
MURA2_LACPL       --------------------MKKMIIHGGKR-LSGELTIGGAKNSTVALIPAAILAD-TP
MURA2_CALS4       --------------------MGKFKINGGKR-LYGEVEVHGAKNSILPILAATILNE-GV
MURA_MYCTU        -------------------MAERFVVTGGNR-LSGEVAVGGAKNSVLKLMAATLL-AEGT
MURA_COREF        ----------------MGGVKDKFLVKGGAR-LQGSVRVDGAKNSVLKLMAAALL-AEGT
MURA_CHLTR        --------------------MPGIKVFGETV-LRGSVRVSGAKNATTKLLVASLL-SDQR
MURA_CHLTA        --------------------MPGIKVFGETV-LRGSVRVSGAKNATTKLLVASLL-SDQR
MURA_CHLAB        --------------------MAAAEVFGGCV-LEGSVRVSGAKNSTTKLLVASLL-SDRK
MURA_PARUW        --------------------MDVLKITGGIP-LKGQVKAAGAKNAMTKLLVASLL-SDKK
B1VVQ3_STRGG      ----------------MTGTDDVLLVHGGTP-LEGEIRVRGAKNLVPKAMVAALL-GSGP
C7Q9Z5_CATAD      --------------MALSTSSDVLTVHGGAA-LSGEVRVRGAKNLVPKAMVAALL-GHGT
I0H0U0_ACTM4      ------------------MTDDVLIVHGGTP-LQGQIRVRGAKNLVSKAMVAALL-GESP
Q83G25_TROWT      --------------MKLDSTPDRFVITGGSP-LRGEIAVKGAKNLVTKAMVASML-GNSQ
A0LRT2_ACIC1      -------------------MADTWVIEPSGP-LRGDVVLRGSKNAVTKHMVAALL-ADEP
D6YA03_THEBD      MSETAKGNAAHHGGKGAPVREEVWQIEPSGP-LRGDVHVRGSKNAVSKHMVAAML-GIGP
                                           :      : *       **     :   ::     

MURA_BORBU        VILENIPNINDVKVVLDILNDIGADIAR-EGN-TLKIKV----LNIVKTEIDS----SFT
MURA_TREPA        VLLQNVPDIEDVAVMLTIFRAFGGSVER-RGNHEYMLHL----PQLQTCEVPC----EAA
I0HYX3_CALAS      ITLHNVPNIGDVKTMLRILGEMGVSIQQ-SGS-TVTLCA----RDVRTASPDP----MLF
I4B6Y2_TURPD      VTIRNVPQIEDIKNLLKIVEAVGAEITTLADGHSYSIVT----KDIKMSELPS----ELV
MURA_BACFN        VTVNNIPDILDVNNLIQLMRDMGVTVAK-TGVDSYSFKA----ANVDLAYLESDNFLKKC
C6W0Z9_DYAFD      VTIHNIPDIRDVNQLINLLGDLGVRRTR-LSESSIRFEA----DDINLDYLESDSFRQKA
A5FNP8_FLAJ1      VKINNIPDIIDINKLITLLGNLGVKIQR-NEPGSITFQA----DEVNVGYLETEAFKKEG
G2Z3S2_FLABF      VTIHNIPDIIDVNKLITLLGNLGVKIQK-NGPSSMTFQS----DEVNVGYLETEAFKKEG
F6GG77_LACS5      VTINNIPNIIDINKLIVLLSNLGVKVEK-LNEGSYSFQA----DDLNLEYLESAKFKEEG
MURA_THEFY        TVLRNVPVIEDVRRALELAEYVGAKVEFHEAERTIVIDA----TGLNDP-NRAVLPASIA
MURA_RHIME        LTLENVPHLADVEQLIRILGNHGADISVNGRRERQGESYARTVHFTSRNIVSTTAPYELV
MURA_AGRFC        LTLENVPHLADVEQLIRILGNHGVDISVNGRRESQGEAYSRTVHFTCRTIVDTTAPYELV
MURA1_RHILO       LTLENVPHLADVEQLIRILGNHGVDYSVNGRREKQNEGYSRTINFSARNIVDTTAPYELV
MURA_NITWN        LILDNVPRLADVAQLQRILGNHGVDIMSAGKRPGDHEYQGQTLHISAASVIDTTAPYELV
MURA_CAUVC        LRLTNMPRLADTRFLGKLLTRLGVQVTESDGSDGQQ------TLLHAPEITSGFAPYDLV
MURA_RUEPO        LTLTNAPRLSDIKTMTLLLQSLGAEVSSLQDG--------KVLAMSSHDLTSHTADYDIV
MURA2_RHILO       LELTNLPDVTDVENMLGVVRLHGAEVTRSAHA----------ATIDTSAAVSKETSYDTV
MURA_PSEAE        VTVCNLPHLHDITTMIELFGRMGVQPIIDEKLNVE---------VDASSIKTLVAPYELV
MURA_PSEPK        VTVGNLPHLHDITTMIELFGRMGIEPVIDEKLSVE---------IDPRTIKTLVAPYELV
MURA_HAHCH        VTIGNLPHLNDITTMIELLGRMGVELMIDEKMCVE---------VHANTIKHLTAPYELV
MURA_XYLFA        VEISNVPYLHDVITMINLLRELGAGVTMNEGIEAKGR----SITVDPRWVRQHMVPYDLV
MURA_RALSO        FTLHNVPNLQDVRTMLKLLRQMGVEGTQDG-HDVTL---------DAAAIDAPEAPYDLV
MURA_NEIMB        LRLKNVPMLADVKTTQKLLQGMGARVLTDNISEFEI---------NGGTVNNTCAPYELV
MURA_ECOLI        VEIQNVPKLKDVDTSMKLLSQLGAKVERN--GSVHI---------DARDVNVFCAPYDLV
MURA_ECO57        VEIQNVPKLKDVDTSMKLLSQLGAKVERN--GSVHI---------DARDVNVFCAPYDLV
MURA_SALTY        VEIQNVPKLKDVDTSMKLLSQLGAKVERN--GSVHI---------DASQVNVFCAPYDLV
MURA_YERPE        VELQNVPKLKDIDTTIKLLSQLGTKIERNN-GSVFV---------DASAVNEFCAPYDLV
MURA_VIBCH        VEVANVPHLRDIDTTMELLERLGAKVERN--GSVHV---------DAGPINQYCAPYDLV
MURA_HAMD5        IELKNIPELKDIDTTLNLLKQLGVKAKYQPPDSIMI---------DAKAVNHFCAPYELV
MURA_HAEIN        VKLTNVPELKDIETTLKILRQLGVVVDRDATGAVLL---------DASNINHFTAPYELV
MURA_PASMU        VKLTNVPELKDIETTLKILRKLGVVVERDAEGAVHL---------DASKIDHFVAPYELV
MURA_BUCAI        IKIGNIPNLTDINIALKLLVYLGVKITGN--ETLCI---------DASSINIFCPPYNLI
MURA_HELPY        VKIKSLPQVVDIKAMALLLQNLGASLEWL---NPNTLQI------GAKSLNHTEATYDLV
MURA_HELHP        VTINNLPDVADVKTLAKLLEHLGVNITWH---KPTSLTC------LAENIVHTRAIYDIV
MURA_ARCB4        ITIGNLPNVVDINTFLKLILKLGGSFVK----EENKVKI------NTSTINNTTATYDIV
MURA_PELUB        ISLANLPRVKDIETMILLLKSLGSIIE----DNKKELII------KNTKQTKTFAAYSLV
MURA_RICPR        LHITNVPKLTDVSTMKDLLRNHGACIRIIEHTDEFELII------NTTNINKFTADYEIV
MURA_CHLT3        TVIHRVPNLRDVHTLSNLLRIIGAKVDF----EAHTLSI------ASGDISHYEAPYELV
MURA_AQUAE        CTITNVPDLLDVRNTLLLLRELGAELEFL-----NNTVF------INPSINSFITNQEII
MURA_FUSNN        YVLRNVPDLRDIRTLVALLESLGLEVEKLDANSYKI---------INNGLSGAEASYDLV
MURA_BDEBA        HVFTNMPKLKDIESTSELLNSLGCET-KWVGDEFHV---------TVNKPSSFEASYDLV
MURA_THEMA        VILKNVPRLQDVFVMIDILRSIGFRVEFEEN----------ELKIKRENDISQEVPYELV
MURA_PSELT        VLLENVPDLMDVRTMIDILNSAGCKTRFAEN----------VLSVNPPEKPNTDIPYELV
MURA_DEIRA        ITLHGIPRLSDVYTILELMHHLGTRHAWVGP---------NSLTLHTPEIENTDAPYALV
MURA_DEIDV        VTLHGIPRLSDVYTILDLVHHIGTQHQWVGP---------NSLELHTPSIVNTDAPYALV
MURA_ANAMF        VVLAGMPDLRDVTVMSELITSLGGRISFLRNTKEKAN---HKVEINCDNLHNWAIPHEIT
MURA_NOSS1        CRIRNVPLLADVERMGEVISALGVRLTRQADIIDIN----------ASEIKTSKAPYELV
MURA_SYNY3        CRLSNLPALADIDKMCQILAAIGVNLERDGDRLVVD----------SSNVGHGPAPYELV
MURA1_CLOAB       CTIKNCPMLLDVFVISDLLKSIGAQVDIDLNSGDMKI--------DTSNVKSIEPDAELV
MURA1_CLOPE       VLINELPMLQDVFTICNVMEQLGYDLKIDKKENKLIV--------PPLNKDPLIPSEDLV
MURA1_CALS4       VILEDIPSLEDVNVMIELIKNFGALCELDNGKLKIKV--------DIKDVE---APYELV
MURA1_BACSU       SVICDVPTLSDVYTINEVLRHLGADVHFEN--NEVTV--------NASYALQTEAPFEYV
MURA1_BACHD       SKIYDVPKLADVYTMKEVLRNLNINVEYEN--GEFVV--------NATNPLKTEAPFEYV
MURA1_LISMO       SVLKNVPNLSDVFTINEVLKYLNADVSFVN--DEVTV--------DATGEITSDAPFEYV
MURA1_LACLA       VVLTNVPILSDVFMMNNLVNHLGTAISFDQEAKKIIA--------KSNSEIKTTAPYEYV
MURA1_STRP1       TILRNVPILSDVFTMNNVVRGLDIRVDFNEAANEITV--------DASGHILDEAPYEYV
MURA2_CLOPE       CIIDNVPDIADVHCLERIIRSLGCNV-EKLDNNTLKI--------NAEEIKTVEACGNDV
MURA2_CLOAB       SVIDNIPDIQDIQRLERIITSLGCKV-KRV-QNTVEI--------DSTNLTSVNADTEDG
MURA3_CALS4       SVIDNLPDIKDIETLAEIIKRLGGKV-EKG-KHEIKI--------DPTGLNSFHPPRELA
MURA2_BACHD       VTIDNLPDISDVRLLGELLKEIGGEV--ELADQKMVI--------DPSKMFAMPLPNGRV
MURA2_BACSU       VTIEGLPEISDIETLRDLLKEIGGNV--HFENGEMVV--------DPTSMISMPLPNGKV
MURA2_LISMO       VVLEGLPDISDVYTLYDILEELGGSV--RYDNKTAII--------DPTDMLSMPLPSGNV
MURA2_STRP1       VILDGVPAISDVDSLIEIMELMGATV--NYHGDTLEI--------DPRGVQDIPMPYGKI
MURA2_LACLA       VTLEGVPDISDVASLVEIMEIMGAKIERNLEEGRLVI--------DTRSVVSRPLPYGKI
MURA_LACJO        VTLEGVPRIADVDNLMDLLSEMDVKC--DFHETTLRI--------NPDNIKRSPLPAGKI
MURA2_LACPL       VQFDTVPHILDVHNLRLILESMNVHS--TFENDVLTI--------DPTNIEESELPSHAI
MURA2_CALS4       SVIHNCPRLKDVDSMIEILEHIGCKV--SFSGRDIVV--------DARDVKDSEIPDNLM
MURA_MYCTU        STITNCPDILDVPLMAEVLRGLGATVELDGDVARIT----------APDEPKYDADFAAV
MURA_COREF        TTLTNCPEILDVPLMRDVLVGLGCEVEIDGHTVTIH----------TPAELKSDADFPAV
MURA_CHLTR        TILKNVPNIEDVRQTVDLCRVLGAIVEWDQQAQVIEIHT------PRILLSKVP--PQFS
MURA_CHLTA        TILKNVPNIEDVRQTVDLCRVLGAIVEWDQQAQVIEIHT------PRILLSKVP--PQFS
MURA_CHLAB        CVLRNVPDIGDVRLTVELCRSLGSIVHWDKQAEVIEIHT------PEIHMSEVS--AQFS
MURA_PARUW        CTFYNVPNIGDVEVTVSLCQEIGMEVRWDRAAGIMEVIT------KELKTSYIP--QRFS
B1VVQ3_STRGG      SRLRNVPDIRDVRVVRGLLQLHGVTVRPGDEPGELILDP------SHVESANVADIDAHA
C7Q9Z5_CATAD      SVLHNVPQISDVRIVTGLLEAHGVSVTRGESPDTLILDP------ASVEAASDAAVEAHA
I0H0U0_ACTM4      SHLYDVPGIRDVEVVRGLLELHGVKVTDGTEDGELVMDP------TNVESASTDEINVHA
Q83G25_TROWT      SVLTNVPNISDVLIVRRLMEAYNVSVR-ATQNDTLVIDP------ILLGQCSRGDIDVYA
A0LRT2_ACIC1      SVIDNVPDVGDVTITTDILRAVGAEVLVEDDR--VTVVP------SREVNPHVP--LSFS
D6YA03_THEBD      STLHNAPEVGEVGLTAAMLQALGVHVEISPGE--ITIER------GAEIRPYVP--EEYT
                    .   * : :      :    .                                     

MURA_BORBU        DLIRASILLLGPFVSRFGKIDMALP-GGDVIGKRRLDTHFYGLCKLGAKLSTKDR---RI
MURA_TREPA        QKVRASILFAGPLLARGRKAVLPPP-GGDVIGRRRLDTHFLALAALGAQVRL-DG---VF
I0HYX3_CALAS      SQIRGSLTLMGPLLARFGRFEVKTSAGGDDIGRRRIDTHLHVLGALGARLAQNGK---FE
I4B6Y2_TURPD      AGLRGSITLLGPILARAKKVFLPRP-GGDKIGRRRVDTHLLALSALGAKVEVFND---GY
MURA_BACFN        SSLRGSVMLIGPMVARFGKAMISKP-GGDKIGRRRLDTHFIGIQNLGADFTYNEE-REIY
C6W0Z9_DYAFD      AALRGSVMLLGPMLARFRKGRIPRP-GGDKIGRRRLDTHFLGFEKLGAEFSYDEEDGGFY
A5FNP8_FLAJ1      GALRGSIMIVGPLLARFGKGYIPKP-GGDKIGRRRLDTHFEGFINLGAKFRYNRE-DHFY
G2Z3S2_FLABF      GSLRGSIMIVGPLLARFGKGYIPKP-GGDKIGRRRLDTHFEGFINLGAKFRYNRE-DHFY
F6GG77_LACS5      RGLRGSIMIVGPLLARFGKGYIPKP-GGDKIGRRRLDTHFEGFISLGAKFRYNRE-DYFY
MURA_THEFY        SRFRGSVLFIPALMHRMGRARIEGV-GGCNLGSRNLDFHYRGFARLGAEVTEDPE---RK
MURA_RHIME        SKMRASFWVIGPLLAREGKARVSLP-GGCAIGTRPVDLFIEGLAALGA-NIEIDGGYVNA
MURA_AGRFC        SKMRASFWVIGPLLAREGRARVSLP-GGCAIGTRPVDLFIEGLQALGA-TMEIDGGYINA
MURA1_RHILO       SKMRASFWVIGPLLARMGEAKVSLP-GGCAIGTRPVDLFLEGLQALGA-DLDVDTGYVIA
MURA_NITWN        SKMRASFWVIAPLLARMHEARVSLP-GGCAIGTRPVDLLILALEKLGA-RIAIDGGYVIA
MURA_CAUVC        RQMRASFNVLGPLVARSGQAKVSLP-GGCTIGARPVDLHLQAIEALGA-KIDLHEGYVYA
MURA_RUEPO        RKMRASNLVLGPMLARLGQAVVSLP-GGCAIGARPMDLHIEALEALGA-EIELRDGYLHA
MURA2_RHILO       RKMRATVLVLAPLLARFGHARVSLP-GGCAIGARPVDMHVAALAALGA-KIAIENGLIVA
MURA_PSEAE        KTMRASILVLGPMLARFGEAEVALP-GGCAIGSRPVDLHIRGLEAMGA-QIEVEGGYIKA
MURA_PSEPK        KTMRASILVLGPMVARFGEAEVALP-GGCAIGSRPVDLHIRGLEAMGA-KIEVEGGYIKA
MURA_HAHCH        KTMRASILVLGPMLAHFGEAEVSLP-GGCAIGSRPVDLHIRGLEAMGA-DILVEGGYIKA
MURA_XYLFA        KTMRASVLLLGPLLACYGAAEVALP-GGCAIGSRPVDQHIRGLQSLGA-EITVENGYIKA
MURA_RALSO        KTMRASILVLGPLLARFGHARVSLP-GGCGIGARPVDQHIKGLQQMGA-EIVIEHGYIEA
MURA_NEIMB        RTMRASILVLGPTLARFGEAQVSLP-GGCAIGSRPVDQHLKGLEAMGA-EIVIEHGYVKA
MURA_ECOLI        KTMRASIWALGPLVARFGQGQVSLP-GGCTIGARPVDLHISGLEQLGA-TIKLEEGYVKA
MURA_ECO57        KTMRASIWALGPLVARFGQGQVSLP-GGCTIGARPVDLHISGLEQLGA-TIKLEEGYVKA
MURA_SALTY        KTMRASIWALGPLVARFGQGQVSLP-GGCTIGARPVDLHITGLEQLGA-TIKLEEGYVKA
MURA_YERPE        KTMRASIWALGPLVARFGQGQVSLP-GGCAIGARPVDLHITGLEQLGA-EIKLEEGYVKA
MURA_VIBCH        KTMRASIWALGPLVARFGQGQVSLP-GGCAIGARPVDLHIHGLEQLGA-TITLEDGYVKA
MURA_HAMD5        KTMRASIWALGPLVARFGRGQVSLP-GGCAIGARPVDLHIFGLKQLGA-KIQIEEGYIKA
MURA_HAEIN        KTMRASIWALAPLVARFHQGQVSLP-GGCSIGARPVDLHISGLEKLGA-DIVLEEGYVKA
MURA_PASMU        KTMRASIWALAPLVARFHRGQVSLP-GGCSIGARPVDLHISGLERLGA-SIILEDGYVKA
MURA_BUCAI        NKIRASIWMLGPLLARFGKAKIFLP-GGCKIGSRPIDLHLNGLTQLGA-TINLKNNCIDA
MURA_HELPY        RKMRASILVLGPLLARFKECLVSLP-GGCAIGARPVDLHLKAMQQLGA-KITIEQGYIHA
MURA_HELHP        RKMRASILVLGPLLSRFGYCEVSLP-GGCAIGARPVDLHIKAMEKMGA-DIQIKGGYIIA
MURA_ARCB4        KTMRASILVLGPLLARFGHCEVSLP-GGCAIGQRPVDLHLKALEQMGA-KIEILQGYIKA
MURA_PELUB        KTMRAGILVLGPLLAKFGKAKVSLP-GGCAIGTRPVDIHLQALSKLGV-KYKIIQGYVHA
MURA_RICPR        RKMRASIWVLGPLLTKYGKAKVSLP-GGCAIGARQVDLHIAVLKSMGA-EIEIEDGYINA
MURA_CHLT3        KKMRASIYVLGPLLGRFGRAKVSLP-GGCAFGPRPVDLHIESMKKLGA-DIKLEDGYIIA
MURA_AQUAE        RRMRASVLSLGPLLGRFGRAVVGLP-GGCSIGARPIDQHLKFFKEAGA-DVEVREGYVYV
MURA_FUSNN        KKMRASFLVMGGMLAIEKRGKVALP-GGCAIGARPVDLHLKGFEALGA-KINIEHGYVEA
MURA_BDEBA        RKMRASFLCMGPMLAKYGEAVVSQP-GGCAIGSRPIDLHLDGFRALGA-TITQKEGYVHA
MURA_THEMA        RKMRASFNVLGPIAVRTGRAKVALP-GGCSIGVRPVDFHLEGLKKMGF-SIKVEHGFVEA
MURA_PSELT        RKMRASFNVLGPLAAKYGKASVSLP-GGCSIGVRPVDYHIEGLQKLGF-SINIEHGIVTA
MURA_DEIRA        SKMRASFIVLGAILARAGTATVSMP-GGCAWGPRPVDQHVKALRALGA-EVIEDGGNFFA
MURA_DEIDV        NKMRASFVVLGAILARAGQARVSMP-GGCAWGPRPVDQHVKALRALGA-EISEEGGNFHA
MURA_ANAMF        SQMRASCLTLGPILTRMGRAEVALP-GGCSIGSRPLDMHIWALQKLGA-KVEVCGNYVKC
MURA_NOSS1        TQLRASFFAIGAILARLGVAQMPLP-GGCAIGARPVDLHVRGLQAMGA-EVQIEHGICNA
MURA_SYNY3        SQLRASFFVIGPLLSRLGMTKVPLP-GGCAIGTRPVDLHVRGLQAMGA-DVHIEHGVVNA
MURA1_CLOAB       RKMRGSFLIMGPMISRYGRFKISLP-GGCNIGTRPIDLHLKGLKALGV-NIEIGHGYVEA
MURA1_CLOPE       KKMRASFLIMGPMIAKYGEFKLARP-GGCNIGSRPIELHLKGLRALGAEDSNCGNGFVCI
MURA1_CALS4       KKMRASFLVMGPILAKLGHAKISMP-GGCAIGARPIDLHLKGFQSLGA-DITIGHGYVEA
MURA1_BACSU       RKMRASVLVMGPLLARTGHARVALP-GGCAIGSRPIDQHLKGFEAMGA-EIKVGNGFIEA
MURA1_BACHD       RKMRASFLVMGPLLARVGHARIALP-GGCAIGSRPIDQHLKGFEAMGA-TVEIGNGFIEA
MURA1_LISMO       RKMRASIVVMGPLLARTGSARVALP-GGCAIGSRPVDLHLKGFEAMGA-VVKIENGYIEA
MURA1_LACLA       SKMRASIVVMGPILARNGQARVSMP-GGCSIGSRPIDLHLRGFEQMGA-TITQNAGYIEA
MURA1_STRP1       SQMRASIVVLGPILARNGHAKVSMP-GGCTIGSRPINLHLKGLEAMGA-TITQKGGDITA
MURA2_CLOPE       RKMRASYYFIGALLARFKEAKVELP-GGCPIGVRPIDQHIKGFEALGA-KVSIEHGAVNI
MURA2_CLOAB       SKMRASYYLIGALLGRFGKAKVELP-GGCPIGVRPIDQHIKGFEALGA-TVKISHGTVEA
MURA3_CALS4       SRMRASYYLIGALLSKFNEAIIPMP-GGCNIGVRPIDQHIKGFEALGA-ETTIEHGFIRI
MURA2_BACHD       KKLRASYYLMGAMLGKFKKAVIGLP-GGCNLGPRPIDQHIKGFEALGA-KVTNEQGAIYL
MURA2_BACSU       KKLRASYYLMGAMLGRFKQAVIGLP-GGCHLGPRPIDQHIKGFEALGA-EVTNEQGAIYL
MURA2_LISMO       KKLRASYYLMGAMLGRFKKAVIGLP-GGCYLGPRPIDQHIKGFEALGA-KVTNEQGAIYL
MURA2_STRP1       NSLRASYYFYGSLLGRFGQAVVGLP-GGCDLGPRPIDLHLKAFEAMGV-EVSYEGENMNL
MURA2_LACLA       NSLRASYYFNGALLGRFGQATVGLP-GGCDLGPRPTDLHDKAFKALGA-KKIQEEEAEHL
MURA_LACJO        KSLRASYYFMGALLGRFGKAVVGFP-GGDDIGPRPIDQHIKGFEALGA-TVENKNDQIII
MURA2_LACPL       KSLRASYYFMGALLGRFNRATVTFP-GGDNIGPRPIDQHIKGFKALGA-NVVEENDSVFI
MURA2_CALS4       RTMRSSIFLMGALIARNKKAFISFP-GGCDIGHRPIDLHLKGLKKLGV-EIEESYGYIRC
MURA_MYCTU        RQFRASVCVLGPLVGRCKRARVALP-GGDAIGSRPLDMHQAGLRQLGA-HCNIEHGCVVA
MURA_COREF        TQFRASVCVLGPLTARCGRAVVSLP-GGDAIGSRPLDMHQSGLEQLGA-TTRTQHGAVVA
MURA_CHLTR        CVNRIPILLLGALLRRCPYGIFVPILGGDAIGPRTLHFHLEGLKKLGAEIVISDE----G
MURA_CHLTA        CVNRIPILLLGALLRRCPYGIFVPILGGDAIGPRTLHFHLEGLKKLGAEIVISDE----G
MURA_CHLAB        RVNRIPILLLGALLARCPEGVVVPCVGGDAIGERTLNFHFEGLEQLGAKVAYDGH----G
MURA_PARUW        GSNRIPILMIGALLGRTDQDIIVPTAGGCPIGQRPVDFHIQALEQLGAVIEYRGMKREGA
B1VVQ3_STRGG      GSSRIPILFCGPLLHRLGHA-FIPGLGGCDIGGRPIDFHFEVLRQFGATIEKRAD----G
C7Q9Z5_CATAD      GTSRIPVLFCGPLLHRLGRA-FIPDLGGCKIGDRPIDFHLDALRAFGAVVEKRPE----G
I0H0U0_ACTM4      GSSRIPILLCGPLLHRLGHA-FIPDLGGCHIGPRPIDFHIRALREFGAVVDKTPE----G
Q83G25_TROWT      GSSRVPILFCGPLLHKTGQA-FITGLGGCRIGERPIDFHLQALRKFGASHEKLPG----G
A0LRT2_ACIC1      GLNRIPVLLLGPLLHRAGEA-FVPKVGGDRIGSRPVDFHVAALRAFGADVEVSDD-----
D6YA03_THEBD      GLNRIPILMLGPLLHLAGEA-FVPFVGGDPIGRRPVNYHVDALRAMGAEVEVGEN-----
                     *                 .    **   * *  .     :   *             

MURA_BORBU        VLKAN--KLVGAEMFLDEASVTATENIIMAAVLAEGN-TVIMNAACEPHVQDLCNMLNSM
MURA_TREPA        TFSAN--KLVGCDVFLDEASVTATENVLMASVLAEGV-TVITNAASEPHVQDLCHLLNAM
I0HYX3_CALAS      LQADG--RLRGKDILLDEASVTATENGVMAAALAQGT-TILRNAASEPHVQDLCHLLMRM
I4B6Y2_TURPD      MLEAA--KLKGTAILLDEASVTGTENAIMAAACAEGV-TLIENAASEPHVQGLCRFLIAQ
MURA_BACFN        EISAE--ELKGTSMLLDEASVTGTANIVMAAVLAKGK-TTIYNAACEPYLQQLCKMLNRM
C6W0Z9_DYAFD      RVDAA--NLKGTFMLLDEASVTGTANVLMAAVMAEGT-TTIYNAACEPYLQQLCKMLNRM
A5FNP8_FLAJ1      GVESPKEGLKGTDMLLDEASVTGTANIVMAAVLANGT-TTVYNAACEPYLQQLCKMLNSM
G2Z3S2_FLABF      GVETS-EKLKGTYMLLDEASVTGTANIVMAAVLAEGV-TTIYNAACEPYLQQLCKMLNLM
F6GG77_LACS5      GVEAE--QLVGTDMLLDEASVTGTANIVMAAVLAKGT-TTIYNAACEPYLQQLCKMLNRM
MURA_THEFY        HINVKADNLKGGRLYLDTPSHTGTENLIMAAALTPGT-TVIEHAALEPEVLDVIEFLGSM
MURA_RHIME        TAP--AGGLIGARYVFPKVSVGATHVLMMAATLANGT-TVLGNAAREPEVVDLAKCLNAM
MURA_AGRFC        SAP--KGGLIGAVYTFPKVSVGATHVMLMAASLARGT-TVIHNAAREPEVVDLAHCLIAM
MURA1_RHILO       KTK--NGRLVGNRYVFPKVSVGATHVLMMAASLAKGE-TVLENAACEPEIVNLAECLNAM
MURA_NITWN        SAP--AG-LRGAEVAFPKVTVSGTHVALMAATLASGT-TVITNAACEPEIVDVADCLNKM
MURA_CAUVC        QAP--RG-LKGAEIRFPFVSVGATEHAMLAAVLADGV-SVIHNAACEPELVDLQECLNAM
MURA_RUEPO        KAP--GG-LKGAVHEMRFASVGATENMVMAATLAKGT-TVLKNAAREPEIVDLVRCLRAM
MURA2_RHILO       SAP--NG-LTGTRIVLSSPSVGATETAMMAATTAKGE-TEILNAAREPEVADLAACLNAM
MURA_PSEAE        KAP--AGGLRGGHFFFDTVSVTGTENLMMAAALANGR-TVLQNAAREPEVVDLANCLNAM
MURA_PSEPK        KAP--EGGLRGAHFFFDTVSVTGTENIMMAAALAKGR-SVLQNAAREPEVVDLANFINAM
MURA_HAHCH        KV---NGRLKGAHIYMDTVTVTGTENLLMAATLADGK-TVIENAAREPEVIDLAECLIAM
MURA_XYLFA        SVS--QGRLKGGRFVFDVVSVTGTENLLMAAAVAQGT-SVIENAAMEPEVVDLAECLIAL
MURA_RALSO        KLADGAKRLHGARIVTDMVTVTGTENLLMAAVLADGE-TVLENAAREPEVTDLANLLVKM
MURA_NEIMB        K-----GKLKGTRVAMDVVTVGGTENLLMAATLAEGT-TVLENCAIEPEVVDLAECLVKM
MURA_ECOLI        SVD---GRLKGAHIVMDKVSVGATVTIMCAATLAEGT-TIIENAAREPEIVDTANFLITL
MURA_ECO57        SVD---GRLKGAHIVMDKVSVGATVTIMCAATLAEGT-TIIENAAREPEIVDTANFLITL
MURA_SALTY        SVE---GRLKGAHIVMDKVSVGATVTIMCAATLAEGT-TIIENAAREPEIVDTANFLVTL
MURA_YERPE        SVN---GRLKGAHIVMDKVSVGATVTIMSAATLAEGT-TVIENAAREPEIVDTANFLNTL
MURA_VIBCH        HVD---GRLQGAHIVMDKVSVGATITIMCAATLAEGT-TVLDNAAREPEIVDTAMFLNKL
MURA_HAMD5        SVE---GRLKGAHIVMDKVSVGATLTVMSAATLAEGT-SIIENVAREPEIVDTANFLNIL
MURA_HAEIN        QVS---DRLVGTRIVIEKVSVGATLSIMMAATLAKGT-TVIENAAREPEIVDTADFLNKM
MURA_PASMU        YVD---HCLVGTRIVMEKVSVGATLSIMMAATLAKGK-TIIENAAREPEITDTALFLNKM
MURA_BUCAI        YVK---GRLQGKYILMEKISVGATITIMSAATLAKGS-TIIDNAACEPEIVDIAKFLNTL
MURA_HELPY        KAP---KGLKGNDILFDKISVTGTENALMAASLAKGI-TRIINAAKEPEIAQLCAFLQSG
MURA_HELHP        QAK---GGLKGADILFDKITVTGSENVIMAAALAQGK-THIINAAKEPEVVQLCEILSQS
MURA_ARCB4        TAP---NGLKGAKIVFDKVTVGGTENIVMAAALAHGV-TTIINAAKEPEIVQLCEVLANS
MURA_PELUB        NAP---KGLIGANIKFPKVSVGATENLIIAACLAKGK-TTLSNCAIEPEIKDLVNFLINM
MURA_RICPR        SSK---GRLKGTHFIFDKVSVGATINAILAAVLAKGE-TVLFNCGREPEIVDLCYCLIKM
MURA_CHLT3        KTKR--KGLSGAKIDFRISSVGATGNTLMAAALAKGT-TCLTNAALEPEIVYLCEFLEKM
MURA_AQUAE        NLK----EKRRVHFKFDLVTVTGTENALLYLASVPEE-SILENIALEPEVMDLIEVLKKM
MURA_FUSNN        TTE---NGLIGGNIVLDFPSVGATENIIMAAVKAKGK-TVLENAAKEPEIEDLCNFLIKM
MURA_BDEBA        GSP---K-LKGGTFLFETVTVGGTENVMMAATLADGV-TVLENAAKEPEIVDLAEYLNKM
MURA_THEMA        CFE---RRIDYVTITLPFPSVGATEHLMTTAALLKGARVVIENAAMEPEIVDLQNFINRM
MURA_PSELT        ELG---ERPQEVLISLPFPSVGATEHIMTTAAILDGTHTILENAAMEPEIEDLANFLNDM
MURA_DEIRA        HRE---GSLNGSFV-FELLTVGGTHNAILAAALGEGT-VTLENASIDTDVVDVIEFLNAL
MURA_DEIDV        RRQ---GSLNGTFV-FELLTVGGTHNAVLAAVLGDGV-VTLENASIDTDVVDLIEFLNSL
MURA_ANAMF        SSS---GKLVGCHIDFQSVSVGATENALMAAVMAHGT-TTISNAAIEPEVADLAHFLVKA
MURA_NOSS1        YVPGSGGRLKGAKIYLDTPSVGATETLMMAATLADGE-TILENAAREPEVVDLANFCKAM
MURA_SYNY3        SIKGHSRRLTGAKIYLDYPSVGATETILMAATLAEGE-TVIDNAAREPEIVDLANFCRSM
MURA1_CLOAB       NAA----KLLGDRIYLDFPSVGATENIIMASVFAEGE-TIIENAAQEPEIDDLINFLNKM
MURA1_CLOPE       KAK----KLTGSKIYLDFPSVGATENIMMAATMAKGT-TVIENAAQEPEITDLINFLNSM
MURA1_CALS4       RAK----KLTGKKIYLDFPSVGATENIMMAAVFADGV-TVIENAAEEPEIVDLANFLNKM
MURA1_BACSU       EVKG---RLQGAKIYLDFPSVGATENLIMAAALAEGT-TTLENVAKEPEIVDLANYINGM
MURA1_BACHD       KVEG---RLQGTKIYLDFPSVGATENIMMAAAMAEGT-TILENAAEEPEIVCLANYLNAM
MURA1_LISMO       TAE----KLVGAKVYLDFPSVGATQNIMMAATLAEGT-TVIENVAREPEIVDLANFLNQM
MURA1_LACLA       KAD----KLKGAHIYLDFPSVGATQNLILAATLADGT-TTLENAAREPEIVDLANLLNKM
MURA1_STRP1       QAD----RLQGAMIYMDFPSVGATQNLMMAATLADGV-TTIENAAREPEIVDLAQFLNKM
MURA2_CLOPE       MA----EKLIGTNIFFDVVSVGATINLMIAATLAEGT-TVLENAAREPHVVDVANFLNAM
MURA2_CLOAB       QA----DKLIGTNIYFDVVSVGATINLMLASVFAEGT-TVLENAAKEPHIVDVANFLNSM
MURA3_CALS4       KA----EKLRGAHIYFDVVSVGATINLMLAAVKAEGV-TILENCAKEPHVVDVANFLNAM
MURA2_BACHD       RA----DELKGARIYLDVVSVGATINIMLAAVLAKGR-TIIENAAKEPEIIDVATLLTSM
MURA2_BACSU       RA----ERLRGARIYLDVVSVGATINIMLAAVLAEGK-TIIENAAKEPEIIDVATLLTSM
MURA2_LISMO       RA----DELKGARIYLDVVSVGATINIMLAAVRAKGK-TVIENAAKEPEIIDVATLLTNM
MURA2_STRP1       STNG--QKIHGAHIYMDTVSVGATINTMVAATKAQGK-TVIENAAREPEIIDVATLLNNM
MURA2_LACLA       EVIG--DSLVGTTIYMDVVSVGATINTMLAASRAKGL-TIIENAAREPEIIDVATLINNM
MURA_LACJO        TAPK--TGLRGAKIHLKMPSVGATMNIIMASVMAKGQ-TIIENAAKEPEIIDLATFLNNM
MURA2_LACPL       STGT--EGLHGARIFLDVVSVGATINIILAAVKAHGT-TTIENAAKEPEIIDLATFLNNM
MURA2_CALS4       KG----VRVRGNEIHLDLPSVGATENIMLAATLADGI-TVIRNAAKEPEIEDLQNFLNSM
MURA_MYCTU        RAE----TLRGAEIQLEFPSVGATENILMAAVVAEGV-TTIHNAAREPDVVDLCTMLNQM
MURA_COREF        EAD----KLVGAEISLDFPSVGATENILMASVMAEGQ-TTLDNAAREPEIVDLCRMLRSM
MURA_CHLTR        YWASAPNGLVGAHITLPYPSVGATENLILASVGAQGR-TIIKNAALEVEIIDLIVFLQKA
MURA_CHLTA        YWASAPNGLVGAHITLPYPSVGATENLILASVGAQGR-TIIKNAALEVEIIDLIVFLQKA
MURA_CHLAB        YQAAAPKGLIGAYITLPYPSVGATENLILASVRAQGR-TIIKNAALEVEILDLILFLQKA
MURA_PARUW        YFAHAHNGLKGTLITLPYPSVGATENTILAGITARGV-TVIKNAAIEPEIVELILFLQKL
B1VVQ3_STRGG      QYLEAPQRLRGTKIRLPYPSVGSTEQVLLTAVLAEGV-TELSNAAVEPEIEDLICVLQKM
C7Q9Z5_CATAD      LLISAPERLRGTHIRLPYPSVGATEQVLLTAVLAEGV-TELSNAATEPEIVDLIAVLQKM
I0H0U0_ACTM4      MHLSAPNGLHGAKLELPYPSVGATEQVLLTAVRAEGV-TELRNAAIEPEIMDLICILQKM
Q83G25_TROWT      ILLSTKKRLKGASVHFPYPSVGATEQVLLTAVLADGV-TELRGAAIEPEIMDLIAILQKM
A0LRT2_ACIC1      GIFAKATRLTGARIHLPYPSVGATESVLLTATLAKGK-TVLTNAATEPEVVDLALFLQRM
D6YA03_THEBD      GISAKATRLHGARIQLPYPSVGATETILLTAVLAEGK-TVIKGAAMEPEVVELALFLQRM
                                     :  .:   :            :   . :  :          

MURA_BORBU        GANILGIGSNVLEIKGV---KKLSG-TVFRIGADFMQVGSLISLAALTGGELEIKKADPQ
MURA_TREPA        GARVSGIGSNVLTIEGV---SALHG-TTYTLGADFMEVGSLIGLAVVTRGALTISDVNVR
I0HYX3_CALAS      GCHIEGIGSNVLTIHGC---DRLHG-AEAHISPDFVEVGSYIGMGAITPGELRIVGVVPE
I4B6Y2_TURPD      GVTIEGVGSNMLKIHGVGGFENLKA-ADHTIGPDYLEIGSFIAMSAMTGGDLVVQDVNPI
MURA_BACFN        GAKISGIASNLLTIEGV---EELHG-TDHTVLPDMIEVGSFIGMAAMTRSEITIKNVSYE
C6W0Z9_DYAFD      GAKISGIASNMLIVEGV---SELKG-TEHTMLPDMIEIGSFIGLAAMTQSEITIKDCQIP
A5FNP8_FLAJ1      GAKITGVGSNLLTIEGV---ESLGG-CEHTILPDMIEIGSWIGLAAMTKSEITIKNVSWE
G2Z3S2_FLABF      GAKISGVGSNLLTIEGV---EALGG-CEHRILPDMIEIGSWIGLAAMTKSEITIKNVSWE
F6GG77_LACS5      GAKISGVGSNLLTIEGV---DTLGG-TEHTMLPDMIEIGSWIGLAAMTKSELTIKNVSWD
MURA_THEFY        GAKISGGGTGFIKVEGV---SELTA-VEHTVMPDRIDTGVFAMMTAATGGDVSLVGANLD
MURA_RHIME        GAKISGQGTSTVTIEGV---RSLSG-ARHRVLPDRIETGTYAMAVAMAGGDVILEDTEAS
MURA_AGRFC        GAKIEGAGTSTITIEGV---TSLSG-ARHRVLPDRIETGTYAMAVAMAGGDVVLEGTRAS
MURA1_RHILO       GARISGAGTPTITIDGV---ESLSG-ARVRVIPDRIETGTYAMAVAMTGGDVVLEGARPE
MURA_NITWN        GARVSGAGTPRIVIEGV---GRLGG-ARHTVLPDRIETGTYAMAVAMTGGEVLLRGARPE
MURA_CAUVC        GAKVEGAGTPTVTITGV---PRLHG-ATHAVIPDRIEMGTYAVAAAMAGGEVRLSNARPG
MURA_RUEPO        GAQIEGEGTSTIEIQGV---DRLHG-ATHQVVTDRIELGTYMLAPAICGGEVELLGGRLD
MURA2_RHILO       GARIEGAGTHRILIAGD---TGWHA-ARHDIIPDRIEAGTYAIAAAITGGQLELTHARLE
MURA_PSEAE        GANVQGAGSDTIVIEGV---KRLGG-ARYDVLPDRIETGTYLVAAAATGGRVKLKDTDPT
MURA_PSEPK        GGNIQGAGTDTITIDGV---ERLDS-ANYRVMPDRIETGTYLVAAAVTGGRVKVKDTDPT
MURA_HAHCH        GADIRGHGSSTIEINGV---PRLHG-CRYNVLPDRVETGTYLVAAAATRGRVRVKDTRED
MURA_XYLFA        GARIEGAGTPRIVVEGV---ERLKG-GQYAVLPDRIETGTFLVATAMTGGRISMQQVRPQ
MURA_RALSO        GARIDGIGTDRLVVQGV---EALRG-AEHTVIADRIEAGTFLCAVAAAGGDVTLRGVPPG
MURA_NEIMB        GAKISGIGTSTMIVEGV---DELQG-CEHSVVPDRIEAGTFLCAVAITGGRVVLRNAAPK
MURA_ECOLI        GAKISGQGTDRIVIEGV---ERLGG-GVYRVLPDRIETGTFLVAAAISRGKIICRNAQPD
MURA_ECO57        GAKISGQGTDRIVIEGV---ERLGG-GVYRVLPDRIETGTFLVAAAISRGKIICRNTQPD
MURA_SALTY        GAKIAGQGTDRITIEGV---ERLGG-GVYRVLPDRIETGTFLVAAAISRGKILCRNAQPD
MURA_YERPE        GAKISGAGTDRITIEGV---TRLGG-GVYRVLPDRIETGTFLVAAAISGGKVVCRQTRPD
MURA_VIBCH        GAKISGAGTDSITIEGV---ERLGG-GKHAVVPDRIETGTFLVAAAVSRGKIVCRNTHAH
MURA_HAMD5        GANIQGAGTDKIVVEGV---KRLRG-GAYSIMPDRIETGTFLVAGAVSRGKVVCRHTQPA
MURA_HAEIN        GAKITGAGSAHITIEGV---ERLTG-CEHSVVPDRIETGTFLIAAAISGGCVVCQNTKAD
MURA_PASMU        GAKIVGAGTDTITVEGV---ERLGG-CEHSIVPDRIETGTFLVAAAISGGRIECKNTKAD
MURA_BUCAI        GADIIGAGSNKICIKGV---LKLTG-GTHQVIPDRIETGTFLVAAAASQGHITCHKTEPK
MURA_HELPY        GVEIHGIGSSELKIRGVEN-DALNL-KDIQIIPDRIEAGTYLCVGAITNSQLKINHIIPN
MURA_HELHP        GVKIEGIGGNELIIYGTGG-ELLNF-APICVIPDRIEAGTYLCAGAITNSSITLENVENN
MURA_ARCB4        GVKIEGIGTSKIVIEGTGQ-KLIDI-KPFDVIPDRIEAGTYMCAAAITNKKLKINKVIPL
MURA_PELUB        GCNIKWTAKRTVRIEGV---NNLKE-LDYSVMPDRIEAGTYLIAAALTEGNLKITGIDPK
MURA_RICPR        GADILGVGSSTITIKGK---DCLNE-TSYKVLSDRIEAGTYMFAAAITKGDVKICGIDYN
MURA_CHLT3        GAKISGIGTTTLEIEGV---DELYP-IRADNICDRIEAGTLLAAAAITHGNITLTDVDPD
MURA_AQUAE        GAHVKVEGRS-AYVKGS---ENLKG-FTHSVIPDRIEAGTFMVGAVLTDGEILLENARIN
MURA_FUSNN        GAKISGVGTSRLEIDGV---DKLTA-CEYTIIPDRIVAGTYIIASILFDGSIKVSGIVPE
MURA_BDEBA        GAKITGHGTSVIRIEGV---AKLTP-AKHSIMPDRIEAGTLLIAGAITKGQVTVTKCVPA
MURA_THEMA        GGHIEGAGTSRIVIEGV---EKMQG-VEYSIIPDRIEAGTYLVAIAASRGKGLVKNVNPD
MURA_PSELT        GCKVFGAGTRRIEIFGV---EKTRE-CTHRIIPDRIEAGTYAIAVAATMGDAVIENLQVS
MURA_DEIRA        GARIEGAGTNTITIHGV---KELHG-GEYTVIPDRIEAGTFMMLAAATRSRLTLTNVRPD
MURA_DEIDV        GADIQGAGTNTLVIRGV---QQLRG-GEYTVIPDRIEAGTFMMLAAATRSQLTVRNVRPD
MURA_ANAMF        GAQISGIGTRTLQICGV---QQLSG-PSHTIIRDRMEAGTYALAAISTGGSVHIAGVTSE
MURA_NOSS1        GANIQGAGTSTITIVGV---PKLHS-VDYSIIPDRIEAGTFLVAGAITRSEITLSSVVPE
MURA_SYNY3        GAQIRGDGSSRIIINGV---EKLHS-TDFPIIPDRIEAATFLCAGAITHSEISLFPVVPD
MURA1_CLOAB       GSDIKKIETGAIIIRGV---KELKG-IKYTPIYDRIEAGTFIIAAAITKSKIKINGVEEK
MURA1_CLOPE       GAKIYIEKPGKIIIEGV---DSLTS-TEYTPIYDRIEAGTFMVAAAITGSEIKINGVNKD
MURA1_CALS4       GANIKGAGTDTIRIEGV---KELKG-AEHTVIPDRIEAGTFMVAAAMTGGNVLIENVIVD
MURA1_BACSU       GGKIRGAGTGTIKIEGV---EKLHG-VKHHIIPDRIEAGTFMVAAAITEGNVLVKGAVPE
MURA1_BACHD       GAKVRGAGTGVIRIEGV---DELVG-AEHTVISDRIEAGTFMVAAAITGGDVFIEGAVAE
MURA1_LISMO       GARVIGAGTEVIRIEGV---KELTA-TEHSIIPDRIEAGTFMIAAAITGGNVLIEDAVPE
MURA1_LACLA       GANVKGAGTDTIIIKGV---EKMHG-ANHSVVQDRIEAGTFMVAAAMTQGDVLIKDAIAE
MURA1_STRP1       GARIRGAGTETLTITGV---THLRG-VEHDVVQDRIEAGTFMVAAAMTSGNVLIRDAVWE
MURA2_CLOPE       GANVKGAGTDVIRIKGV---KELKG-CNYSVVPDQIEAGTFMIAAAATRGDVTIQNVIPK
MURA2_CLOAB       GANIKGAGTDVIRIAGV---EKLKG-CNYSVIPDQIEAATYMIATAACGGCVTIKNVIPK
MURA3_CALS4       GANIKGAGTDTIKITGV---DKLEG-CHYTIIPDQIEAGTYMVAAAATGGDVYVKGVIPT
MURA2_BACHD       GARIKGAGTNVIRIDGV---ESLHG-CRHSIIPDRIEAGTYMILAAAIGQNVLIDNIIPL
MURA2_BACSU       GAKIKGAGTNVIRIDGV---KELHG-CKHTIIPDRIEAGTFMIAGAAMGKEVIIDNVIPT
MURA2_LISMO       GAIIKGAGTDTIRITGV---DHLHG-CHHTIIPDRIEAGTFMVLAAASGKGIRIENVIPT
MURA2_STRP1       GAHIRGAGTDIITIQGV---QKLHG-TRHQVIPDRIEAGTYIALAAAIGKGVKITNVLYE
MURA2_LACLA       GAQVRGAGTDIIRITGV---DEMHG-AQHTVIPDRIEAGTYLALAAAMGDGVIIENVIYE
MURA_LACJO        GAVIRGAGTEVIRIEGV---EELKAQTPHTIIPDRIEAGTYVALAACIGNGIRIHNIIEE
MURA2_LACPL       GAKIRGAGTDVIRIEGV---PALHSRATHTIIPDRIETGTYLSLAASIGDGILLKNVIPE
MURA2_CALS4       GARITGAGTNTIVIEGV---KKLHD-TEYTIIPDRIVAGTYLCAAAMTRGELTVVKALKE
MURA_MYCTU        GAQVEGAGSPTMTITGV---PRLHP-TEHRVIGDRIVAATWGIAAAMTRGDISVAGVDPA
MURA_COREF        GADIEGEGSPKITINGV---EKLHP-TSHEVIGDRIVAGTWAFAAAMTRGDVTVGGIAPR
MURA_CHLTR        GVEITTDNDKTIEIFGC---QDFYS-VEHSIIPDKIEAASFGMAAVVSQGRIFVEQARHE
MURA_CHLTA        GMEITTDNDKTIEIFGC---QDFYS-VEHSIIPDKIEAASFGMAAVVSQGRIFVEQARHE
MURA_CHLAB        GVEITTDNDRTIEIFGC---EDFYE-VDHWVIPDKIEAASFGMAAVLTGGRVFVENAEQH
MURA_PARUW        GAIITIDVDRTIRIQGT---RRFYE-VEHTVIPDRIEAASWGMAAISSKGKVFVEGAQHL
B1VVQ3_STRGG      GAIISMDTDRTIRITGV---DKLDG-YTHRALPDRLEAASWASAALATEGNIYVRGAQQR
C7Q9Z5_CATAD      GAIISVHNDRVVRIIGV---DRLDG-FTHRAVPDRLETASWACAALATGGDIRVIGASQG
I0H0U0_ACTM4      GAIITVHTDRVIEIQGV---PRLYG-YEHKPIPDRIEAASWAAAALATRGEIEVVGARQA
Q83G25_TROWT      GAIITCARDRVIFIEGV---DSLSG-YTHHAISDRNEAASWACAALATRGDIFVRNAEQA
A0LRT2_ACIC1      GARIEFWPDRRVVIEGV---PAVHG-ARARLAGDRNEAFSYLVAGLLTKGDVRVIGCPQE
D6YA03_THEBD      GALIELNPDRRIVIEGV---DRLHG-ASTRLAGDRIEAFSYLVAGLVTGGEVRVHGCHQD
                  *  :         : *                 *                          

MURA_BORBU        HFRLIRHVY-SRLGINFEYDRE------------NVYVRNKQELKVKLDFGGHIPKIDDG
MURA_TREPA        DLRPLGFAF-KKLGVIWSEQEH------------AVSVSASQDLRVNYDFGGMIPKIDDG
I0HYX3_CALAS      HLRMMEMVFVDRLGVRMHLEEDPS---APANERYTLVIEEDQELRVRPDFGGAVPKIDDA
I4B6Y2_TURPD      DLRMIKFVF-ERVGINWRYHEREGKGIAPSGQIVDLVMKSPYALKIQTDVHGEIPKIDDA
MURA_BACFN        NLGIIPESF-RRLGIKLEQRGDD-----------IFVPAQ-DCYQIESFIDGSIMTIADA
C6W0Z9_DYAFD      ELGIIPDVF-KRLGIQMEFRGDD-----------IFIPAQ-ERYRIENYLDGSTLSVADA
A5FNP8_FLAJ1      NLGLIPNTF-RKLGITIEKRNDD-----------IYIPAHKDGYEVKTDIDGSILTIADA
G2Z3S2_FLABF      NLGIIPSTF-RKLGITIEKKGDD-----------IYIPAHTNGYEVKTDIDGSILTIADA
F6GG77_LACS5      DLGQIPNVF-RKLGITVERRGDD-----------IFIPKHTDGYEIQNYIDGSILTIADA
MURA_THEFY        HLGVARWKL-EQMGVQFTQQGAV------------------LRVRRDPNVPLRPINAVTS
MURA_RHIME        LLDTALEAI-RRAG-------------------AQISETNSGIRIVRNGAGIKPVDIVTD
MURA_AGRFC        LLDNALDTL-RLAG-------------------VTISDTDTGLRVVRNGNGIQPVDIVTE
MURA1_RHILO       LLQTALDVI-SQTG-------------------AEITQTNSGIRVKRNGAGISPVDVTTA
MURA_NITWN        LLQAALDVL-TEAG-------------------AEITPNNEGIRVARNGAGINPVTVSTA
MURA_CAUVC        LIDALLDKL-KEAG-------------------ASVEETADGCIIRRNGQRLTAVDIETA
MURA_RUEPO        LVGAFVEKL-DAAG-------------------IDVAETDKGLKVSRRNGRVSAVNVTTE
MURA2_RHILO       HMASVVQLL-EATG-------------------VSVWPGDRGLIVSRERP-LKAADLTTE
MURA_PSEAE        ILEAVLQKL-EEAG-------------------AHISTGSNWIELDMKGNRPKAVNVRTA
MURA_PSEPK        ILEAVLEKL-KEAG-------------------ADINTGEDWIELDMHGKRPKAVNLRTA
MURA_HAHCH        ILEAVLLKL-DEAG-------------------AHISTGPDWIELDMKGARPKAVSLRTA
MURA_XYLFA        TLDAVLGKL-TEAG-------------------ACIEIGEDSIRLDMQGRRPCSVNLTTA
MURA_RALSO        ILDAVLDKL-REAG-------------------VTLTMGDDWIRVQMHG-RPKAVSFRTS
MURA_NEIMB        TMEVVLDKL-VEAG-------------------AVIEAGDDWIAIDMRQ-RPKAVDIRTV
MURA_ECOLI        TLDAVLAKL-RDAG-------------------ADIEVGEDWISLDMHGKRPKAVNVRTA
MURA_ECO57        TLDAVLAKL-RDAG-------------------ADIEVGEDWISLDMHGKRPKAVNVRTA
MURA_SALTY        TLDAVLAKL-RDAG-------------------ADIEVGEDWISLDMHGKRPKAVNVRTA
MURA_YERPE        TLDAVLAKL-REAG-------------------ADIEVGDDWISLDMQGKRPKAITFRTA
MURA_VIBCH        LLEAVLAKL-EEAG-------------------AEIECGEDWISLDMTGRELKAVTVRTA
MURA_HAMD5        TLEAVLAKL-HEAG-------------------AQIEVGKDWISLDMKGKRPKAVNVRTT
MURA_HAEIN        TLDAVIDKL-REAG-------------------AQVDVTENSITLDMLGNRPKAVNIRTA
MURA_PASMU        TLDAVIDKL-REAG-------------------AQVDVTENSITLDMLGNRPRAVNIRTA
MURA_BUCAI        HLTNVLMKL-TEAG-------------------AKIKTGKDWIKLDMRGKRPKSLNICTA
MURA_HELPY        HLQAITDKL-IEIG-------------------FSLDIQENSIEIHPAK-KRQAFEITTK
MURA_HELHP        HLSAITDKL-EEIG-------------------FGFNKSEHSLTLLPAQ-SLKPFEIITT
MURA_ARCB4        HLEAVISKL-EEMN-------------------FEVLQDENSVTILPTN-EIKPVNIITT
MURA_PELUB        IISTEINIL-KKVG-------------------SKITLKKNEILIQGSK-KIKNINIKTS
MURA_RICPR        IIENIALKL-IETG-------------------IKVVQINNGVQVTYKG-KLNSVDLETN
MURA_CHLT3        HLTAILEKF-KEIG-------------------CEVSTTETAITLSAPE-TLLPSNVEAL
MURA_AQUAE        HLRAVVEKL-KLIG-------------------GEVVEENGNLRVFRKE-SLRACDIETQ
MURA_FUSNN        HLSSFLLKL-EEMG-------------------TKFKIEGDKLEVLTKLSDLKPAKVTTM
MURA_BDEBA        HLEALILKM-REAG-------------------FKIETTKDTMTVFP-CDQWEAVDITTA
MURA_THEMA        HLTNFFEKL-EETG-------------------AKLKVLG-NEVEIEMRERPKAVDVTTN
MURA_PSELT        HLVALFDVL-RSAG-------------------VEIQQIDETAIRIKMNQRPQPVKVQIT
MURA_DEIRA        HLRAVTSKL-AEMG-------------------VDIQEDGNRMVVDARGRDLKPVNVTTQ
MURA_DEIDV        HLRAVSAKL-QEMG-------------------VDILEAGNSLIVDARQRELRPVNVTTQ
MURA_ANAMF        MLGCLAHEL-EGMG-------------------GKVTDVPDGLVVLRHSPQINPVVLHTA
MURA_NOSS1        HLIPLIAKL-RDIG-------------------VTIIEESPDCLRILPAEILKATDIDTL
MURA_SYNY3        HLASAIAKL-REIG-------------------PEVAIDAPDRVRLIPRD-LRGTDIETL
MURA1_CLOAB       SIKPMIAKF-CEMG-------------------INMEIDGKSLIIDG-RNELKPVDIKTM
MURA1_CLOPE       HCSAIISKL-KEAGTEF----------------FDIHNDENSIIVKG-NEEIKPINIKTM
MURA1_CALS4       HVRSVIAKL-TECG-------------------VKITEEKGGLRVKG-VKNYKAVDIKTL
MURA1_BACSU       HLTSLIAKM-EEMG-------------------VTIKDEGEGLRVIG-PKELKPIDIKTM
MURA1_BACHD       HLRPLIAKM-HEMG-------------------VKTIEEDNGIRVIG-PDELKPVDIKTM
MURA1_LISMO       HISSLIAKL-EEMG-------------------VQIIEEENGIRVIG-PDKLKAVDVKTM
MURA1_LACLA       HNRPLISKL-SEMG-------------------VNFIQEESGLRVVG-PEKLKATSVKTL
MURA1_STRP1       HNRPLISKL-MEMG-------------------VSVTEEEYGIRVQANTPKLKPVTVKTL
MURA2_CLOPE       HLESISAKL-LEMG-------------------AKVEEGDDSVRVYVDGD-LKGVNLKTA
MURA2_CLOAB       HLESISAKL-IEMG-------------------ADIKEGDDYVTIESHKN-LKGVNIKTL
MURA3_CALS4       HLESIIAKL-VEMG-------------------VIVEEYDDVIRVRREGP-LKRVDIKTL
MURA2_BACHD       HVESLIAKL-REMG-------------------VDVEVLDDQVRIRNHQE-KKGVDIKTL
MURA2_BACSU       HLESLTAKL-REMG-------------------YHIETSDDQLLIVGGQKNLKPVDVKTL
MURA2_LISMO       HLEGIIAKL-TEMG-------------------VPMDIEEDSIFI-GEVENIKKVDIKTY
MURA2_STRP1       HLESFIAKL-EEMG-------------------VRMTVEEDAIFVEKQES-LKAITIKTS
MURA2_LACLA       HLESFIAKL-EEMG-------------------VGLTIREDSIEVHKSEN-LKSVNITSV
MURA_LACJO        HLDSYLAKV-EEMG-------------------VVIDADEDSLYVYPAGD-LKMIQVRTD
MURA2_LACPL       HMESFTAKL-VEMG-------------------VDLQINEDSIYVPRSND-LDPIRVKTM
MURA2_CALS4       HLEPLISKL-KETG-------------------CELKTGNDYIKITCNKRPKAVDMIVTL
MURA_MYCTU        HLQLVLHKL-HDAG-------------------ATVTQTDASFRVTQYE-RPKAVNVATL
MURA_COREF        YLHLPLEKL-KLAG-------------------AQVDTFENGFRVVMNK-RPKSTDYQTL
MURA_CHLTR        HMIPFLKVLRSIGGGFSVHEN--------------------GIEFFYDKPLKGGVLLETD
MURA_CHLTA        HMIPFLKVLRSIGGGFSVHEN--------------------GIEFFYDKPLKGGVLLETD
MURA_CHLAB        LMIPFLKTLRSIGGGFSVTET--------------------GIEFFYNEPLKGGVVLETD
MURA_PARUW        NMITFLNKLREVGGGFDVRSN--------------------GIEFFYDGPLQGGLHLETD
B1VVQ3_STRGG      SMMTFLNTYRKVGGAFEIDDE--------------------GIRFWHPGGALNAIALETD
C7Q9Z5_CATAD      EMMTFLNVFRRIGGDFEVDDAP----------------GNPSIRFWHSGGQMRALALETD
I0H0U0_ACTM4      DMMTFLNVFRSIGGELKITDDRIAR--------PGVTGAEGGIKFWHPGGELKAVALETD
Q83G25_TROWT      HLLAFLSVYRKVGGVFEIKDD--------------------GIRFFHPGGNLNPVVVETD
A0LRT2_ACIC1      RLVTAITTLQRMGARVDIDDY--------------------GITATAPEG-LRPAAVQTD
D6YA03_THEBD      RLVTAITTLARMGAQFTITDE--------------------WLTATAPDG-LRPAAVQTD
                                                                              

MURA_BORBU        PWPAFPTDLMSIIVVTATQVE-GTVLVFEKMFESRMFFVDKLIKMGARIVLCDPHRVVVT
MURA_TREPA        PWPAFPPDLTSIMTVVATQVE-GVILIHEKMFESRMFFVDKLITMGARIILCDPHRALVS
I0HYX3_CALAS      PWPAFPPDLMSIALVTATQAQ-GTVIIHEKMYESRLFFVDKLIAMGAQIILCDPHRAVVV
I4B6Y2_TURPD      PWPMFPADLISIILTVATQCS-GTVLIHEKLFESRLYFTDKLMGMGAQIVLCDPHRAVII
MURA_BACFN        PWPGLTPDLLSVMLVVATQAK-GSVLIHQKMFESRLFFVDKLIDMGAQIILCDPHRAVVI
C6W0Z9_DYAFD      PWPGFTPDLLSIVLVTATQAQ-GTVLIHQKMFESRLFFVDKLIEMGAQIILCDPHRATVI
A5FNP8_FLAJ1      PWPGFTPDLLSIVLVVATQAK-GDVLIHQKMFESRLFFVDKLIDMGAKIMLCDPHRAVVM
G2Z3S2_FLABF      PWPGFTPDLLSIILVVATQAK-GDVLIHQKMFESRLFFVDKLIDMGAKIMLCDPHRAVVM
F6GG77_LACS5      PWPGFTPDLLSIVLVVATQAK-GEVLVHQKMFESRLFFVDKVIDMGAKIILCDPHRATII
MURA_THEFY        PFPGFATDLQPPLMALATLAE-GESYIREAIFDGRFALADELNKMGAKIEVEG-NRAIVH
MURA_RHIME        PFPGFPTDLQAQFMGLMTRSS-GVSHITETIFENRFMHVQELARLGAKISLSGQTAKVEG
MURA_AGRFC        PFPGFPTDLQAQFMALMTRSQ-GVSHITETIFENRFMHVQELARLGAKISLSGQMARIEG
MURA1_RHILO       PFPAFPTDLQAQFMGLMTMAK-GKSRITETIFENRFMHVQELARLGAHITLSGQTAIVDG
MURA_NITWN        PFPGFPTDLQAQLMALMTRAR-GTSHITETIFENRFMHVQELARLGARIHLDGETATIEG
MURA_CAUVC        PFPGFATDLQAQFMALMTTAK-GESRIRETIFENRFMHAPELMRLGADISVSGGEARVRG
MURA_RUEPO        PFPGFPTDLQAQMMALLCTAE-GTSVLEEKIFENRFMHAPELTRMGARIEVHGGTATVRG
MURA2_RHILO       PYPGFPTDLQAQFMALMCCAE-GASLLRETIFENRFMHVPELMRLGANIKLQGTMALVRG
MURA_PSEAE        PYPAFPTDMQAQFISMNAVAE-GTGAVIETVFENRFMHVYEMNRMGAQILVEGNTAIVTG
MURA_PSEPK        PYPAFPTDMQAQFISLNAIAE-GTGAVIETIFENRFMHVYEMHRMGAQIQVEGNTAIVTG
MURA_HAHCH        PYPAFPTDMQAQFVAMNTVAE-GTGAIVETVFENRFMHVQELRRMGAKIKLEGNTAIVEG
MURA_XYLFA        PYPGFPTDMQAQFMALNCVAE-GVGVIKETIFENRFMHVDELLRLGAKIQIEGHTAIVQG
MURA_RALSO        EYPAFPTDMQAQFMMLNCIAE-GAALVTETIFENRFMHVQELNRLGANIITEGNTAAVTG
MURA_NEIMB        VHPGFPTDMQAQFMALNAVAE-GSCRVVETIFENRFMHVPELNRMGANITTEGNTAFVQG
MURA_ECOLI        PHPAFPTDMQAQFTLLNLVAE-GTGFITETVFENRFMHVPELSRMGAHAEIESNTVICHG
MURA_ECO57        PHPAFPTDMQAQFTLLNLVAE-GTGFITETVFENRFMHVPELSRMGAHAEIESNTVICHG
MURA_SALTY        PHPAFPTDMQAQFTLLNLVAE-GTGFITETVFENRFMHVPELSRMGARAEIESNTVICHG
MURA_YERPE        PHPGFPTDMQAQFSLLNLVAE-GTGVITETIFENRFMHVPELIRMGAHAEIESNTVICYG
MURA_VIBCH        PHPGFPTDMQAQFTLLNMMAK-GGGVITETIFENRFMHVPELKRMGAKAEIEGNTVICGD
MURA_HAMD5        PYPGFPTDMQAQFTLLNIVAT-GTGVITETIFENRFMHVPELIRMGAQVKIESNTVICHG
MURA_HAEIN        PHPGFPTDMQAQFTLLNMVAE-GTSIITETIFENRFMHIPELIRMGGKAEIEGNTAVCHG
MURA_PASMU        PYPGFPTDMQAQFTLLNMVAC-GTSIITETIFENRFMHIPELIRMGGKAEIEGNTAICHG
MURA_BUCAI        PYPGFPTDMQAQFALLNSISK-GIGTITETIFENRFIYTSELIRMGAKIKIKNNTIICYG
MURA_HELPY        EYPGFPTDMQAQFMALATQCL-GTSVIEETLFENRFMHASELQRLGANISLKTNVATISG
MURA_HELHP        EYPGFPTDMQAQFMALATQCE-GTSVIEERLFENRFMHVSELQRLGADISLKGNHATIKG
MURA_ARCB4        EYPGFPTDMQAQFMALATQAN-GTSTIDERLFENRFMHVSELLRLGADIHLNGNIATING
MURA_PELUB        PYPGFPTDLQAQMMVLLCKAN-KRSHIKEEIFENRFMHVAELNRMGAKISINGNQASIEG
MURA_RICPR        PYPGFATDLQAQFMSLMSISS-GVSMITENIFENRFMHVPELCRMGADIVVRGNKAVVRG
MURA_CHLT3        PYPKFPTDMQAQWIALMTQAN-GISQIIDQVYTERFNHVPELNRLGGEITVKNNMATVHG
MURA_AQUAE        VYPGFPTDMQAQFMALLSVAK-GKSRIKENIFEHRFHHAQELNRLGANITVRGNTAYVEG
MURA_FUSNN        PHPGFPTDLQSPMMTLMCLVN-GTSEIKETIFENRFMHVPELNRMGAKIEIDSSTAKITG
MURA_BDEBA        PHPLFPTDLQAQFMALMTVAH-GTSVITETVFENRFMHVTELSRLGADITPKTRVAVVRG
MURA_THEMA        PYPGFPTDLQPQMMAYLSTAS-GVSVITENVFKTRFLHVDELKRMGADIEVSGNVAIVKG
MURA_PSELT        PYPGYPTDLQPQIITFLSIAT-GTSTVSETVFKSRFQHVDELRRLGAKIEVNDGTAIIYG
MURA_DEIRA        SYPGFPTDLQPQMSALLATVP-GTSVIQDPVYPDRLTHVAELHRMGATITVSGYTQVIQG
MURA_DEIDV        SYPGFPTDVQPQMSALLATVP-GTSVVQDPVYPDRLTHVAELHRMGANITVSGYTQVIQG
MURA_ANAMF        PYPGFPSDMQAQFAATACLAR-GTSQIHEHVFDRRFSYARELAKMGADIHVQGNTASIRG
MURA_NOSS1        PHPGFPTDMQAPFMALLTLAE-GDSIINESVFENRLRHASELNRLGADIRVKGNTAFVRG
MURA_SYNY3        PYPGFPTDMQAQFMALLAVSE-GNSVVTETVFENRLQHVAELQRMGANIKLKGNAAFIQG
MURA1_CLOAB       PYPGFPTDMQAQIMSLLCCTE-GTSVITETIFENRFMHVPELKRFGANIKIDGRSAVIVG
MURA1_CLOPE       PYPGYPTDMQSQMMSLLSIAK-GSSIITESVFENRFMNVDELRRMGANIQVEGRTALIEG
MURA1_CALS4       PYPGFPTDMQAQMMAMMTVAK-GTSVIIETVFENRFMHVSELKRMGANIKIEGRSAMITG
MURA1_BACSU       PHPGFPTDMQSQMMALLLRAS-GTSMITETVFENRFMHAEEFRRMNGDIKIEGRSVIING
MURA1_BACHD       PHPGFPTDMQSQMMALLLRAN-GTSVITETVFENRFMHVEEFRRMNGNIKIEGRSAIISG
MURA1_LISMO       PHPGFPTDMQSQMMVIQMLSE-GTSIMTETVFENRFMHVEEMRRMNADMKIEGHSVIISG
MURA1_LACLA       PHPGFPTDMQSQMTAAQAVAV-GESVMVETVFENRFQHLKEMRRIGLEVDITRNTALIQG
MURA1_STRP1       PHPGFPTDMQAQFTALMAVVN-GESTMVETVFENRFQHLEEMRRMGLQSEILRETAMIHG
MURA2_CLOPE       PYPGFPTDVQQPMCTLLSTAK-GRSIIVETIWENRHKHVDELKKMGATIKVEGRSAIIDG
MURA2_CLOAB       PYPGFPTDAQQPMSTLLSISQ-GRSIVNESIWESRLKHVDELKKMGANIKVEGTVAIIDG
MURA3_CALS4       PYPGFPTDMQQPFAVLLALAD-GISVITENIYENRFRYLEELKKMGMKVRVEGRSAIIEG
MURA2_BACHD       VYPGFPTDLQQPATTLLTQAH-GTSIVTDTIYNARFKHIDELRRMGADIKVEGRSAIING
MURA2_BACSU       VYPGFPTDLQQPMTALLTRAK-GTSVVTDTIYSARFKHIDELRRMGANMKVEGRSAIITG
MURA2_LISMO       AYPGFPTDLQQPLTALLTRAE-GSSVITDTIYPSRFKHIAELERMGGKFKLEGRSAVISG
MURA2_STRP1       PYPGFATDLQQPLTPLLLKAD-GRGTIIDTIYEKRINHVPELMRMGADISVIGGQIVYQG
MURA2_LACLA       PYPGFATDLQQPITPLLLKAK-GRGSIVDTIYQKRVNHVPELARMGANISVLDDRIIYDA
MURA_LACJO        VYPGFATDLQQPITPLLLTAKSGEGVVIDQIYPKRVGHIPELQKMGANIQVEDNIILVHP
MURA2_LACPL       TYPGFATDLQQPITPLLLRAN-GSSVVIDTIYPQRTQHVEQLRKMGADIRVQDNLIVVGH
MURA2_CALS4       PYPGFPTDLQPQIVSVLSIAE-GTSIVTETIFDNRFKYTEELVRMGADIKVEGRVAVIRG
MURA_MYCTU        PFPGFPTDLQPMAIALASIAD-GTSMITENVFEARFRFVEEMIRLGADARTDGHHAVVRG
MURA_COREF        PFPGFPTDLQPMAIGLNAIAD-GVAVVTENVFESRFRFVDEMQRLGADTSVDGHHVVIRG
MURA_CHLTR        VHPGFITDWQQPFAVLLSQSE-GCSVIHETVHENRLGYLKGLVKMGAHCDLFHECLSAKS
MURA_CHLTA        VHPGFITDWQQPFAVLLSQSE-GCSVIHETVHENRLGYLKGLVKMGAHCDLFHECLSAKS
MURA_CHLAB        VHPGFLTDWQQPFSVLLSQAE-GSSVIHETVHENRLGYLRGLQKMGANCELFYQCLSSKA
MURA_PARUW        VHPGFMTDWQQPFVVLLTQSS-GTSVVHETVYENRFGYTDTLKEMGADITPFRQCLGGKS
B1VVQ3_STRGG      VHPGFQTDWQQPLVVALTQAA-GLSIVHETVYESRLGFTSALNQMGAHIQLYRECLGGSD
C7Q9Z5_CATAD      VHPGLSTDWQQPLVVALTQAH-GLSIIHETVYEQRLGFTEALNRMGAQIQLYRECLGGSA
I0H0U0_ACTM4      VHPGFMTDWQQPLVVALTQAR-GISIMHETVYEQRLGYTEALNQMGATIQVYRDCLGGTP
Q83G25_TROWT      VHPGFSTDWQQPLVVALTQAS-GRSVVHETVYESRFGFTEALNRMGADISVHENGFQGTL
A0LRT2_ACIC1      THPGFMTDWQTPLMMLFTQAR-GMSVLHETVYEDRLVYVPALQAMGAEIELFATCLGGPA
D6YA03_THEBD      THPGFMTDWQTPLVVLFTQAD-GMSVLHETVFENRLVYVPALQKMGCEIEVFAQCLGGPA
                    *   .*                  : : :   *      .  :.              

MURA_BORBU        G---------------KSSLKGNVLSSPDVRAGMSLLIAAFVAEG-RSEIQNVYQIERGY
MURA_TREPA        G---------------PSALHGSDLVSPDVRAGMAMVLAACCARG-VSIIRNVYQIERGY
I0HYX3_CALAS      G---------------PSRLTGQQVTSPDIRAGMALVLAALAAEG-VTTIGNVQQIDRGY
I4B6Y2_TURPD      G---------------PSKLYGSRMTSPDIRAGMALVIAALAAEG-ESVIQNIVQVDRGY
MURA_BACFN        GHNH------------GFTLRGGNMTSPDIRAGIALLIAAMSAEG-ISRIHNIEQIDRGY
C6W0Z9_DYAFD      GHNR------------ETQLRGIRMTSPDIRAGVALLIAAMSAKG-VSIIDNIEQIDRGY
A5FNP8_FLAJ1      GHNF------------ESQLKATTMSSPDIRAGISLLIAALSAKG-TSTIQNIEQIDRGY
G2Z3S2_FLABF      GHNF------------ESQLKATVMSSPDIRAGISLLIAALSAKG-TSTIQNIEQIDRGY
F6GG77_LACS5      GHDF------------KSQLKATTMTSPDIRAGISLLIAALSAKG-TSTIHNIEQIDRGY
MURA_THEFY        G---------------PSELHGTKVTAHDLRCGAGAIMAGLVAKG-ETIVSPAYQVDRGH
MURA_RHIME        ----------------VSRLKGAPVMATDLRASVSLVIAGLAAEG-ETMVSRVYHLDRGF
MURA_AGRFC        ----------------VTRLKGAPVMATDLRASVSLVIAGLVAEG-ETMVSRVYHLDRGF
MURA1_RHILO       ----------------VAKLKGAPVMATDLRASVSLVIAGLAAEG-ETTVNRVYHLDRGF
MURA_NITWN        ----------------IETLRGAPVMATDLRASVSLVIAGLAGEG-ETMVNRVYHLDRGF
MURA_CAUVC        ----------------VDQLEGAQVMATDLRASVSLVIAGLVARG-ETTVSRIYHLDRGF
MURA_RUEPO        ----------------VERLKGAPVMATDLRASVSLILAGLAAEG-ETLVSRVYHLDRGY
MURA2_RHILO       ----------------GEKLHGAQVMATDLRASVSLVLAALVSEG-ETIINRVYHLDRGY
MURA_PSEAE        ----------------VPKLKGAPVMATDLRASASLVIAGLVAEG-DTLIDRIYHIDRGY
MURA_PSEPK        ----------------VKALKGAPVMATDLRASASLVLSALVAEG-DTLIDRIYHIDRGY
MURA_HAHCH        ----------------VESLTGAPVMATDLRASASLVIAGLVAEG-DTLVDRIYHIDRGY
MURA_XYLFA        ----------------VERLSGAPVMATDLRASASLILAGLVAEG-ETIIDRIYHLDRGY
MURA_RALSO        ----------------VEQLSGATVMATDLRASASLVIAGLVAQG-ETLVDRIYHLDRGY
MURA_NEIMB        ----------------VEQLSGAVVKATDLRASASLVIAGLAARG-ETVVEQIYHLDRGY
MURA_ECOLI        ----------------VEKLSGAQVMATDLRASASLVLAGCIAEG-TTVVDRIYHIDRGY
MURA_ECO57        ----------------VEKLSGAQVMATDLRASASLVLAGCIAEG-TTVVDRIYHIDRGY
MURA_SALTY        ----------------VETLSGAQVMATDLRASASLVLAGCIAEG-TTIVDRIYHIDRGY
MURA_YERPE        ----------------VEQLSGAQVMATDLRASASLVLAGCIAEG-VTIVDRIYHIDRGY
MURA_VIBCH        ----------------VDRLSGAQVMATDLRASASLVIAGCIAKG-ETIVDRIYHIDRGY
MURA_HAMD5        ----------------VERLSGAGVMATDLRASASLVLAGCIAQG-ITTVERIYHIDRGY
MURA_HAEIN        ----------------VEQLSGTEVIATDLRASISLVLAGCIATG-ETIVDRIYHIDRGY
MURA_PASMU        ----------------VDHLSGAEVMATDLRASISLVLAGCIATG-ETIVDRIYHIDRGY
MURA_BUCAI        ----------------IPKLISSNVFSSDLRASATLILAGCIAAG-ITIVNHTYHLVRGY
MURA_HELPY        ----------------STELTGSDVMATDLRASSALVLAALVAKG-VSRVHRIYHLDRGY
MURA_HELHP        ----------------ISPLLGADVMATDLRASSALVVASLVSEG-TTNIHRIYHLDRGY
MURA_ARCB4        K---------------MGSLNGTDVMATDLRASSALVLAALVANG-ETNIHRIYHLDRGY
MURA_PELUB        ----------------NIKFEAAELMATDLRASVSLILAALAAKG-KSVINRIYHLDRGY
MURA_RICPR        ----------------VEMLKGAEVMASDLRASVSLILAGLSTNS-KTVLHRIYHLDRGF
MURA_CHLT3        ----------------VKPLSGAKVMSTDLRASASLILAGLAAKG-TTEVLRVYHLDRGY
MURA_AQUAE        ----------------VERLYGSEVYSTDLRASASLVLAGLVAQG-ETVVRDVYHLDRGY
MURA_FUSNN        V---------------E-NFSSAEVMASDLRAGASLILAALKANG-ESLVNRIYHVDRGY
MURA_BDEBA        C---------------PGKLTGAPVMATDLRASASLVLAGLVASG-ETVVSRIYHLDRGY
MURA_THEMA        ----------------VEKLSGAPVEGTDLRATAALLIAGIIADG-VTEISNVEHIFRGY
MURA_PSELT        ----------------VENLSGAQVNATDLRAAAALVIAGLMASG-TTSINEVDQIFRGY
MURA_DEIRA        -----------------GTLHAAPVKAADLRAGAALFIAGLTCEG-ETVIDGVQYLNRGY
MURA_DEIDV        -----------------SALHAAPVKAADLRAGAALFIAGLTCTG-ETVIDGVQYLNRGY
MURA_ANAMF        ----------------VDKLHGASVQAPDLRASAALLIAGLSAQG-VTTISNVQTLYRGY
MURA_NOSS1        ----------------VPLLSGAPVIGTDLRASAALVIAGLAAEG-KTTIQGLHHLDRGY
MURA_SYNY3        ----------------VPFLSGAPVMSTDLRASAALVIAGLAAEG-KTIVQGLRHLDRGY
MURA1_CLOAB       ----------------VKELTGCSARATDLRAGAALILAGLVAEG-ETQISDIYHVDRGY
MURA1_CLOPE       ----------------VDNLTGCEVKATDLRAGAALILAGLVAKG-ETIVTDIYHIDRGY
MURA1_CALS4       ----------------VDHLTGAEVKATDLRAGAALVLAGLIAEG-RTEINDIYHVDRGY
MURA1_BACSU       ----------------PVQLQGAEVAATDLRAGAALILAGLVAEG-HTRVTELKHLDRGY
MURA1_BACHD       ----------------PCQLQGAEVTATDLRAGAALVLAGLVADG-HTRVVELKHVDRGY
MURA1_LISMO       ----------------PAKLQGAEVAATDLRAAAALILAGLVADG-YTQVTELKYLDRGY
MURA1_LACLA       ----------------NSNLQGAAVKSTDLRASAALILLGLVAKG-QTTVRRLSHLDRGY
MURA1_STRP1       ----------------GRQLQGAPVMSTDLRASAALILTGIVAQG-VTIVNNLVHLDRGY
MURA2_CLOPE       ----------------VDRLTGAVVKATDLRAGAAMVIAGLISDG-VTEITSIEHIDRGY
MURA2_CLOAB       ----------------VEKLTGANVKATDLRAGAAMVIAALAAEG-VSEISCIEHIDRGY
MURA3_CALS4       ----------------VGKLTGAPVYATDLRGGAAMVIAGLAAEG-ITEVLDIYHIDRGY
MURA2_BACHD       ----------------KTKLQGAKVRASDLRAGASLVIAGLTAEG-ITELSGVEHIDRGY
MURA2_BACSU       ----------------PVELQGAKVKASDLRAGACLVVAGLMADG-VTEITGLEHIDRGY
MURA2_LISMO       ----------------PAKLQGSKVTATDLRAGAALVIAGLLAEG-RTEIHGVEHIERGY
MURA2_STRP1       ----------------PSRLTGAQVKATDLRAGAALVTAGLIAEG-KTEITNIEFILRGY
MURA2_LACLA       ----------------PNELTGSCVQATDLRAGAALVTAGIIASG-TTKISNIEFILRGY
MURA_LACJO        ----------------THHLHGAHVSAGEIRAGACLMLAGLMADG-ETIISNAGNILRGY
MURA2_LACPL       ----------------SSHLQGAHVEAGEIRSGAALMIAGLAASG-VTEISRADNILRGY
MURA2_CALS4       ----------------VDKITGAKVLAKDLRGGVALVIAGLGAEG-TTVVEGAEHIDRGY
MURA_MYCTU        ----------------LPQLSSAPVWCSDIRAGAGLVLAGLVADG-DTEVHDVFHIDRGY
MURA_COREF        ----------------IEELSSTTVWSSDIRAGAGLVIAALCAEG-TTEVRDVFHIDRGY
MURA_CHLTR        CRYSTGNHPHSAVIHGPTPLQATDLVIPDLRAGFAYVMAALIAEGGASWIENTEMLDRGY
MURA_CHLTA        CRYSTGNHPHSAVIHGPTPLQATDLVIPDLRAGFAYVMAALITEGGASWIENTEMLDRGY
MURA_CHLAB        CRYATGNFPHSAIIHGVTPLKASQLVIPDLRAGFAYIMAALIAEGGPSLIKNTQLLDRGY
MURA_PARUW        CRFASQSFSHSAIIKGATPLVGKEIRIPDLRAGFAYIMAALIAND-TSTISGLPFIQRGY
B1VVQ3_STRGG      CRFGQRNFLHSAVVSGPTRLQGADLVIPDLRGGFSYLIAALAAQG-TSRVHGIDLINRGY
C7Q9Z5_CATAD      CRFGQRNFMHSAVISGPTKLHGAELTIPDLRAGFSYLIAALAAQG-TSTVHGISLIHRGY
I0H0U0_ACTM4      CRFGRRNFMHSAVIAGPSKLHAADLRIPDLRAGFAHLIAALAAEG-TSRVYGVNLIERGY
Q83G25_TROWT      RRVPHRAIEQAAVINGPTPLTGQDIDVPDLRGGFSHFIAAFAAEG-KSIITNAGIISRGY
A0LRT2_ACIC1      CRFHDTDAVHSAVVRGVSKLHGTRVEIPDVRAGFSSVIAAAIAEG-TTVLTGVHHLRRGY
D6YA03_THEBD      CRYHDTDAKHSAVVRGVSKLRGADVTLPDIRAGFSAVLAAAVADG-TSTLRGVNHIERGY
                                     : .      ::*     .  .    .  : :     : **.

MURA_BORBU        EDVVNKLINLGAKIKKVKSQ----------------------
MURA_TREPA        ERLVERLQAIGVRIWKEG------------------------
I0HYX3_CALAS      QEIDVKLRALGAHIERVE------------------------
I4B6Y2_TURPD      ENIDARLRSLGAKIERI-------------------------
MURA_BACFN        QNIEGRLNAIGARITRI-------------------------
C6W0Z9_DYAFD      QNIDTRLNAIGAEIVRL-------------------------
A5FNP8_FLAJ1      ERIDERLRAIGAKIVRA-------------------------
G2Z3S2_FLABF      EKIDERLRAIGAHIVRL-------------------------
F6GG77_LACS5      QHIVKRLQRIGAKITRVDS-----------------------
MURA_THEFY        SHFATRLSALGADVVREEVS----------------------
MURA_RHIME        ERLEEKLTRCGAHVERVSD-----------------------
MURA_AGRFC        ERLEEKLTRCGALVERVSD-----------------------
MURA1_RHILO       ERLEEKLSNCGAVIERISA-----------------------
MURA_NITWN        EQLEKKLSACGASIERIRA-----------------------
MURA_CAUVC        ERLEEKLGACGAQVRRIKGDGEAEL-----------------
MURA_RUEPO        EHVVQKLEAVGARIERIKG-----------------------
MURA2_RHILO       EQLDRKLRLCGADIERLSA-----------------------
MURA_PSEAE        ECIEEKLQLLGAKIRRVPG-----------------------
MURA_PSEPK        ECIEEKLQMLGAKIRRVPG-----------------------
MURA_HAHCH        ECIEEKMQLLGAKIRRLPG-----------------------
MURA_XYLFA        ENIEGKLGALGASIRRMT------------------------
MURA_RALSO        DCIEDKLSAVGAKIRRIQG-----------------------
MURA_NEIMB        ENIEKKLGSVGAKIERVSG-----------------------
MURA_ECOLI        ERIEDKLRALGANIERVKGE----------------------
MURA_ECO57        ERIEDKLRALGANIERVKGE----------------------
MURA_SALTY        ERIEDKLRALGANIERVKGE----------------------
MURA_YERPE        ERIEDKLRALGAKIERVKGE----------------------
MURA_VIBCH        ERIEDKLSALGANIERFRD-----------------------
MURA_HAMD5        ECIENKLRKLGAYIERIQGAQ---------------------
MURA_HAEIN        EHIEDKLRGLGAKIERFSGSDEA-------------------
MURA_PASMU        ERIEEKLRGLGARIERFSAQSEES------------------
MURA_BUCAI        ESFPKKLNKIGANIKII-------------------------
MURA_HELPY        ERLEDKINALGAKVARLKEK----------------------
MURA_HELHP        ERLEHKLQHLGVNIVRLKS-----------------------
MURA_ARCB4        ENLEGKLSLIGADVKRSKED----------------------
MURA_PELUB        EDIEKKLKKVGAKIKRIN------------------------
MURA_RICPR        QDLEKKLSNCGANIKRV-------------------------
MURA_CHLT3        ESIEKKLRKLGARIRRQTYDEFAQPQLT--------------
MURA_AQUAE        EKLEEKLKKLGADIERVSEL----------------------
MURA_FUSNN        ENFEEKFKALGANIERIKTEA---------------------
MURA_BDEBA        EKLEDKLSSLGAKIRRIE------------------------
MURA_THEMA        EDVIDKFSELGAKIEYVEKEN---------------------
MURA_PSELT        ENIVEKLSRLSAVVEYFE------------------------
MURA_DEIRA        ERLAERLRGIGGEVMQPEPMLAADD-----------------
MURA_DEIDV        ENLAERLCGIGATAQQTELAVAMD------------------
MURA_ANAMF        EAMEEKLRACGAEVELVR------------------------
MURA_NOSS1        DQIDVKLQQLGAKILRVREEPANAEVAVNNNVSPASIST---
MURA_SYNY3        EDIEGKLRKLGAKLTRI-EQPVTL------------------
MURA1_CLOAB       VSIEKKLTKLGAKIERVE------------------------
MURA1_CLOPE       VEIENKFRALGADISRI-------------------------
MURA1_CALS4       VKMEEKLRALGAKIYRK-------------------------
MURA1_BACSU       VDFHQKLAALGADIERVNDESASEQENKEVVSDLNA------
MURA1_BACHD       VDLAGKLARLGADIERVV-ETEHELENLDAPAPLKLNTNLV-
MURA1_LISMO       NNFHGKLQALGADVERVD-DSKVDVTNLASLF----------
MURA1_LACLA       YKFHEKLKALGADIIRVE-----DEDGEG-------------
MURA1_STRP1       YQFHEKLAKLGATISRSS-----EV-----------------
MURA2_CLOPE       PHIEEKFRMLGADIVRK-------------------------
MURA2_CLOAB       PHIEDKFKELGANIRREKI-----------------------
MURA3_CALS4       EAMEVKLQALGADIIRIRE-----------------------
MURA2_BACHD       EDLEQKLIGLGAKIWREQMSDQEEEQVKSS------------
MURA2_BACSU       SSLEKKLEGLGATIWRERMTDEEIEQLQNS------------
MURA2_LISMO       SKIIEKLSAIGADITRSSTAETNI------------------
MURA2_STRP1       ASIIAKLTALGADIQLIED-----------------------
MURA2_LACLA       DHIIEKLTAVGVDIQLIEE-----------------------
MURA_LACJO        DRIEQKLRQLGAEVSVIDV-----------------------
MURA2_LACPL       DRVIDKLHTLGADVEIAADEEVPEN-----------------
MURA2_CALS4       ESLEKALKSVGADIVRIM------------------------
MURA_MYCTU        PLFVENLVSLGAEIERVCC-----------------------
MURA_COREF        PNFVENLQALGADIQRVVA-----------------------
MURA_CHLTR        TDWRGKLERLGAKVLARDSVSVYV------------------
MURA_CHLTA        TDWRGKLERLGAKVLARDSVSVYV------------------
MURA_CHLAB        YNWVDKLNSLGAKIHLLSLDPVAF------------------
MURA_PARUW        ENFIGKLADLGANVSLVEEEKNVKEMPENSSKLPLFAELQVN
B1VVQ3_STRGG      ENFMEKLEKLGAKVELPGGSLV--------------------
C7Q9Z5_CATAD      EDFEAKLSALGADVELGIPA----------------------
I0H0U0_ACTM4      EDFEAKLAALGAHVERP-------------------------
Q83G25_TROWT      ENFVHKLERLKVDFEA--------------------------
A0LRT2_ACIC1      HRPEENLRALGLHLRAE-------------------------
D6YA03_THEBD      HRPFEQFTSLGLKIKRLT------------------------
                        :