CLUSTAL format seed alignment for MF_00112

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

GGGPS_SULAC       -------MKFRGKVARYISEILE--EGKTLHFSLFDPDKIFDL---------DSLHDIAS
GGGPS_METS5       -------MRIKGKTAKYLQKLID--EGQPIHFSLIDPDKVKDI---------QSLSKVAS
GGGPS_SULIY       MKIRKKKMKLKGKVKKYLMDKLN--DNEKLHFSLLDPFKINSS---------EELKYIAK
GGGPS_SULIM       MKIRKKKMKLKGKVKKYLMDKLN--DNEKLHFSLLDPFKINSS---------EELKYIAK
GGGPS_SACS2       MRILKKKMKLKGKVKKYLIDKLN--DNEKLHFSLIDPFKINSS---------DELKYITK
GGGPS_STAMF       ----------MGKVNKYIVEKIN--NGEKLHFTLIDPDRVNDL---------GKLEETAI
GGGPS_AERPE       ---------MAVKRRRLLEKLLERRSRGRLHFTLIDPDKTGP----------GEAGEIAA
GGGPS_HYPBU       --------MKLGKVERLLRSRVE--SGEKLFLLLSDPEKP-------------ISPNTVK
GGGPS_PYRNV       ---------------MKLYEYLL--EG-TKHFTLIDPDK---S---------VDYLKIAR
GGGPS_PYRIL       ---------------MKLYEYLV--EG-TKHFTLIDPDK---S---------VDYLKIAK
GGGPS_PYRAE       ---------------MNLYEYLL--EG-VRHFTLIDPDK---S---------VDYLKIAK
GGGPS_PYRAR       ---------------MNLYEYLS--QG-IKHFTLIDPDK---S---------VDYLRIAR
GGGPS_PYRCJ       ---------------MKLVDYLL--EGSVKHFTLIDPDK---S---------VDYLKIVR
GGGPS_CALMQ       -----------MTVFESLMNKLT--EKGALHFSLLDPDKV-TM---------DKFIELAK
GGGPS_THEPD       ---------MRGRVKNYILEKIR--EHGAIHMTLIDPEKT-TP---------EVAARIAR
GGGPS_METTH       -----------MKVEDYFHDILR--E-RKIHLTLIDPEEQ-TP---------EEAVEIAR
GGGPS_METTM       -----------MKVEDYFHDILG--E-RKIHLTLIDPEEQ-TP---------EEAVEIAE
GGGPS_METST       -----------MNIENYLNETLK--E-HKLHFTLIDPDEQ-TP---------QEAVEIAK
GGGPS_THEKO       -------MLKLGKVETYIHEKLE--R-EKLHFVLLDPDDV-SP---------ELAGELAS
GGGPS_THEGJ       -------MLEIGKVERYIHEKLK--K-EKLHFVLLDPDDV-SP---------ETAGKIAE
GGGPS_PYRHO       -----MGELRIGKVEKYIHEKLE--K-KKLHFVLIDPDDT-SP---------EVAGKLAR
GGGPS_PYRFU       --------MKIGKVERYIHEKLE--K-KRLHFVLIDPDDT-SP---------EVAGKLAR
GGGPS_THESM       -------MLKIGKVESYIHEKLK--E-EKLHFVLLDPEDV-SP---------RLASKLAK
GGGPS_PYRAB       -------MVKIGKVEMYINEELE--SGKKLHFVLIDPDDT-HP---------EMAGRIAE
GGGPS_METAC       -----------MQVEAHLQKIID--QDGKVHLTLIDPASQ-TP---------ERAAEIAL
GGGPS_METBF       -----------MQVEAHLQKIID--QEGKVHLTLIDPASQ-TP---------ERAAEIAL
GGGPS_METMA       -----------MQVEAHLQKIIE--KDGKVHLTLIDPASQ-TP---------DRAAEIAL
GGGPS_METBU       -----------MQVEEYLNDIAE--REGTVHLTLIDPASQ-SP---------EAAAEIAK
GGGPS_METTP       ---MLRKRVEIGPVESGLWNAVE--TDGAAHLTLIDPASQ-DP---------ERAVQMAR
GGGPS_THEAC       ----------MMTVLEDMLRKTR--N-GKVHMTLIDPGAK-PP---------QECARIAE
GGGPS_THEVO       -----------MTILKQMMRKLK--N-EKIHMTLIDPAAK-SP---------DESAKIAK
GGGPS_PICTO       -----------MTVYNDIIEKLK--R-KKIHMTLIDPASQ-DI---------ESSGRIAE
GGGPS_METM5       ------MQIKIGEIESKLNNIIE--EEGAAYFVLIDP----DE---------KNYREIAN
GGGPS_METM6       ------MQIKIGEVESKLNEIIE--EEGAAYFVLIDP----DE---------KNYRKIAN
GGGPS_METM7       ------MQIKIGEVESKLNKIIE--EDGAAYFVLIDP----DE---------KNYREIAN
GGGPS_METMP       ------MQIKIGEIESKLNKIIE--EEGAAYFVLIDP----DE---------KNYREIAN
GGGPS_METVS       ------MDLKIGKIETELNNILK--KEGALYFVLIDP----DE---------KNYAEVAE
GGGPS_META3       ---------MFGKVEEKLNNVLK--TEGALYFILIDP----DE---------KNCLEIAE
GGGPS_METJA       ------MKIKIGKVEKRLNQIIE--EEGAVYLTLLDP----EE---------ENIEEIAE
GGGPS_KORCO       -----------MSLEERMRKAER--TLLAVLLDPAKL----DD---------EGARKLAR
GGGPS_CENSY       ----------MGAVEARLRSELK--KRKTLLFALIDSEVS-DT---------KSAQDLAR
GGGPS_NITMS       --------MAGNKVETFLKSELK--KKNALLFVLIDSEVS-NL---------EASAKLAK
GGGPS_METKA       --------------MGVFGYLRE--RT-PCHLTLLDPVDVGPE---------E--VPEVL
GGGPS_IGNH4       --------------MGAYDELMK--RRGRALLPLLDPDKVISE---------EDYYERAV
GGGPS_CHIPD       ---------MHNKIYNSFIDRKA--KGIKSFAVLIDPDKVNPA----------DIADLAA
GGGPS_SPILD       --------------MTILRDYKL--SGRKAFAVLLDPDKVEQD----------AFSTLLQ
GGGPS_FLAJ1       -----MEQKILTTIHQQILEAKK--NGQKLLAILLDPDKIVWE----------NLDHLLL
GGGPS_ZUNPS       ----------MPKILDAIIKASK--INKKLLAVLIDPEKFATE----------NYSYFIE
Q26HI8_FLABB      --------------MHNILSRIQ--SGDRAMAFLLDPEKTGIEDLIDTFDHINNLRIVIQ
PCRB_GEOKA        ----------------------MEEIRAWRHVFKLDPNKPIDDER-------------LE
PCRB_GEOTN        ----------------------MEEIRAWRHVFKLDPNKPIDDER-------------LE
PCRB_GEOSW        ----------------------MYDIRQWRHVFKLDPNKGISDEQ-------------LE
PCRB_ANOFW        ----------------------MNEITTWRHVFKLDPNKEITDEQ-------------LE
PCRB_ALKHC        ---------------------MMLEFQEWRHVFKLDPNKELNDDD-------------LE
PCRB_BACCR        ----------------------MYDISGWKHVFKLDPNKELSDEH-------------LE
PCRB_BACC4        ----------------------MYDISGWKHVFKLDPNKELSDEH-------------LE
PCRB_BACC2        ----------------------MYDISGWKHVFKLDPNKELSDEH-------------LE
PCRB_BACAN        ----------------------MYDISGWKHVFKLDPNKELSDEH-------------LE
PCRB_BACHK        ----------------------MYDISGWKHVFKLDPNKELSDEH-------------LE
PCRB_BACCZ        ----------------------MYDISGWKHVFKLDPNKELSDEH-------------LE
PCRB_BACC1        ----------------------MYDISGWKHVFKLDPNKELSEEH-------------LE
PCRB_BACMK        ----------------------MYDISKWKHVFKLDPNKELSDEH-------------LE
PCRB_BACCN        ----------------------MYDISKWKHVFKLDPNKEISDEH-------------LE
PCRB_LYSSC        -----------------------MDYLEWRHVFRLDPAKDISDED-------------LE
PCRB_BACSU        ----------------------MYDVTEWKHVFKLDPNKDLPDEQ-------------LE
PCRB_BACLD        ----------------------MYDITEWKHVFKLDPNKDITDDQ-------------LE
PCRB_BACP2        ----------------------MYDVTEWKHVFKLDPNKEISDEQ-------------LE
PCRB_BACSK        ----------------------MKNYDEWAHVFKLDPNKEITDEA-------------LE
PCRB_OCEIH        ----------------------MKNINEWHHIFKLDPAKEISDEH-------------LD
PCRB_EXIS2        ---------------------MLLPYNEWRHVFKLDPAKEIEEAA-------------LQ
PCRB_STAAN        ----------------------MYDIKKWRHIFKLDPAKHISDDD-------------LD
PCRB_STAAM        ----------------------MYDIKKWRHIFKLDPAKHISDDD-------------LD
PCRB_STAAR        ----------------------MYDIKKWRHIFKLDPAKHISDDD-------------LD
PCRB_STAAB        ----------------------MYDIKKWRHIFKLDSAKHISDDD-------------LD
PCRB_STAA8        ----------------------MYDIKKWRHIFKLDPAKHISDDD-------------LD
PCRB_STAAT        ----------------------MYDIKKWRHIFKLDPAKHISDDD-------------LD
PCRB_STAES        ----------------------MYDITKWKHMFKLDPAKSISDEN-------------LE
PCRB_STAHJ        ----------------------MYDIKAWQHVFKLDPAKEISDND-------------LD
PCRB_STACT        ----------------------MYDIKKWKHVFKLDPAKTISDED-------------LD
PCRB_STAS1        ----------------------MTDMNKWRHIFKLDPAKPISDED-------------LM
PCRB_BREBN        ----------------------MIDYRGWRHTFKLDPDKTIDDEA-------------LE
PCRB_LISW6        ----------------------------MKHLFKLDPAKNLPHNS-------------VT
PCRB_LISIN        ----------------------------MKHLFKLDPAKNLPRNS-------------VT
PCRB_LISMF        ----------------------------MKHLFKLDPAKNLPMND-------------LT
PCRB_LISMC        ----------------------------MKHLFKLDPAKNLPMND-------------LT
PCRB_LISMH        ----------------------------MKHLFKLDPAKNLPMND-------------LT
PCRB_LISMO        ----------------------------MKHLFKLDPAKNLPTND-------------VT
GGGPS_METMJ       ---------------------MHANWKTWAHVTKLDPDKRLPRGA-------------VE
GGGPS_METHJ       ---------------------MHTKWKTWAHVTKLDPDKHLTEDE-------------IA
GGGPS_METB6       -----------------------MKWKDWVHVTKLDPDKQLGPGD-------------ID
GGGPS_METLZ       -----------------------MNWQTWRHITKLDPDKVITKEE-------------IA
GGGPS_METAR       --------------------MAPIDWKKWRHVTKLDPDKKITRQD-------------IA
GGGPS_ARCFU       -----------------------MRWRKWRHITKLDPDRTNTDEI-------------IK
GGGPS_HALMA       ----------------------MSDWADWDHIVKIDPDKTLVDGET------------FE
GGGPS_NATPD       ---------------------MSAPWAEWDHIVKIDPDKTLADGET------------FQ
GGGPS_HALS3       ---------------------MTAPWADWDHVLKIDPDKSLVDGET------------FD
GGGPS_HALWD       ---------------------MNGPWTEWDHVLKVDPDKPLVDGET------------FE
I7BWC9_NATSJ      ---------------------MTTPWDDWNHILKIDPDKELPEGVT------------YG
I3R209_HALMT      ---------------------MSLDWNDITHITKVDPAEPLPQDL---------------
Q9HNW3_HALSA      ---------------------MTIDWGSVTHITKVDPADPLPDDA---------------
D4GW01_HALVD      ---------------------MSFDWSEFEHVTKVDPAKRHPESI---------------
                                                     .                        

GGGPS_SULAC       KLIEAGTDVFLIGGTLGISQDKLDNILSILEEFS--IPLIIFPSNVNLISNKA----DAI
GGGPS_METS5       SLFKAGTSAFLIGGTLGVSKEKLDSILSVLQDFS--VPKIIFPSNINLISEKA----DAI
GGGPS_SULIY       NLYNVGTDAFLIGGTLGVSKDKLDFVISLLDDYE--IPKIIFPSNINLLSEKA----DAL
GGGPS_SULIM       NLYNVGTDAFLIGGTLGVSKDKLDFVISLLDDYE--IPKIIFPSNINLLSEKA----DAL
GGGPS_SACS2       NLYNAGTDAFLIGGTLGVSKDKLDFVISLLDDYE--IPKIIFPSNINLLSEKA----DAL
GGGPS_STAMF       KMAEFGTDAFLIGGSLGVTPEEAGETAKILKKTG--LPVIIFPGNINCLTPYA----DAV
GGGPS_AERPE       RAAEAGSDAILVGGSIGVTFEETDGVVKAAKRSG--LPVILFPGGHTNASRHA----DAV
GGGPS_HYPBU       LFEENGADVLLIGGSLNVTPYDIDEYIARLRVEGVKLPIVLFPGGLNNIAKSA----DAI
GGGPS_PYRNV       YALEAGTDGILVGGSLGIRESQIAQVARDIKSVAH-VPVVIFPGSVSQLTEEA----DGV
GGGPS_PYRIL       YALEAGTDGILVGGSLGIRESQITQVVKDIKSIAH-VPVVIFPGSISQLTDEA----DGV
GGGPS_PYRAE       YALEAGTDGILIGGSLGIRESQIAQVVKDIKNISN-VPVVLFPGSLTQLTDLA----DGV
GGGPS_PYRAR       YALEAGTDGILVGGSLGITASQMEKVVKDIKSVAN-VPVVLFPGSLSQLTDAA----DGV
GGGPS_PYRCJ       YALDAGTDGILVGGSLGIRETQMTQVVKDIKSVAH-VPVVLFPGSPSQLTEEA----DGV
GGGPS_CALMQ       GAEKAGSDALMIGGSYGVNEGTLDNYIDAVKQEVK-LPIILFPGSVAGLSRRA----DAV
GGGPS_THEPD       EVAEAGTSAIMVGGSIGVSEAMTDEVVLAIKRSTE-VPVILFPGSPTALSRHA----DAV
GGGPS_METTH       AAIRGGTDGIMLGGSTTDSSE-LDNTARALRENID-VPIILFPGNTTGVSRYA----DAI
GGGPS_METTM       AAIRGGTDGIMLGGSTTDSSE-LDATAGALRENID-VPIILFPGNTTGVSRHA----DAI
GGGPS_METST       QAKKARSDAILVGGSITDQED-LNITVKSIKEEVD-LPVILFPGNISGVSKYA----DAL
GGGPS_THEKO       MSEEVGVDAIMVGGSTGAEGEVLDSVVRAIKESSN-LPVILFPGSHGGISKYA----DAI
GGGPS_THEGJ       MSEAIGVDAIMVGGSTGAEGEVLDSVVRAIKESSS-LPVILFPGSHGGISRYA----DAI
GGGPS_PYRHO       VCEELGVDAIMVGGSTGAEGEVLDNVVRSIKDNSS-LPVILFPGSHGGISRYA----DAI
GGGPS_PYRFU       VCEELEIDAIMVGGSTGAEGETLDEVVKAIKENYS-LPVILFPGSHGGISKYA----DAI
GGGPS_THESM       ISEEVGVDAIMVGGSTGAEGEVLDGVVKAIKENSS-LPVILFPGSHGGLSKYA----DAV
GGGPS_PYRAB       LCENVGVNAIMVGGSTGAEGEMLDNVVKAIKESSS-LPVILFPGSHSGISKYA----DAI
GGGPS_METAC       AAVEGGTDAIMIGGSTGASGTLLDETVIKIKEKVN-VPTILFPGSSAGLSSYA----DAV
GGGPS_METBF       AAVKGGTDAIMIGGSTGASGTLLDETVIKIKEKVD-VPTILFPGSSAGLSRYA----DAV
GGGPS_METMA       AAVEGGTDAIMIGGSTGASGTLLDETVIKIKENIH-VPTILFPGSSAGLSKYA----DAV
GGGPS_METBU       AAVAGGTDAILIGGSTGAVGVALDQTLIKIKEQVD-VPTILFPGNAGGVSTHA----DAI
GGGPS_METTP       SAADAGTTALMVGGSVGATGSALDRTVRAIKDSVD-LPVILFPSSAAGLCDNA----DAV
GGGPS_THEAC       EAEMAGTDFIMVGGSTDIDSRAMDEAISAIKAKTD-LKVIIFPGSSLMISPKA----DAI
GGGPS_THEVO       EAEMAGTDFIMVGGSTDIDERLMDQTVSAIKENTN-LKVILFPGSSNMISRHA----DAI
GGGPS_PICTO       AAERAGTDFIMIGGSTRINSELMDKTIGAIKSKTS-LKTIIFPGSPEMISPRA----DAI
GGGPS_METM5       HVKDY-ADAIIIGGSIGI--INLDEVTKEIKEITG-LPVILFPGNVDGVTKEA----DAV
GGGPS_METM6       HVKNY-ADAIIIGGSIGI--INLDEVTKEIKEITG-LPTILFPGNVDGVTKEA----DAV
GGGPS_METM7       HVKNY-ADAIIIGGSIGI--ISLDEVTKEIKEITG-LPVILFPGNVDGVTKEA----DAV
GGGPS_METMP       HVKDY-ADAIIIGGSIGI--INLDEVTKDIKEITG-LPIILFPGNVDGVTKEA----DAV
GGGPS_METVS       KVKDY-ADAIIIGGSIGI--TNLDEVTKNIKKITN-LPVILFPGNVDGVTKEA----DAV
GGGPS_META3       KVKDY-ADAIILGGSIGI--TNLDETTKQIKEIIGDIPIILFPGNVDGLTPYA----DAV
GGGPS_METJA       NVKDY-ADAIMVGGSIGI--VNLDETVKKIKKITK-LPIILFPGNVDGLSRYA----DAV
GGGPS_KORCO       AASEGGADLIFVGGSIGAG-FRINEIILSVKKESN-IPIILFPGNVDGVSPYA----DAI
GGGPS_CENSY       GAEKAGASAILVGGSSTGDQAETSRIVGDIKEATT-IPVILFPGNVTGVAPGA----DAI
GGGPS_NITMS       DVEKIGASAILVGGSSATDQIEMAQVVKGIKKGIK-IPIILFPGNVTGVVPDA----DAI
GGGPS_METKA       ESLVKAGTDAVMVGGSTAHASQVEAVVEAIREVAD-VPVILFPNGPEGLAPNA----DAV
GGGPS_IGNH4       KALCEYAATFLVGGSTGVGQIETEKTVALVKKNCD-KPVTVFPGSPCQVAPSA----DAI
GGGPS_CHIPD       KCTAAKVDYIFLGGSLVITNHLDECVQQFKTLCDI--PVVLFPGSPSQVSRYA----DAL
GGGPS_SPILD       RTADYPVDFFLVGGSLVTDYAHKEVIATIRRYSST--PVILFPGNPLHIESSA----DAI
GGGPS_FLAJ1       KINQSPATHIFVGGSIVESTIIEDLIAQLKQKTRL--PVVIFPGDPSQISPKA----DAI
GGGPS_ZUNPS       KLPEA-VTHIFVGGSTATTAQSEVCVDFIKTKTNL--PVILFPGDKEQITEKA----DGI
Q26HI8_FLABB      KEIGVDYFILFVGGSTMIDIDLDKWILAAKEIIKI--PIVIFPGSHHQLTENA----DGL
PCRB_GEOKA        RLCESGTDAVIVGGTDGVTIDNVLDLLARIRR--FSVPCALEVTDVEALTPGF----DVY
PCRB_GEOTN        RLCESGTDAVIVGGTDGVTLDGVLDLLARIRR--FSVPCALEVTDIEALTPGF----DAY
PCRB_GEOSW        RICESGTDAVIVGGTDDVTLENVLELLARIRR--FSVPCVLEISNLESVTPGF----DFY
PCRB_ANOFW        QVCESGTDAIIVGGTDGVTLENVIDLLARVRR--FSVPCALEVSDIEAITPGF----DYY
PCRB_ALKHC        AICESGTDGILVGGSDGVTLDNTLQLLARIRR--FSVSCALEVSNLESITPGF----DHY
PCRB_BACCR        MICESGTDAVIVGGSDGVTIDNVLHMLVSIRR--YAVPCVLEVSDVEAITPGF----DFY
PCRB_BACC4        MICESGTDAVIVGGSDGVTIDNVLHMLVSIRR--YAVPCVLEVSDVEAITPGF----DFY
PCRB_BACC2        MICESGTDAVIVGGSDGVTIDNVLHMLVSIRR--YAVPCVLEVSDVEAITPGF----DFY
PCRB_BACAN        MICESGTDAVIVGGSDGVTIDNVLHMLVSIRR--YAVPCVLEVSDVEAITPGF----DFY
PCRB_BACHK        MICESGTDAVIVGGSDGVTIDNVLHMLVSIRR--YAVPCVLEVSDVEAITPGF----DFY
PCRB_BACCZ        MICESGTDAVIVGGSDGVTIDNVLHMLVSIRR--YAVPCVLEVSDVEAITPGF----DFY
PCRB_BACC1        MICESGTDAVIVGGSDGVTIDNVLHMLVSIRR--YAVPCVLEVSDVEAITPGF----DFY
PCRB_BACMK        MICESGTDAVIVGGSDGITIDNVLHMLVSIRR--YAVPCVLEVSDVEAITPGF----DFY
PCRB_BACCN        MICESGTDAVIVGGSDGVTIDNVLHMLVSIRR--YAVPCVLEVSNVEAITPGF----DFY
PCRB_LYSSC        KICESGTDVILVGGTDNVTLDGVLDLLVRVRR--FEVPIALEISTIDAITPGY----DYY
PCRB_BACSU        ILCESGTDAVIIGGSDGVTEDNVLRMMSKVRR--FLVPCVLEVSAIEAIVPGF----DLY
PCRB_BACLD        QLCESGTDAVLIGGSDHVTEDDVLRLMSKVRR--FLVPCVLEVSTIDAIVPGF----DLY
PCRB_BACP2        AICESGTDAILIGGSDNVTEDNVLQLMSKVRR--FLVPCVLEISTHEMIVPGF----DLY
PCRB_BACSK        AVCESGTDAIIVGGTDNVTLDNTLSLFARIRR--FPVTCALEVSDLEAITPGF----DYY
PCRB_OCEIH        QICESGTDAIIVGGTDNVTLDGVLDLLSRIRRS-HMVPVVLEVSEEETLTPGF----DYY
PCRB_EXIS2        AIATSGTDAIIVGGTDDITLDATLDLLMRLRR--YPVAVALEVSELEAATMGF----DAY
PCRB_STAAN        AICMSQTDAIMIGGTDDVTEDNVIHLMSRIRR--YPLPLVLEISNIESVMPGF----DFY
PCRB_STAAM        AICMSQTDAIMIGGTDDVTEDNVIHLMSKIRR--YPLPLVLEISNIESVMPGF----DFY
PCRB_STAAR        AICMSQTDAIMIGGTDDVTEDNVIHLMSRVRR--YPLPLVLEISNIESVMPGF----DFY
PCRB_STAAB        AICMSQTDAIMIGGTDDVTEDNVIHLMSRVRR--YPLPLVLEISNIESVMPGF----DFY
PCRB_STAA8        AICMSQTDAIMIGGTDDVTEDNVIHLMSRVRR--YPLPLVLEISNIESVMPGF----DFY
PCRB_STAAT        AICMSQTDAIMIGGTDDVTEDNVIHLMSRVRR--YPLPLVLEISNIESVMPGF----DFY
PCRB_STAES        ALCMSNTDAIIIGGTDDVTEDNVIHLMSRVRR--YPLPLVLEVSNVESVMPGF----DFY
PCRB_STAHJ        ALCMSDTDAIMIGGTDNVTEDNVIHLMSRVRR--YPLPLVLEISNIESIIPGF----DFY
PCRB_STACT        KICMSETDAIIIGGTDNVTEDNVIQLMSRVRR--YPLPLVLEISNLESTMPGF----DFY
PCRB_STAS1        KICTSDTDAIMIGGTDDITEENVAHLMHKVKC--YSLPIVLEISNLESVVPGF----DLY
PCRB_BREBN        AICESGTDAIIVGGTYGVTYDNTLELMSRLRR--YAVPAVLEISSLDAVVPGF----DSY
PCRB_LISW6        RLIHSGTDGFIIGGTDNLQTEAVENLYELLAE--TDLPIFLEVSDESMILPEA----EHF
PCRB_LISIN        KLIHSGTDGFIIGGTDNLEIEAVENLYELLAE--TDLPIFLEVSDESMILPEA----EHF
PCRB_LISMF        KLVHSGTNGFIIGGTDNVQIEAVQKLYELLGE--TDLPIFLEISNESMILPEA----DHF
PCRB_LISMC        KLVHSGTNGFIIGGTDNVQIEAVQKLYELLGE--TDLPIFLEISNESMILPEA----DHF
PCRB_LISMH        KLVHSGTDGFIIGGTDNVQIEAVQKLYELLGE--TDLPIFLEISNESMILPEA----DHF
PCRB_LISMO        KLIHSGTDGFIIGGTDNVQIEAVQNLYELLVE--TDLPIFLEISNESMILPEA----DHF
GGGPS_METMJ       EIATSGTDALMLSGTLNVTRENLQELLDLVSA--YGLPLVVEPASPDCAIFDGG--IDHL
GGGPS_METHJ       EIATSGTDALILSGTLNITKDNMSQLRDQVKE--YGLPLVVEPAGPESVIFHG---IDLL
GGGPS_METB6       AIAASGTDALMLSGTLNVTKENLLALQKMIAQ--YDLPLVMEPAGPEAVLMEG---IEYV
GGGPS_METLZ       EIAASETDALMLSGTLDVTPENLAELYDNVRD--AGLPLTVEPADPSCARFEG---IDYV
GGGPS_METAR       AIVDSGTDAVMISGTQNITKENVGNMIDMLAE--YSIPKVLEPS--VSAIIRND--VDFI
GGGPS_ARCFU       AVADSGTDAVMISGTQNVTYEKARTLIEKVSQ--YGLPIVVEPSDPSNVVYDV----DYL
GGGPS_HALMA       DVAATGTDAIEVGGTTGMTEEKMKRVVDACGK--HDIPVYIEPSNPASVVHSDR--HDGY
GGGPS_NATPD       DVCATGTDALEIGGTTGMTEEKMARVVEATAA--HDIPVYIEPSNVGAVVHDED--LDGY
GGGPS_HALS3       DIAQTGTDAIEIGGTLDVTTEKMRRVIDACRT--HEVPLYQEPSNPAVVVEDEA--LDGY
GGGPS_HALWD       DVCQTGTDAIEIGGTLDITTEKMQEVVDACSR--YDMPLYQEPSNPAVVVESDA--LDGY
I7BWC9_NATSJ      DLCATGTDAIEVGGTMGITEENMSAVIEACAE--HDVALYQEPSNPEVVLEDDA--LDGY
I3R209_HALMT      -EILSQTDLVIVGGSDGVTQENSLDAIERVQNQFPDLPVFQEPYGSDHVSSETMDAVDYL
Q9HNW3_HALSA      -SVLGHTDLVIVGGSDGVTESNTLATIERIATEAPDIPVWQEPYSGSHVSKDTIEAVDNV
D4GW01_HALVD      -DVLRHTDAVIVGGSDGVTEENSLAVFERLRAEFPDLPLVQEPYRSAHVSKRTVEVADAV
                             : *                                           :  

GGGPS_SULAC       LFLSLLN-----------------SDDLYYIVGAQIVAAPIIKRI---------GLEVLP
GGGPS_METS5       LFMSLLN-----------------SDDLYYVIGAQVSASIIVKTI---------GLEPIP
GGGPS_SULIY       LFLSLLN-----------------SDDIYYVIGAQIVAAPIIKML---------QMEVIP
GGGPS_SULIM       LFLSLLN-----------------SDDIYYVIGAQIVAAPIIKML---------QIEVIP
GGGPS_SACS2       LFMSLLN-----------------SDDIYYIIGAQIVAAPIIKML---------QMEVIP
GGGPS_STAMF       LFMILMN-----------------SMEQYYLMHAQIAAAPIIKKY---------KLETLP
GGGPS_AERPE       LFLTVMN-----------------SDNPYYIVQAQILGAPLALKL---------GLEAIP
GGGPS_HYPBU       LFMTLMN-----------------SMDPYWIVGAQVAAAPIVYRL---------GLEAIP
GGGPS_PYRNV       LFLSVLN-----------------SLDPYYIIGAQVHGAVLLAKHY-------PRLEVIS
GGGPS_PYRIL       LFLSVLN-----------------SLDPYYIIGAQIQGAVLLAKHY-------PKLEVIS
GGGPS_PYRAE       LFLSVLN-----------------SLDPYFIIGAQIQGAVLIAKHY-------PRLEVIS
GGGPS_PYRAR       LFLSVLN-----------------SLDPYFIIGAQVHGAVLIAKHY-------PRLEVIS
GGGPS_PYRCJ       LFLSVLN-----------------SLDPYFIIGAQVQGAVLIAKHF-------PRLEVIS
GGGPS_CALMQ       LFLSVLN-----------------STDPYYIIGAQVQAAVLMAKHY-------SNLESIP
GGGPS_THEPD       WFLSVLN-----------------SQNPYFITGAQMQGAPIVKRY---------GLEVLP
GGGPS_METTH       FFMSLLN-----------------STNPYWIIGAQALGAATVKKM---------GIEALP
GGGPS_METTM       FFMSLLN-----------------SNNPYWIIGAQALGAPAVKKM---------GIEALP
GGGPS_METST       LFMSLLN-----------------STNPYWITGAQALSAPSIKKM---------GIETIP
GGGPS_THEKO       FFMSLLN-----------------SRNPFFITGAQALGAFQVKRY---------GIEPIP
GGGPS_THEGJ       FFMSLLN-----------------SRNPFFITGSQALGAFTVKRY---------GIEPIP
GGGPS_PYRHO       FFMSLLN-----------------SRNPFFITGAQALGAFTVKKF---------GIEPIP
GGGPS_PYRFU       FFMSLLN-----------------SRNPFFITGAQALGAFRVKKY---------NLEPIP
GGGPS_THESM       FFMSLLN-----------------SRNPFFIAGAQALGAFRVKHY---------GIEPIP
GGGPS_PYRAB       FFMSLLN-----------------SRNPFFITGAQALGAFTVKRY---------GLEPIP
GGGPS_METAC       FFMSLLN-----------------SRDLGYVITNQVLGAPLVYKS---------QIEPIS
GGGPS_METBF       FFMSLLN-----------------SRDLGYVITNQVMGAPLVYQS---------QIEPIS
GGGPS_METMA       FFMSLLN-----------------SRDLGYVITNQVLGAPLVYRS---------QIEPIS
GGGPS_METBU       FFMSLLN-----------------SRDINYIITNQVMGAPVVYKS---------GIEPIS
GGGPS_METTP       FFMSLLN-----------------SRSTSYLIENQALGAPIVSRY---------GIEAIP
GGGPS_THEAC       FFMSLLN-----------------SGSLEYVVGHQVKAAIPLSAM---------KIEKIP
GGGPS_THEVO       FFMSLLN-----------------SSDREFIVGHQVKASKFLSLL---------GIEKIP
GGGPS_PICTO       YYMSLMN-----------------SRNIDFIIGHQVKTSLFLRQL---------AIETIP
GGGPS_METM5       LFMSLMN-----------------SKNTYWNMTAPTLGALTIKKY---------GLETLP
GGGPS_METM6       LFMSLMN-----------------SKNTYWNMTAPTLGALTIKKY---------GLETLP
GGGPS_METM7       LFMTLMN-----------------SKNTYWNMTAPTLGALTIKKY---------GLETLP
GGGPS_METMP       FFMSLMN-----------------SKNTYWNMTAPTLGALTIKKY---------GLETLP
GGGPS_METVS       LFMSLMN-----------------SKNTYWNMTAPTLGALTIKKY---------GLEAIP
GGGPS_META3       FFMSFMN-----------------SNNTYWTTTAPTLGAITVKKY---------NLEPIS
GGGPS_METJA       FYMSLMN-----------------SANTYWVVTAPTLGAITILKY---------NLEPIP
GGGPS_KORCO       LFMSLLN-----------------STNPYWIIQAQALAAIPIRRM---------GLEAIP
GGGPS_CENSY       LFSSLMN-----------------SENPYFITQAQALGAPSVLKF---------GLEALP
GGGPS_NITMS       LFSSLMN-----------------SENPYFITQAQALGAPSVLKF---------GLEPLP
GGGPS_METKA       LFMSLLN-----------------SRNTYYLIEAQVKGAPLVERF---------GLESIP
GGGPS_IGNH4       LFMSLLN-----------------STNRKYLIDYQLEGSLLVYRY---------GLEAIP
GGGPS_CHIPD       LYLSVIS-----------------GRNPELLIGQHVLSAPAVKKS---------GLEVIS
GGGPS_SPILD       LLLSLIS-----------------GRNADFLIGQHVIAAPLLKKS---------GLEILP
GGGPS_FLAJ1       LFLSLLS-----------------GRNPDYLIEYQVQAAPILKKT---------NLEVIS
GGGPS_ZUNPS       LLLSLIS-----------------GRNPEYLIEQHIKAVPKLLNA---------GLEIIP
Q26HI8_FLABB      LFLNLIS-----------------GDNSDYLIGHQRLAAAQLLKS---------KLEIVP
PCRB_GEOKA        LVPIVLN-----------------SRQAEWIIGRHHEAVKQYGDM-------MNWDEIAA
PCRB_GEOTN        LIPMVLN-----------------SCRVDWVIGRHHEAVKQYGDV-------MNWDEIFA
PCRB_GEOSW        FVPMVLN-----------------SREKKWIIDLHHEAVKQFGDI-------MNWDEIFM
PCRB_ANOFW        FIPMVLN-----------------SRDLTWLIDLHHEAVKQFGDL-------INWEELFV
PCRB_ALKHC        FIPSVVN-----------------SGEVKWISGLHHEAVKEFGPI-------MNWDEIVM
PCRB_BACCR        YIPSVLN-----------------SRKVEWVTGVHHEALKEFGDI-------MDWDEIFM
PCRB_BACC4        YIPSVLN-----------------SRKVEWVTGVHHEALKEFGDI-------MDWDEIFM
PCRB_BACC2        YIPSVLN-----------------SRKVEWVTGVHHEALKEFGDI-------MDWDEIFM
PCRB_BACAN        YIPSVLN-----------------SRKVEWVTGVHHEALKEFGDI-------MDWDEIFM
PCRB_BACHK        YIPSVLN-----------------SRKVEWVTGVHHEALKEFGDI-------MDWDEIFM
PCRB_BACCZ        YIPSVLN-----------------SRKVEWVTGVHHEALKEFGDI-------MDWDEIFM
PCRB_BACC1        YIPSVLN-----------------SRKVEWVTGVHHEALKEFGDI-------MDWDEIFM
PCRB_BACMK        YIPSVLN-----------------SRKVEWVTGVHHEALKEFGDI-------MDWDEIYM
PCRB_BACCN        YIPSVLN-----------------SRKVEWLTGVHHEALKEFGDI-------MNWDEIFM
PCRB_LYSSC        FIPTVLN-----------------SDDPKWIKNLHHAAIKEFGDI-------MVWDELVA
PCRB_BACSU        FIPSVLN-----------------SKNADWIVGMHQKAMKEYGEL-------MSMEEIVA
PCRB_BACLD        FIPTVLN-----------------SRDTDWIAGLHKKAMKEYGEL-------MSPEEIVV
PCRB_BACP2        FIPTVLN-----------------SSHPDWIVGLHKDAMKEFGDL-------MSMEEIVP
PCRB_BACSK        LIPSVMN-----------------SQHVSWVIGHHHKAVKEYGEI-------INWQELLL
PCRB_OCEIH        FVPMVLN-----------------SKEKKYMMDIQHKAIKEFIDM-------MEFAEVYF
PCRB_EXIS2        LTPSVLN-----------------SGTLEHVIDKQVEALEEVGHM-------LAHQDLVG
PCRB_STAAN        FVPTVLN-----------------STDVAFHNGTLLEALKTYGHS-------IDFEEVIF
PCRB_STAAM        FVPTVLN-----------------STDVAFHNGTLLEALKTYGHS-------IDFEEVIF
PCRB_STAAR        FVPTVLN-----------------STDVAFHNGTLLEALKTYGHS-------IDFEEVIF
PCRB_STAAB        FVPTVLN-----------------STDVAFHNGTLLEALKTYGHS-------IDFEEVIF
PCRB_STAA8        FVPTVLN-----------------STDVVFHNGTLLEALKTYGHS-------IDFEEVIF
PCRB_STAAT        FVPTVLN-----------------STDVVFHNGTLLEALKTYGHS-------IDFEEVIF
PCRB_STAES        FIPTVMN-----------------SKDTKYHNEILLEALKKYGHV-------INFDEVFF
PCRB_STAHJ        FVPTVLN-----------------SQDTTYHNGMMHKALKQFGFM-------VNFDEVVL
PCRB_STACT        FAPMVLN-----------------SRDVTYHNGILLEALKEYGHM-------MDFDEVIF
PCRB_STAS1        FIPTVLN-----------------SRDVKYHNGLLLEALKSYGTL-------IDFNEVVF
PCRB_BREBN        LIPLVLN-----------------AGDPDWIFAPHVSGLQAFGAY-------IHWDEIIT
PCRB_LISW6        LIPVVLN-----------------TENSKWTHGLHKELIKEMGEF-------IPWKRVTS
PCRB_LISIN        LIPVVLN-----------------TENSKWTHGLHKELIKELGDF-------IPWKRITS
PCRB_LISMF        LIPVVLN-----------------TENSKWTHGLHQELIKEMGAF-------IPWKRVTA
PCRB_LISMC        LIPVVLN-----------------TENSKWTHGLHQELIKEMGAF-------IPWKRVTA
PCRB_LISMH        LIPVVLN-----------------TENSKWTHGLHQELIKEMGAF-------IPWKRVTA
PCRB_LISMO        LIPVVLN-----------------TENSKWTHGLHKELIKEMGEF-------IPWKRVTS
GGGPS_METMJ       FVPSVLN-----------------TNDVRWIVGKHYAWL-RQASG-------IDWEMVVP
GGGPS_METHJ       YVASVMN-----------------TSDARWIVGKHRDW--AMNPD-------IVWEKVIP
GGGPS_METB6       FVPSVLN-----------------TTDVQWIVGKHRSWVQQQDGK-------IPWDMVVP
GGGPS_METLZ       FVPSVFN-----------------AGHPAFITGLHKEW--AQHAD-------ILWDKVVQ
GGGPS_METAR       FVPSIFN-----------------TKYSKFAVGYHKDFV-KNYPD-------EVLDKVIP
GGGPS_ARCFU       FVPTVLN-----------------SADGDWITGKHAQWVRMHYENLQKFTEIIESEFIQI
GGGPS_HALMA       LVPVVMN-----------------AGDVTWITGAHKEWIRID--------DEIDWSRTFT
GGGPS_NATPD       FVPTVLN-----------------AGDVFWTTGAHKEWVRLD--------GDIDWDRTFT
GGGPS_HALS3       LVPVVLN-----------------AGDPFWITGAHKEWVRI---------ADLDWERTTT
GGGPS_HALWD       LVPTVFN-----------------AESAFWVAGAHKEWVRID--------GPLDWERTAT
I7BWC9_NATSJ      LIPTVFN-----------------AGSPFWITEAHKEWVRLE--------GELDWERTTT
I3R209_HALMT      SVPAVYNGDRDNFVAKHVDFFTEVGSKPEEVVGTGLPIVGDVIASRGRDAIASAAEKILG
Q9HNW3_HALSA      AVPAVYNGDSANFVDKHVDFFTQAARKPAQLTGANLPLVGDIVESKGRDAVTDLTDAVLA
D4GW01_HALVD      FVPAVYNGDKTNFVEKHVGFFTELARKSEDVTGSGLPFVGSVLASKGR----ELVDGVVG
                      . .                                                     

GGGPS_SULAC       TAYLIIG---HGGTAGHIGRARVIPYDNIELIVSYSLAANYMGMKYIYLEAGSGASETVK
GGGPS_METS5       TGYLIVG---HGGTAAHIGRARVVPYDNPELAVAYALAAEYMGMEYLYLEAGSGAPDTVR
GGGPS_SULIY       TAYVIVG---HGGTAAHIGKARVIPYDNFELATAYTLAAEYLGMDFVYLEAGSGAPEPIR
GGGPS_SULIM       TAYVIVG---HGGTAAHIGKARVIPYDNFELATAYTLAAEYLGMDFVYLEAGSGAPEPIR
GGGPS_SACS2       TAYVIVG---HGGTAAHIGKARVIPYDNFELATAYTLAAEYLGMSFVYLEAGSGAPEPIR
GGGPS_STAMF       TGYIVIY---GETAVAHVGRTYPIPVSKPEILLSYTWAAEMIGIKYIYLEAGSGSPKPVP
GGGPS_AERPE       TSYIIVG---YGGAAGFVARARPIPYEKPELAALHALAGAMMGGRIIYLEAGSGAPKPVP
GGGPS_HYPBU       SAYIIVG---HGGAAGHIGRALPIPYENGYIAAAYALAAEYLGARLVYFEAGSGAPKPVP
GGGPS_PYRNV       TAYVIVG---DGGAAGFVSMSKPIPYTRPDIAAAYALAANYIGFKALYLEAGSGAPQPAP
GGGPS_PYRIL       TAYIIIG---DGGAAGFVSMSKPIPYTRPDIVMAYALAANYIGFKAVYLEAGSGAPQPAP
GGGPS_PYRAE       TAYIIVG---DGGAAGFVSMSKPIPYTRPDIAAAYALAANYIGFKAVYLEAGSGASQPVP
GGGPS_PYRAR       TAYVIVG---DGGAAGFVSMSKPIPYTRPDIATAYALAAGYIGFKALYLEAGSGAPQPVP
GGGPS_PYRCJ       TAYVIVG---DGGAAGFVSMSKPIPYARWDLAVAYALAAYYIGFGAVYLEAGSGAPQPVP
GGGPS_CALMQ       MAYIIVG---EGGAVGFASYAKPIPFHMEDVIVAYALAAYYMGFSAIYLEAGSGAREPVP
GGGPS_THEPD       LGYIIVG---EGGAVSIVSYTRPLPFAKPEVVAAYALAAEYMGFQFVYLEGGSGG-EPVP
GGGPS_METTH       MGYLVVE---PGGTVGWVGDTKPVPRNKPDIAAAYAMAAEFLGMRLFYLEAGSGAPEHVP
GGGPS_METTM       MGYLVVE---PGGTVGWVGDTKPVPRNKPDIAAAYAMAAEFLGMRLFYLEAGSGAPQHVP
GGGPS_METST       MGYLIIE---PGGTVGWVGDSKPIPRKKSDLAVAYALAAEFLGMRVIYLEAGSGADSHIP
GGGPS_THEKO       MAYLIIE---PGETVGWVGDAKPIPRHKPKIAAAYALAGQYLGMRLVYLEAGSGAPQPVP
GGGPS_THEGJ       MAYLIIE---PGETVGWVGDAKPIPRHKPKIAAAYALAGQYLGMRLVYLEAGSGAPQPVP
GGGPS_PYRHO       MAYIVVE---PGETVGWVGDARPIPRHKPKLAAAYALAGQYLGMRLVYLEAGSGAPEPVP
GGGPS_PYRFU       MAYIIVE---PGETAGWVGDAKPIPRHKPKIAAAYALAGQYLGMRLVYLEAGSGAPQPVP
GGGPS_THESM       MAYLVVE---PGETAGWVSDANLIPRHKPKIAAAYALAGQYMGMRLVYLEAGSGAPEHIP
GGGPS_PYRAB       MAYIIVE---PGETVGWVGDAKPIPRHKPKLAAAYALAGQYLGMRLVYLEAGSGSPEPVP
GGGPS_METAC       MAYLVVE---PGGTVGWVGDAKLIPRKKPDIAAVYALAGKYLGMHYTYLEAGSGADAPIP
GGGPS_METBF       MAYLIVE---PGGTVGWVGDAKLIPRKKPELAAVYALAGKYLGMHYTYLEAGSGADKPIN
GGGPS_METMA       MAYLIVE---PGGTVGWVGDAKLIPRKKPEIAAVYALAGKYLGMHYTYLEAGSGADSPVN
GGGPS_METBU       MAYIISE---PGGTVGWVGDAKLIPRNKPEIAAAYSLAGKYMGMHYTYLEAGSGADRPIT
GGGPS_METTP       MGYIVVE---PGGTVGWVGDAKLVPRRKPDIAAAYALAGRYLGMRLIYLEAGSGAESPVP
GGGPS_THEAC       MAYLVFD---PGMTVGRVGKAHLIPRDDEKTALSYALAAQYFGFRLVYFEAGSGSPYHVG
GGGPS_THEVO       MAYLVFS---PGMTVGRVGKANLIDSFDRETALSYSLAAQYMGFKLIYFEAGSGAPRPVS
GGGPS_PICTO       MAYLIFE---PGMTVGRVGEANLIKRDDSDTALLYALAAETFGMKLVYLESGSGSPTYVS
GGGPS_METM5       MAYLGIEP-ISKTAVGFVGEVNEIPQKKPEIAGIYSLSASYFGMRWVYLEAGSGAEYPVN
GGGPS_METM6       MAYLGIEP-ISKTAVGFVGEVNEIPQKKPEIAGIYSLSASYFGMRWVYLEAGSGAEYPVN
GGGPS_METM7       MAYLGIEP-ISKTAVGFVGEVNEIPQKKPEIAGIYSLSASYFGMRWVYLEAGSGAEYPVN
GGGPS_METMP       MAYLGIEP-ISKTAVGFVGEVNEIPQKKPEIAGLYSLSASYFGMRWAYLEAGSGAEYPVS
GGGPS_METVS       MAYLGIEP-ISKTAVGFVGEVNEIPQKKPEIASIYCLSASYFGMRWAYLEAGSGAEFPVS
GGGPS_META3       MAYLGIEP-IKRTAVGFVGEVNEIPQRKPEIAGMYCLSAKYFGMRWAYLEAGSGAELPVS
GGGPS_METJA       MAYLCIEP-AKKTAVGYVGEIREIPQNKPKITAMYCLSAKFFGMRWAYLEAGSGASYPVN
GGGPS_KORCO       TAYLIVEP-GQRSAAGWVGSVNPIPRDKPEIALAYATAAEMLGMRWIYLEAGSGAEAPVP
GGGPS_CENSY       TAYLVI---GEGTSVWFVGAARGIPLGKPRIAAAYSLAARFLGMRFVYLEAGSGAESPVK
GGGPS_NITMS       TAYLVI---GDGTTAWFVGSARGIPFEKPKIAAAYALAAQFLGMRFVYLEAGSGAKSSVT
GGGPS_METKA       TGYLIVGEW--GTTVSVVGDARVIPFDRVEVIVAYALAAKHLGMKAVYLEAGSGAPEPVP
GGGPS_IGNH4       TAYIIVGE---GGTAGWVGEAKAIPPEKPELLSMYVLAAKYLGFKVVYLEAGSGVKRSVP
GGGPS_CHIPD       TGYVLIDG-GAPTTVSYISNTTPIPSDKDDIAMCTAMAGEMLGMKVVFMDAGSGARKPIT
GGGPS_SPILD       TGYMVVDS-GTQTTVSYISGTMPLPHDKPDVAACTALAGEMLGLQLMYLDAGSGARRPVS
GGGPS_FLAJ1       TGYILIES-GNETAVARVSKTEPLNRENFDLALATAQAGEMLGSKLIYLEAGSGAKKPVP
GGGPS_ZUNPS       TGYLLLDG-GNQSAVARVSKTKPIQQDEIELIRNTALAGAMLGKQLVYLEAGSGALIPVS
Q26HI8_FLABB      TGYLLIDG-GHESAVQRVSQTQPLPQNDVDSIVHTAFAGQLMGNQLIYLEAGSGAITSID
PCRB_GEOKA        EGYCILNP----ECKAAKLTRADTELDVDDIVAYARLAEHLYKLPIFYLEYSGVYGDPSV
PCRB_GEOTN        EGYCILNG----ECKAAKLTEANTALDDDDVVAYARLAEHLYKLPIFYLEYSGTYGNPSL
PCRB_GEOSW        EGYCILHK----NCKAAMLTDANTELQEDDVVAYARIAEHMYRLPIFYLEYSGSYGNPEL
PCRB_ANOFW        EGYCILND----ECKAASLTSARTNVTEEDVIAYARMAEHMYHFPIFYMEYSGRYGDVAL
PCRB_ALKHC        EGYCIMNP----DSKAATLTSAKTDLANEDVVAYARMVENMYQFPVFYLEYSGTFGDPQL
PCRB_BACCR        EGYCVLNP----EAKVAQLTEAKCDLTEDDVIAYARLADKLLHLPIFYLEYSGTYGDVEL
PCRB_BACC4        EGYCVLNP----EAKVAQLTEAKCDVTEDDVIAYARLADKLLRLPIFYLEYSGTYGDVEL
PCRB_BACC2        EGYCVLNP----EAKVAQLTDAKCDLTEDDVIAYARLADKLLHLPIFYLEYSGTYGEVEL
PCRB_BACAN        EGYCVLNP----EAKVAQLTDAKCDVTEDDVIAYARLADKLLRLPIFYLEYSGTYGDVEL
PCRB_BACHK        EGYCVLNP----EAKVAQLTDAKCDVTEDDVIAYARLADKLLRLPIFYLEYSGTYGDVEL
PCRB_BACCZ        EGYCVLNP----EAKVAQLTDAKCDVTEDDVIAYARLADKLLRLPIFYLEYSGTYGDVEL
PCRB_BACC1        EGYCVLNP----EAKVAQLTDAKCDVTEDDVIAYARLADKLLRLPIFYLEYSGTYGDVEL
PCRB_BACMK        EGYCVLNP----EAKVAQLTDAKCDLTEDDVIAYARLADKLLHLPIFYLEYSGTYGDIEL
PCRB_BACCN        EGYCVLNP----EAKVAQLTEAKCDLTEDDVIAYARMADKLLHLPIFYLEYSGTYGDVEL
PCRB_LYSSC        EGYCILNP----DCKVAHVTGATTDLSIDDIVAYARMAENFFKLPVFYLEYSGIYGNPEV
PCRB_BACSU        EGYCIANP----DCKAAALTEADADLNMDDIVAYARVSE-LLQLPIFYLEYSGVLGDIEA
PCRB_BACLD        EGYCILNQ----DCKAAALTNADTELDIEDIKAYARVAEHLFRLPVFYLEYSGMLGDSET
PCRB_BACP2        EGYVILNE----ECKAAKLTEANTALDIDDVRAYARVAEHLMKLPIFYLEYSGTLGDIEL
PCRB_BACSK        EGYCVLNG----EARVANHANAQTDLDIEDVVAYARLAEHMYRYPFFYLEYSGKKGPIDV
PCRB_OCEIH        EGYCILNE----DAKAFQYTNCVMP-DLDDVKAYAYMAEKVFHLPFFYIEYSGAYGDPTL
PCRB_EXIS2        EGYIVLNA----DAKVARVTQAKLL-NDDQVVAYAQLADSVFRMPIIYLEYSGMYGDPSL
PCRB_STAAN        EGYVVCNA----DSKVAKHTKANTDLTTEDLEAYAQMVNHMYRLPVMYIEYSGIYGDVSK
PCRB_STAAM        EGYVVCNA----DSKVAKHTKANTDLTTEDLEAYAQMVNHMYRLPVMYIEYSGIYGDVSK
PCRB_STAAR        EGYVVCNA----DSKVAKHTKANTDLTTEDLEAYAQMVNHLYRLPVMYIEYSGIYGDVSK
PCRB_STAAB        EGYVVCNA----DSKVAKHTKANTDLTTEDLEAYAQMVNHMYRLPVMYIEYSGIYGDVSK
PCRB_STAA8        EGYVVCNA----DSKVAKHTKANTDLTTEDLEAYAQMVNHMYRLPVMYIEYSGIYGDVSK
PCRB_STAAT        EGYVVCNA----DSKMAKHTKANTDLTTEDLEAYAQMVNHMYRLPVMYIEYSGIYGDVSK
PCRB_STAES        EGYVVLNA----NSKVAKITKAYTQLGIEDVEAYAQMAEELYRFPIMYVEYSGTYGDVDK
PCRB_STAHJ        EGYLVLNP----DSKVAKLTQSNTNIDIEDVEAYAQMVNEMYKLPLMYLEYSGQYGDVEK
PCRB_STACT        QGYVVLNP----DSKVAEKTQANTDIDTQDIEAYALMTDKVYRFPIMYIEYSGTFGDMEK
PCRB_STAS1        EGYVVLNP----DCKVAKLTQADTMIDDEDIEAYAQMINDMYQLPVMYIEYSGVYGETNL
PCRB_BREBN        EGYIIANP----EAGVAQLTKARPIADATQAKAYAQVATNICRLPIVYMEYSGTYGDPTI
PCRB_LISW6        EGYVILNK----DAKVAQLTEAKTDLTEEDIIAYARLAENIFRLPIFYIEYSGMYGNPEV
PCRB_LISIN        EGYVILNK----DAKVAQLTEAKTDLTDEDIIAYARLAENIFRLPIFYVEYSGMYGDPEA
PCRB_LISMF        EGYVILNK----DAKVAHLTEAKTDLTDEDIVAYARLAENIFHLPIFYVEYSGMYGDPEV
PCRB_LISMC        EGYVILNK----DAKVAHLTEAKTDLTDEDIVAYARLAENIFHLPIFYVEYSGMYGDPEV
PCRB_LISMH        EGYVILNK----DAKVAHLTEAKTDLTDEDIVAYARLAENIFHLPIFYVEYSGMYGDPEV
PCRB_LISMO        EGYVILNK----DAKVAHLTEAKTDLTDEDIVAYARLAENIFHLPIFYVEYSGMYGDPEV
GGGPS_METMJ       EAYIVLNP----NSAVGRVTGADCSLSTGDVAAFAQVADRYFRFPIVYIEYSGTYGDPAI
GGGPS_METHJ       EAYIVLNP----NSAVGRVTGADCGISAEEVAAYASIADHYFKFPIVYIEYSGMYGNPDI
GGGPS_METB6       EAYIVLNP----ASSVGRVTKAVCDLKPAEVAAYTEVADRYFHFPIVYIEYSGTYGAPAV
GGGPS_METLZ       EAYVVLNP----NSSVGKLTRAKCDLTPAEVAAYGIVAEKYYSMPVLYIEYSGMYGDPAV
GGGPS_METAR       EAYIVLNP----LSAVAIVTRAQTGISPREAAAYAELADRFFRFPVVYIEYSGTYGNPEL
GGGPS_ARCFU       EGYIVLNP----DSAVARVTKALCNIDKELAASYALVGEKLFNLPIIYIEYSGTYGNPEL
GGGPS_HALMA       EAYIVMNP----EASVASYTQANCDLDADDVAAYAEAAEHLLGQEIVYVEYSGMLGDPDI
GGGPS_NATPD       EAYIVLNP----DASVADYTEADCNLDIDEVAAYAEVAEKMFGQEIVYVEYSGMLGDPEM
GGGPS_HALS3       EAYIVMNP----DASVAEYTGADCGLDADEVGAYATVAERLLGQEVVYVEYSGTLGDPAV
GGGPS_HALWD       EAYIVLNP----DASVAEVTEANTDQTAEDVAAFATVAERLFGQEIIYIEYSGTFGDTKK
I7BWC9_NATSJ      EAYIVMNP----EADVAELTEANCDLDADDVGAYATVAEHMFGQEIIYVEYSGTLGDEAV
I3R209_HALMT      EGYVIQNL----DSKAATVSGVDKRYSPDEVAGAALATESFYGFPIFYIEYSGVYGGPED
Q9HNW3_HALSA      EGYVVQNL----DSKAAAESGVDTLYTPEQVAGAALATESFFDFPVFYVEYSGTYGGPAD
D4GW01_HALVD      EGYVVQNP----DSKVAGLTNVEEHYTPEQVAGAALATESFYGFPIFYIEYSGRYVGPED
                   .*                                            :.: ..       

GGGPS_SULAC       PEAIKVVKNTVKDG------VVIVGGGVTSEERARNLVLAGADIIVTGNVIERDHQKALK
GGGPS_METS5       PEMVKFV-SKYSEI------NLIVGGGIRTPERAVELVKAGAKALVTGNVIETDIERAIK
GGGPS_SULIY       PEMISFI-KKASSI------PLIIGGGIRSVEVALKLVEAGANIIVTGNIIERDVDKAIK
GGGPS_SULIM       PEMISFI-KKASSI------PLIIGGGIRSVEVALKLVEAGANIIVTGNIIERDVDKAIK
GGGPS_SACS2       PEMISFI-KNASSI------PLIVGGGIRSVEVALKLVEAGADIIVTGNIIESDVNKAIK
GGGPS_STAMF       PSFPAIV-KKYTNL------ITIVGGGIRSPFIAKELASSGADIIVTGTIVEEDPDKASK
GGGPS_AERPE       PEAVAASRKLVDAAGYGGEVLLTVGGGVRTPEAARMLAEAGADVLVTGTLAEESPGKLAD
GGGPS_HYPBU       VDAVAAASKVLSQA------LLVVGGGIREETLAAERLKAGADGVVIGTLAEKDPEK---
GGGPS_PYRNV       PEMVKAVRKAFP-------RVLIVGGGIRSGEAARAVARERPNVIVTGTLAEENPEK---
GGGPS_PYRIL       PEMVRAARRVFP-------RILIVGGGIRSGEVAYTIAREKPNVIVTGTLAEEKPEK---
GGGPS_PYRAE       PEMVRAVRRAFP-------RVLIVGGGIKSGEIARAIARERPNVIVTGTLAEESPEK---
GGGPS_PYRAR       PDMVRAVRKAFP-------RVLIVGGGIRSSEVARSIAREGPNVIVTGTLAEESPEK---
GGGPS_PYRCJ       PEMVRAVRKVFP-------RVLIVGGGIRSGEAARQLARERPNVIVTGTLAEEQPEK---
GGGPS_CALMQ       SSVVAKVKRAVR-N-----KILMVGGGIKSPEAAYSIALAGADVIITGTVIEESPAVV--
GGGPS_THEPD       PKIVKMVKGVTT-------LPLIVGGGIRSPEVAKELAKAGADIIVTGTIVEESENIRET
GGGPS_METTH       EEMIALVKRCT--D-----QILIVGGGIRSGEDAARVAGAGADVVVTGTVVENSDNVEDK
GGGPS_METTM       EEMISLVKRCT--D-----QILIVGGGIRTGADAARVAGAGADIIVTGTVVENSSNVEDK
GGGPS_METST       VDFIMKVKKLT--N-----LMVIVGGGIKTAQDALEVKEAGADIIITGTVVEETDDTYKK
GGGPS_THEKO       PEMIGLVKRVI--D-----VPLIVGGGIRTEEQARAAVKAGADIIVTGTAIEKAGSVEKA
GGGPS_THEGJ       PEMIALVRKVI--D-----VPLIVGGGIRTKEQARRAVEAGADIIVTGTAVEKAGSIEKA
GGGPS_PYRHO       EEMVRVVKSVI--D-----VPLIVGGGIKSGEQAKKLIKSGADIIVTGTAIEKAKSLEEA
GGGPS_PYRFU       ETMVATVKKAI--D-----VPLIVGGGIRSGEQVRKLVKAGADIIVTGTAIESAGSIEEA
GGGPS_THESM       NEMIKVVKSAI--D-----VPLIVGGGIRTYEDAKEVVQSGADIIVTGTAIEKAGSLEES
GGGPS_PYRAB       PEMVRIVKSVI--D-----VPLIVGGGIRTGDQVRELTKAGADIIVTGTAIESTKSIDEA
GGGPS_METAC       PEMIGAVKKVLG-E-----NKLIVGGGVRDAKTAKLCASAGADMIVTGTIVEEVKDVAAK
GGGPS_METBF       PEMIGAVKKVLG-E-----NKLIVGGGIRDAEAAKLCASAGADMIVTGTVLEEVRDVTAK
GGGPS_METMA       PEMIGAVKQVLG-E-----NKLIVGGGIRNAETAKICTSAGADMIVTGTVVEEVKDVTAK
GGGPS_METBU       PETIGAVKHVLG-D-----NKLIVGGGIRDGKTAKICADAGADMIVTGTIVEETDDVRKK
GGGPS_METTP       TSMVSAVRDAIG-D-----TLLVVGGGIRDAEAARKLVSAGADLIVTGTGVEESGDVFRF
GGGPS_THEAC       ENVVRRVKQEL--D-----IPVIVGGGIRTPEAAKALAQAGADMIVTGTIAERSVNVYEA
GGGPS_THEVO       EDTISYVKSKI--N-----IPLIVGGGIRDPETAMRIALAGADMIVTGSIAEKSNNVYSV
GGGPS_PICTO       ENVIKKIKEYV--K-----IPVIVGGGIRDKNAAEKLAAAGADIIVTGTIVERSRNVYEA
GGGPS_METM5       NEMIGVSKKLS--G-----INIIVGGGIRTPEVAYEKVMSGADVIVTGTLTEKDP---KA
GGGPS_METM6       NEMIGISKKLS--G-----INIIVGGGIRTPEVAYEKVMSGADVIVTGTLTEKDP---KA
GGGPS_METM7       NEMIGISKKLS--G-----INIIVGGGIRTPEVAYEKVMSGADVIVTGTLTEKDP---EA
GGGPS_METMP       NEMVGISKKLS--G-----INIIVGGGIRTPEVAYEKVMSGADVIVTGTLTEKDP---QA
GGGPS_METVS       NEMILISKKLS--G-----INLIVGGGIRSPDVAYEKVISGADVIVTGTLTEKNP---DA
GGGPS_META3       NEIIGISKKLS--G-----INIIVGGGIRTPETAYQKVLSGADAIVTGTLIEDNP---DA
GGGPS_METJA       NETIALSKKLS--G-----INIIVGGGIRKPEIAYEKVLAGADAIVTGNLLEENP---KA
GGGPS_KORCO       SEMVRLVRERT--N-----LGIIVGGGLRSPELVRERAEAGANVIVVGTHIEEGRDALAS
GGGPS_CENSY       PEMIRAVREAF--D-----GFLIVGGGIRDEEAARRASEAGADAIVIGTMLEGGG-SLDK
GGGPS_NITMS       PEMVKTVRQLF--N-----GFLIVGGGIKDVKTAQNLVKAGADALVIGTFLEKGG-SLKK
GGGPS_METKA       PEVVR---RVSGIG-----VFTIVGGGIRSPETARELAEAGADAIVTGTAVERDP---DL
GGGPS_IGNH4       PEAVRLAKKLLGEE-----VILIVGGGIKDEEVAAEILRAGADGVVVGTVVERDL---SA
GGGPS_CHIPD       ESMISRVASQVS-------APIIVGGGIRDAEKAYLNCKAGADIIVVGNAIEKETSLIKE
GGGPS_SPILD       AAMIAAVRKAVN-------VPIIVGGGITSGEKAYEALKAGADMIVVGNGVEQDPDLLPQ
GGGPS_FLAJ1       LEMISVISQNVE-------IPIIVGGGIVDLHGIKKAYNAGADLVVIGTAFENDSHFFDS
GGGPS_ZUNPS       EKVIAEVKRDLN-------IPLIVGGGIRNATQLKKAYKAGADLVVIGTAFENGEFK---
Q26HI8_FLABB      PEVIKSVKNQLD-------IPLIVGGGLRSLQQLESSFLAGADMLVIGTAIEQKINWN--
PCRB_GEOKA        VEKVKQALDQTQ---------LFYGGGITT-PEQAEHMARYADTVVVGNAIYDAF--EQA
PCRB_GEOTN        VEKVKRALSRTQ---------LVYGGGIMT-PEQAAEMARYADTVVVGNAVYDSF--ESA
PCRB_GEOSW        VQRVKQVLKQTQ---------LFYGGGIET-EKQAKEMAQYADTIVVGNVIYEDI--KKA
PCRB_ANOFW        VEKVKRTLERTR---------LFYGGGIHT-PEQAKEMAMWADTVVVGNAIYTNL--QMA
PCRB_ALKHC        VEEVSQVLTKTK---------LFYGGGIRT-VEQAEQMAPFADTVVVGNVIYDDV--QAA
PCRB_BACCR        VKNVKAELKQAK---------LYYGGGISN-AEQAKEMAQYADTVVVGNIIYDDI--KSA
PCRB_BACC4        VKNVKAELKQAK---------LYYGGGISN-AEQAKEMAQYADTVVVGNIIYDDI--KSA
PCRB_BACC2        VKNVKAELKQAQ---------LYYGGGISN-AEQAKEMAQYADTVVVGNIIYDDI--KSA
PCRB_BACAN        VKNVKAELKQAK---------LYYGGGISN-AEQAKEMAQHADTVVVGNIIYDDI--KAA
PCRB_BACHK        VKNVKAELKQAK---------LYYGGGISN-AEQAEEMAQHADTVVVGNIIYDDI--KAA
PCRB_BACCZ        VKNVKAELKQAK---------LYYGGGISN-AEQAKEMAQYADTVVVGNIIYDDI--KAA
PCRB_BACC1        VKNVKAQLKQAK---------LYYGGGISN-AEQAKEMAQHADTVVVGNIIYDDI--KAA
PCRB_BACMK        VKNVKAELKQAK---------LYYGGGISN-AEQAKEMAQYADTVVVGNIIYDDI--KSA
PCRB_BACCN        VKKVKAELQQAK---------LYYGGGISN-VKEAKEVAQYADTVVVGNVIYENI--KAA
PCRB_LYSSC        VSAVKNELKHTK---------LFYGGGITS-AKQAEEMAQYADTVVVGNIIYEDL--KAA
PCRB_BACSU        VKKTKAVLETST---------LFYGGGIKD-AETAKQYAEHADVIVVGNAVYEDF--DRA
PCRB_BACLD        VKETKAVLQETT---------LFYGGGIKD-AETAVKMAEHADVIVVGNAIYENF--EEA
PCRB_BACP2        VKETKAVLSDTV---------LFYGGGIEN-AKQAEDFAQHADVVVVGNVIYDNF--KEA
PCRB_BACSK        VKRASAVLEKTK---------LIYGGGIKN-AADASEIAAYADVVVVGNGLYENL--KEA
PCRB_OCEIH        VKEVKEELQNTQ---------LLYGGGIET-TAQAKEMKEYADTIIVGNSIYTNI--NEA
PCRB_EXIS2        VASVKRVLKQGR---------LFYGGGIDS-IERAQEMLTHADTIVVGNIIYDNL--EAA
PCRB_STAAN        VQAVSEHLTETQ---------LFYGGGISS-EQQATEMAAIADTIIVGDIIYKDI--KKA
PCRB_STAAM        VQAVSEHLTETQ---------LFYGGGISS-EQQATEMAAIADTIIVGDIIYKDI--KKA
PCRB_STAAR        VQAVSEHLTETQ---------LFYGGGISS-EQQATEMAAIADTIIVGDIIYKDI--KKA
PCRB_STAAB        VQAVSEHLTETQ---------LFYGGGISS-EQQATEMAAIADTIIVGDIIYKDI--KKA
PCRB_STAA8        VQAVSEHLTETQ---------LFYGGGISS-EQQATEMAAIADTIIVGDIIYKDI--KKA
PCRB_STAAT        VQAVSEHLTETQ---------LFYGGGISS-EQQATEMAAIADTIIVGDIIYKDI--KKA
PCRB_STAES        VKAIANMLQHTQ---------LFYGGGITN-IDKANEMSNIADTIVVGDIIYNDI--KKA
PCRB_STAHJ        VEAASRLLTNTQ---------LFYGGGITS-IEQAREMAQYADTIVVGNIIYDDI--KKA
PCRB_STACT        VRAAKDNLEEAH---------IFYGGGISS-ISDAKAAAGVADTIVVGNLVYNDI--KQA
PCRB_STAS1        VKAAADMLTETQ---------LFYGGGISN-YEEAEMMASIADTIIVGNIIYEDI--NKA
PCRB_BREBN        VKAAKTGAGEAH---------LFYGGGIRN-PEQAAEMAAIADTVVVGNVIYDDL--DAA
PCRB_LISW6        AKKVSAALDDTK---------FWYGGGIRS-KEQAAEMAEYADTIIVGNIIYEDI--EKA
PCRB_LISIN        VRKVSEVLSDTE---------FWYGGGIRS-KEQAAEMAKYADTIIVGNIIYEDL--EKA
PCRB_LISMF        VRKASAALSNTK---------FWYGGGIRS-KEQAAEMAKYADTIIVGNIIYEDL--EKA
PCRB_LISMC        VRKASAALSNTK---------FWYGGGIRS-KEQAAEMVKYADTIIVGNIIYEDL--EKA
PCRB_LISMH        VRKAGAALSNTK---------FWYGGGIRS-KEQAAEMAKYADTIIVGNIIYEDL--EKA
PCRB_LISMO        VRKASAALSNTK---------FWYGGGIRS-KEQAAEMAKYADTIIVGNIIYEDL--EKA
GGGPS_METMJ       VQAASEAVENAT---------LYYGGGIRS-AEQAAEMGRYADTIVVGNAVYEEG-IDVL
GGGPS_METHJ       VKRAGEAIDHAV---------LYYGGGIDS-AEKAAEMAKYADTIVVGNAVYEKG-VKTL
GGGPS_METB6       VKAAAEAIDHAI---------LYYGGGINS-AEKAAEMGKYADTIVVGNAVYDQG-ASVL
GGGPS_METLZ       TRAVSEALSTTR---------VFYGGGINS-GAKAAEMGQYADTIVVGNAVYEAG-PAVL
GGGPS_METAR       VKAVREKLTNTV---------LYYGGGIDS-REKAETMAKYANTIVVGNAVYKKGGIEKL
GGGPS_ARCFU       VAEVKKVLDKAR---------LFYGGGIDS-REKAREMLRYADTIIVGNVIYEKG-IDAF
GGGPS_HALMA       VAAAADILDDAT---------LFYGGGIHD-YESARTMAQHADTIVVGDLVHDEG-VDAV
GGGPS_NATPD       VQAATDATEEAT---------VFYGGGIRD-YESAYTMRQHADTVIVGDLVHDEG-ADAV
GGGPS_HALS3       VEAAAGGVDDAA---------VFYGGGIDG-YDAAYRMGAHADTIVVGDLVHEAG-VDAV
GGGPS_HALWD       VAAAAAALTEST---------LFYGGGIGG-YDSAYEMGAHADTIVVGDLLHDEG-VDAV
I7BWC9_NATSJ      VEAAAEATDEST---------LFYGGGIHD-YDSAYTMAQYADVVVVGDLAHDEG-IGAV
I3R209_HALMT      VEAAAKYLDETA---------LLYGGGIRSNRQTREILDAGADAIVVGDCFHDDP--EQY
Q9HNW3_HALSA      VEAAAQYLEDTT---------LLYGGGIQNGTQTRAILDAGADAVVVGDIFHEDP--DRF
D4GW01_HALVD      VSAAAPFLDETA---------LLYGGGIRSRAQTDEILDAGADAVVVGDCFHEDT--ERF
                                          ***:             .. :: *            

GGGPS_SULAC       IIKEIKSIRRTSNAIK--------------
GGGPS_METS5       IIEAMQRVYRIE------------------
GGGPS_SULIY       IIRGIKNK----------------------
GGGPS_SULIM       IIRGIKNK----------------------
GGGPS_SACS2       IIRGIKNK----------------------
GGGPS_STAMF       IISAIKKN----------------------
GGGPS_AERPE       VVEAFKSA----------------------
GGGPS_HYPBU       ---ALRSSR---------------------
GGGPS_PYRNV       LGEIVKAVKSA-------------------
GGGPS_PYRIL       LGEIIRAIKSA-------------------
GGGPS_PYRAE       LGEIVRAIKQA-------------------
GGGPS_PYRAR       LGEIVRAIKQR-------------------
GGGPS_PYRCJ       LAEVVRAIKSSL------------------
GGGPS_CALMQ       LKDIVDAVHRGGLRRLSNSNENANAWVNDK
GGGPS_THEPD       IGRIVRATREGALERSRE------------
GGGPS_METTH       IREIVEGMGSV-------------------
GGGPS_METTM       IREIVEGMGSL-------------------
GGGPS_METST       IKELTDVIH---------------------
GGGPS_THEKO       REKLEELNRGVKG-----------------
GGGPS_THEGJ       RKKLEELNSGVKI-----------------
GGGPS_PYRHO       RKRLEAIRNGVFV-----------------
GGGPS_PYRFU       RKKLEDLRRGVSI-----------------
GGGPS_THESM       KKRLESIINGVKEVSP--------------
GGGPS_PYRAB       KRKLEEIRRGLK------------------
GGGPS_METAC       VAEIVSAIKS--------------------
GGGPS_METBF       VAELVSAIKR--------------------
GGGPS_METMA       VAEIVSAIKR--------------------
GGGPS_METBU       IEEIVSAIKK--------------------
GGGPS_METTP       VKDIVTAIHV--------------------
GGGPS_THEAC       LHPIVESIKEVGISKIQ-------------
GGGPS_THEVO       LRNIIGKIKSIEIKNSV-------------
GGGPS_PICTO       LQEIISSI----------------------
GGGPS_METM5       VEEMKKAIKKAGMDKLKMLSKK--------
GGGPS_METM6       VEEMKKAIKKAGMDKLKMLSKK--------
GGGPS_METM7       VKEMKKAIKKAGMDKLKMLSKK--------
GGGPS_METMP       VVEMKKAIKKAGLDKLKMLSKK--------
GGGPS_METVS       VKEMKEAIKRAGKDKLKNKN----------
GGGPS_META3       VKEMRNAIKKAGIDKL--------------
GGGPS_METJA       VEMMYDAIKKAGKEKLKNK-----------
GGGPS_KORCO       VREMKEALKS--------------------
GGGPS_CENSY       LSRIAGAIGGT-------------------
GGGPS_NITMS       LEEITKAIQRSK------------------
GGGPS_METKA       AAEIVEAIKDL-------------------
GGGPS_IGNH4       AERIARRVAGWT------------------
GGGPS_CHIPD       MADAVHAAAPVLK-----------------
GGGPS_SPILD       LATVVREFNQSVVQA---------------
GGGPS_FLAJ1       ------------------------------
GGGPS_ZUNPS       ------------------------------
Q26HI8_FLABB      ------------------------------
PCRB_GEOKA        LATVAAVKQMAGQRNGDDGK----------
PCRB_GEOTN        LATVEAVKRIDGENEISGVK----------
PCRB_GEOSW        LATVKAVKQ---------------------
PCRB_ANOFW        LQTVEAVKGKSA------------------
PCRB_ALKHC        LATIAAVKK---------------------
PCRB_BACCR        LKTVKAVKGE--------------------
PCRB_BACC4        LKTVKAVKGE--------------------
PCRB_BACC2        LKTVKAVKGE--------------------
PCRB_BACAN        LKTVKAVKGE--------------------
PCRB_BACHK        LKTVKAVKGE--------------------
PCRB_BACCZ        LKTVKAVKGE--------------------
PCRB_BACC1        LKTVKAVKGE--------------------
PCRB_BACMK        LKTVKAVKGE--------------------
PCRB_BACCN        LQTVKAVKGE--------------------
PCRB_LYSSC        LATVKAVKNTL-------------------
PCRB_BACSU        LKTVAAVKGE--------------------
PCRB_BACLD        LKTVQAVKG---------------------
PCRB_BACP2        LKTVSAVKKSS-------------------
PCRB_BACSK        LKTVEAVKEHKCR-----------------
PCRB_OCEIH        LKTVEAVKGN--------------------
PCRB_EXIS2        LATVAATR----------------------
PCRB_STAAN        LKTVKIK-ESSK------------------
PCRB_STAAM        LKTVKIK-ESSK------------------
PCRB_STAAR        LKTVKIK-ESSK------------------
PCRB_STAAB        LKTVKIK-ESSK------------------
PCRB_STAA8        LKTVKIK-ESSK------------------
PCRB_STAAT        LKTVKIK-ESSK------------------
PCRB_STAES        LKTVKIK-ESNK------------------
PCRB_STAHJ        IKTVKIKKESNK------------------
PCRB_STACT        LKTVKIKGKS--------------------
PCRB_STAS1        LKTVKVK-ETH-------------------
PCRB_BREBN        LATVKAVKGTQY------------------
PCRB_LISW6        LETTTVFAKKTV------------------
PCRB_LISIN        LETATIFRKKTV------------------
PCRB_LISMF        LETATIFRKKTV------------------
PCRB_LISMC        LETATIFRKKTV------------------
PCRB_LISMH        LETATIFRKKTV------------------
PCRB_LISMO        LETATIFRKKTV------------------
GGGPS_METMJ       RATVRAVQ----------------------
GGGPS_METHJ       LETVQAVQ----------------------
GGGPS_METB6       KATVDAVQ----------------------
GGGPS_METLZ       KETVKAVK----------------------
GGGPS_METAR       KETIVK------------------------
GGGPS_ARCFU       LETLP-------------------------
GGGPS_HALMA       RETVKGAKDATATVR---------------
GGGPS_NATPD       RETVDGAKDAAD------------------
GGGPS_HALS3       RETVSGVRDAQAEE----------------
GGGPS_HALWD       SETVAGVKDAHADGEI--------------
I7BWC9_NATSJ      RDTVDAANDA--------------------
I3R209_HALMT      LQTIP-------------------------
Q9HNW3_HALSA      IDTIP-------------------------
D4GW01_HALVD      LETVPTT-----------------------