CLUSTAL format seed alignment for MF_00113

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

QUEA_SHISS      --------------------------MRVT----DFSFELPESLIAHYPMPERSSCRLLS
QUEA_ECOHS      --------------------------MRVT----DFSFELPESLIAHYPMPERSSCRLLS
QUEA_SHIFL      --------------------------MRVT----DFSFELPESLIAHYPMPERSSCRLLS
QUEA_SHIDS      --------------------------MRVT----DFSFELPESLIAHYPMPERSSCRLLS
QUEA_ECO57      --------------------------MRVT----DFSFELPESLIAHYPMPERSSCRLLS
QUEA_ECO24      --------------------------MRVT----DFSFELPESLIAHYPMPERSSCRLLS
QUEA_SHIF8      --------------------------MRVT----DFSFELPESLIAHYPMPERSSCRLLS
QUEA_ECOLI      --------------------------MRVT----DFSFELPESLIAHYPMPERSSCRLLS
QUEA_ECOLC      --------------------------MRVT----DFSFELPESLIAHYPMPERSSCRLLL
QUEA_ECOL5      --------------------------MRVT----DFSFELPESLIAHYPMPERSSCRLLS
QUEA_ECOL6      --------------------------MRVT----DFSFELPESLIAHYPMPERSSCRLLS
QUEA_SHIBS      --------------------------MRVT----DFFFELPESLIAHYPMPERSSCRLLS
QUEA_ECOK1      --------------------------MRVT----DFSFELPESLIAHYPMPERSSCRLLS
QUEA_ECOUT      --------------------------MRVT----DFSFELPESLIAHYPMPERSSCRLLS
QUEA_SALPB      --------------------------MRVT----DFSFELPESLIAHYPQPERSRCRLLS
QUEA_SALTY      --------------------------MRVT----DFSFELPESLIAHYPQPERSRCRLLS
QUEA_SALCH      --------------------------MRVT----DFSFELPESLIAHYPQPERSRCRLLS
QUEA_SALPA      --------------------------MRVT----DFSFELPESLIAHYPQPERSRCRLLS
QUEA_SALTI      --------------------------MRVT----DFSFELPESLIAHYPQPERSRCRLLS
QUEA_SALAR      --------------------------MRVT----DFSFELPESLIAHYPQPERSRCRLLS
QUEA_CITK8      --------------------------MRVT----DFSFELPESLIAHYPQPERSRCRLLS
QUEA_ENT38      --------------------------MRVA----DFSFELPESLIAHYPQPERSGCRLLS
QUEA_KLEP7      --------------------------MRVT----DFAFELPESLIAHYPMPERSSCRLLS
QUEA_CROS8      --------------------------MRLT----DFSFELPESLIAHYPQAQRSACRLLS
QUEA_YERPE      --------------------------MRVA----DFSFELPEALIAHYPQPQRSGCRLLS
QUEA_YERPS      --------------------------MRVA----DFSFELPEALIAHYPQPQRSGCRLLS
QUEA_YERP3      --------------------------MRVA----DFSFELPEALIAHYPQPQRSGCRLLS
QUEA_YERE8      --------------------------MRVA----DFSFELPESLIAHYPQPQRSGCRLLS
QUEA_SERP5      --------------------------MRVA----DFSFELPESLIAHYPQPERSGCRLLQ
QUEA_PECAS      --------------------------MRVA----DFSFELPESLIAHYPQAERSGCRLLS
QUEA_PHOLL      --------------------------MRVS----DFTFELPDEMIAHYPQPQRSGCRLLS
QUEA_SODGM      --------------------------MRVA----DFSFALPDNLIARYPQAQRSACRLLS
QUEA_BAUCH      --------------------------MHVA----DFSFNLPKNLIARYPLPERSTCRLLS
QUEA_VIBCH      --------------------------MQVS----DFHFELPDELIARYPKAERTASRLLQ
QUEA_VIBC3      --------------------------MQVS----DFHFELPDELIARYPKAERTASRLLQ
QUEA_VIBPA      --------------------------MQVS----DFHFDLPDELIARYPQPERTASRLLQ
QUEA_VIBCB      --------------------------MQVS----DFHFDLPDELIARYPQPERTASRLLQ
QUEA_VIBVU      --------------------------MQVS----DFHFDLPDELIARYPQSERTASRLLQ
QUEA_VIBVY      --------------------------MQVS----DFHFDLPDELIARYPQSERTASRLLQ
QUEA_ALIF1      --------------------------MQVS----DFHFELPDELIARYPQPERTASRLLQ
QUEA_PHOPR      --------------------------MQVS----DFHFDLPNELIARYPQPERTASRLLQ
QUEA_AERHH      --------------------------MQVS----DFHFDLPDELIARYPMTERTASRLLQ
QUEA_AERS4      --------------------------MQVS----DFHFDLPDELIARYPMAERTASRLLQ
QUEA_COLP3      --------------------------MRVS----DFSFDLPEALIARYPKAERTASRLMT
QUEA_PSEA6      --------------------------MKVS----EFQFDLPEALIARYPTKERTASRLMH
QUEA_SHEPA      --------------------------MRVA----DYSFELPDELIARYPTAERTASRLLS
QUEA_SHEHH      --------------------------MRVA----DFSFELPDELIARYPTAERTASRLLS
QUEA_SHELP      --------------------------MRVA----DFSFDLPDELIARYPMPNRTASRLLT
QUEA_SHESM      --------------------------MRVT----DFSFDLPDELIARYPMAQRNASRLLT
QUEA_SHESA      --------------------------MRVT----DFSFDLPDELIARYPMAQRNASRLLT
QUEA_SHESR      --------------------------MRVT----DFSFDLPDELIARYPMAQRNASRLLT
QUEA_SHEON      --------------------------MRVT----DFSFDLPDELIARYPMAQRNASRLLT
QUEA_SHESW      --------------------------MRVA----DFSFDLPDELIARYPMAQRNASRLLT
QUEA_SHEPC      --------------------------MRVA----DFSFDLPDELIARYPMAQRNASRLLT
QUEA_SHEB8      --------------------------MRVA----DFSFDLPDELIARYPMAQRNASRLLT
QUEA_SHEB9      --------------------------MRVA----DFSFDLPDELIARYPMAQRNASRLLT
QUEA_SHEB5      --------------------------MRVA----DFSFDLPDELIARYPMAQRNASRLLT
QUEA_SHEFN      --------------------------MRVA----DFSFDLPDELIARYPTAQRNASRLLT
QUEA_SHEDO      --------------------------MRVA----DFSFDLPDELIARYPTAQRNASRLLT
QUEA_SHEAM      --------------------------MRVA----DFTFDLPDELIARYPMAERTASRLLH
QUEA_PSEHT      --------------------------MRVA----DFSFDLPDELIARFPKQDRTSSRLLS
QUEA_HAEIG      --------------------------MRVS----DFNFDLPDELIARYPKTDRVSCRLLQ
QUEA_HAEIE      --------------------------MRVS----DFNFDLPDELIARYPKTDRVSCRLLQ
QUEA_HAEI8      --------------------------MRVS----DFNFDLPDELIARYPKTDRVSCRLLQ
QUEA_HAEIN      --------------------------MRVS----DFNFDLPDELIARYPKTDRVSCRLLQ
QUEA_HAES1      --------------------------MYLS----DFYFDLPDELIARYPKRERSSSRMLQ
QUEA_HISS2      --------------------------MYLS----DFYFDLPDELIARYPKRERSSSRMLQ
QUEA_PASMU      --------------------------MRVS----DFYFDLPDELIARYPKPDRTASRLLQ
QUEA_MANSM      --------------------------MHLS----DFYFDLPDELIARYPKPERSSSRLLR
QUEA_HAEDU      --------------------------MLVS----DFHFNLPDELIARYPKDERTASRLLH
QUEA_ACTP2      --------------------------MLVS----DFHFDLPDELIARYPTEERTASRLLH
QUEA_MARMS      --------------------------MLVS----DYHFDLPDSLIANYPMPDRTASRLLH
QUEA_PSEAB      --------------------------MRVA----DFHFDLPEALIARHPLPERRASRLLA
QUEA_PSEAE      --------------------------MRVA----DFHFDLPEALIARHPLPERRASRLLA
QUEA_PSEA7      --------------------------MRVA----DFHFDLPEALIARHPLPERRASRLLA
QUEA_PSEMY      --------------------------MRVA----DFHFDLPESLIARHPLAERRASRLLQ
QUEA_PSEP1      --------------------------MRVA----DFSFELPDSLIARHPLAERHGSRLLV
QUEA_PSEPK      --------------------------MRVA----DFSFELPDSLIARHPLAERHGSRLLV
QUEA_PSEPG      --------------------------MRVA----DFSFELPDSLIARHPLAERHGSRLLV
QUEA_PSEE4      --------------------------MRVA----DFSFELPDSLIARHPLAERHGSRLLV
QUEA_PSEU2      --------------------------MRVA----DFTFELPDSLIARHPLAERRSSRLLT
QUEA_PSE14      --------------------------MRVA----DFTFELPDSLIARHPLAERRSSRLLT
QUEA_PSESM      --------------------------MRVA----DFTFELPDSLIARHPLAERRSSRLLT
QUEA_PSEF5      --------------------------MRVA----DFTFELPDSLIARHPLAERRGSRLLT
QUEA_PSEPF      --------------------------MRVA----DFTFELPDSLIARHPLAERRGSRLLT
QUEA_SACD2      --------------------------MRRQ----DFSYELPDELIARRPTETRTGSRLLM
QUEA_MARHV      --------------------------MNVS----DFHFDLPDELIARYPLKERSASRLLS
QUEA_IDILO      ------------------MSDTNHSTLKVS----DFSFELPDELIARYPQEQRSASRLLS
QUEA_CHRSD      --------------------------MQRA----DFHFDLPDELIARYPSETRSDCRLLC
QUEA_ALKEH      --------------------------MHVD----DFSFDLPEALIAHHPPEQRRDSRLLC
QUEA_HAHCH      --------------------------MRVD----DFDFELPPELIARRPLAERSSSRLLC
QUEA_ALCBS      --------------------------MNVD----DFDFELPDRLIARHPPAQRRDARLLA
QUEA_HYDCU      --------------------------MRRQ----DFNFELPEALIAQQPAKERTQSRLLV
QUEA_XYLFT      -------------------------MLKKS----DFHYDLPEELIAQGPLPERSASRLML
QUEA_XYLFA      -------------------------MLKKS----DFHYDLPEELIAQGPLPERSASRLML
QUEA_XANAC      --------------------------MKKS----DFHYDLPDELIAQAPLAERAASRLLV
QUEA_XANC5      --------------------------MKKS----DFHYELPEELIAQAPLAERAASRLLV
QUEA_XANOR      --------------------------MKKS----DFHYDLPEELIAQAPLAERAASRLLV
QUEA_XANCP      --------------------------MKKS----DFHYDLPEELIAQAPLAERAASRLLV
QUEA_XANC8      --------------------------MKKS----DFHYDLPEELIAQAPLAERAASRLLV
QUEA_METCA      --------------------------MLKS----EFHYDLPQNLIAQSPLPERSASRLLC
QUEA_NITOC      --------------------------MQLS----DFTYNLPKQLIAQYPPKRRGESRLLS
QUEA_CUPMC      -------------------------MLTLS----DFDFPLPPELIAQSALPDRSASRLLV
QUEA_CUPPJ      -------------------------MLTLS----DFDFPLPPELIAQSALPDRSASRLLV
QUEA_CUPNH      -------------------------MLTLS----DFDFPLPPELIAQSALPDRSASRLLV
QUEA_RALSO      -------------------------MLTLS----DFDFDLPPELIAQTALPDRTASRLLA
QUEA_BURCA      -------------------------MFTLS----DFDFNLPPELIAQTALPDRTASRLLE
QUEA_BURCH      -------------------------MFTLS----DFDFNLPPELIAQTALPDRTASRLLE
QUEA_BURL3      -------------------------MFTLS----DFDFNLPPELIAQTALPDRTASRLLE
QUEA_BURVG      -------------------------MFTLS----DFDFNLPPELIAQTALPERTASRLLE
QUEA_BURCM      -------------------------MFTLS----DFDFNLPPELIAQTALPERTASRLLE
QUEA_BURP0      -------------------------MLTLS----DFDFDLPPELIAQTALPERSASRLLE
QUEA_BURP1      -------------------------MLTLS----DFDFDLPPELIAQTALPERSASRLLE
QUEA_BURP6      -------------------------MLTLS----DFDFDLPPELIAQTALPERSASRLLE
QUEA_BURPS      -------------------------MLTLS----DFDFDLPPELIAQTALPERSASRLLE
QUEA_BURMS      -------------------------MLTLS----DFDFDLPPELIAQTALPERSASRLLE
QUEA_BURM9      -------------------------MLTLS----DFDFDLPPELIAQTALPERSASRLLE
QUEA_BURM7      -------------------------MLTLS----DFDFDLPPELIAQTALPERSASRLLE
QUEA_BURMA      -------------------------MLTLS----DFDFDLPPELIAQTALPERSASRLLE
QUEA_PARXL      -------------------------MLTLS----DFDFDLPPELIAQVALPERSASRLLE
QUEA_JANMA      -------------------------MYSLS----DFDFELPQELIAQTPLAERSASRLLQ
QUEA_HERAR      -------------------------MYSLS----DFDFELPQELIAQTPLAERSASRLLH
QUEA_AZOSB      ------------------------MTLSLQ----DFDYDLPPDLIAQAPLAERSASRLLV
QUEA_AROAE      ------------------------MSLTLD----DFDYLLPPELIAQAPLAERCASRLLV
QUEA_DECAR      ------------------------MSLTVD----DFDFPLPPELIAQHPAAERRGSRLLH
QUEA_BORPA      ----------------------MPTPLTLA----DFDYHLPPELIAQSPAAERGGSRLLH
QUEA_BORBR      ----------------------MPTPLTLA----DFDYHLPPELIAQSPAAERGGSRLLH
QUEA_BORPE      ----------------------MPTPLTLA----DFDYHLPPELIAQSPAAERGGSRLLH
QUEA_THIDA      --------------------------MRVA----DFDFELPPDLIAQFPPDVRGASRLLH
QUEA_NEIM0      --------------------------MDIS----DFDFTLPEKLIAQHPPEVRGSSRLLV
QUEA_NEIMA      --------------------------MDIS----DFDFTLPEHLIAQHPPEVRGSSHLLV
QUEA_NEIMB      --------------------------MDIS----DFDFTLPEKLIAQHPPEVRGSSRLLV
QUEA_NEIG1      --------------------------MDIS----DFDFTLPEHLIAQHPPEVRGSSRLLV
QUEA_CHRVO      --------------------------MQLS----DFDYHLPEALIAQHPPAERGASRLL-
QUEA_NITEU      -----------------MLAIGIIRSMKTD----DFDFHLPDELIAQFPLANRSDSRMLY
QUEA_NITEC      --------------------------MKTD----DFDFSLPNELIAQLPLANRADSRMLY
QUEA_NITMU      --------------------------MKIQ----DFDFDLPPELIAQFPAEKRGNSRMLH
QUEA_POLAQ      --------------------------MQLS----DFNYELPPELIAQHPLANRTDSRLLE
QUEA_DICNV      ----------------------MQHTLKKS----DFFYELPEHLIARYPLQNRSDSRLLV
QUEA_PSYWF      MTQPLSQDQHDSSSNMPTDNAETQGYLSVA----DYDYDLPDEYIARYPLAERSASRLMY
QUEA_PSYA2      MTDSEPQTLNNNSEITANHNDDILEYLSVD----DYDYELPDQLIARYPLAQRSASKLLY
QUEA_ACIAD      --------------------------MQLS----DFNFDLPDELIARYPLDTRSASRLLH
QUEA_LEGPL      --------------------------MNKQ----DFYFDLPSELIAQYPLANRSDSRLLI
QUEA_LEGPH      --------------------------MNKQ----DFYFDLPSELIAQYPLANRSDSRLLI
QUEA_LEGPA      --------------------------MNKQ----DFYFDLPSELIAQYPLANRSDSRLLI
QUEA_LEGPC      --------------------------MNKQ----DFYFDLPSELIAQYPLANRSDSRLLI
QUEA_COXBU      --------------------------MKNQWKTSDFDYNLPVELIAQRPLADRSGSRLLY
QUEA_COXBN      --------------------------MKNQWKTSDFDYNLPVELIAQRPLADRSGSRLLY
QUEA_COXBR      --------------------------MKNQWKTSDFDYNLPVELIAQRPLADRSGSRLLY
QUEA_BUCAI      --------------------------MQLS----DFSFDLPKSLISFHPYFIRSTCRLMV
QUEA_BUCAP      --------------------------MHLS----NFYFKIPKSLIAFYPCFIRSQSRLLI
QUEA_BLOFL      --------------------------MRTS----DFKFQLPKKLISRYPNLKRSECRLLV
QUEA_VESOH      --------------------------MQLK----DFDFDLPASLIAQHPIKNRTDSRLLI
QUEA_FRATH      --------------------------MKTD----DFDYKLPEELIASYPLENRDASRLLK
QUEA_FRATO      ------------------------MFMKTD----DFDYKLPEELIASYPLENRDASRLLK
QUEA_FRATF      --------------------------MKTD----DFDYKLPEELIASYPLENRDASRLLK
QUEA_FRATW      --------------------------MKTD----DFDYKLPEELIASYPLENRDASRLLK
QUEA_FRATT      ------------------------MFMKTD----DFDYKLPEELIASYPLENRDASRLLK
QUEA_FRAT1      ------------------------MFMKTD----DFDYKLPEELIASYPLENRDASRLLK
QUEA_FRATN      --------------------------MKTD----DFDYKLPEELIASYPLENRDASRLLK
QUEA_FRAP2      --------------------------MRTD----DFDYKLPEELIASYPLENRDASRLLK
QUEA_GEOKA      --------------------------MKVD----LFDFHLPEELIAQTPLPDRAASRLMV
QUEA_GEOTN      --------------------------MKVD----LFDFHLPEELIAQTPLPDRAASRLMV
QUEA_BACSU      --------------------------MKVD----LFDFELPERLIAQVPLEQRDASRLMV
QUEA_BACVZ      --------------------------MKVD----LFDFELPERLIAQVPLKERDASRLMV
QUEA_BACP2      --------------------------MKLE----LFDFDLPERLIAQVPLEKRDASRLMV
QUEA_BACLD      --------------------------MKVE----LFDFDLPERLIAQVPLKERDASRLMV
QUEA_BACHD      --------------------------MNVR----DFDFHLPEKLIAQTPLKDRTASRLLV
QUEA_BACHK      --------------------------MDIN----LFDFHLPEELIAQVPLEERETSRLMV
QUEA_BACC1      --------------------------MDIN----LFDFHLPEELIAQVPLEERETSRLMV
QUEA_BACAN      --------------------------MDIN----LFDFHLPEELIAQVPLEERETSRLMV
QUEA_BACCZ      --------------------------MDIN----LFDFHLPEELIAQVPLEERETSRLMV
QUEA_BACCR      --------------------------MDIN----LFDFHLPEELIAQVPLEDRETSRLMV
QUEA_BACCN      --------------------------MDIN----LFDFHLPEELIAQTPLEKRETSRLMV
QUEA_OCEIH      --------------------------MQIE----DFDFHLPEELIAQTPLKDRTSSRLCV
QUEA_LISMO      --------------------------MKVE----DFDFDLPEELIAQTPLLDRTSSRLMV
QUEA_LISMF      --------------------------MKVE----DFDFDLPEELIAQTPLLDRTSSRLMV
QUEA_LISIN      --------------------------MKVE----DFDFDLPEELIAQTPLLDRTSSRLMV
QUEA_LISW6      --------------------------MKVE----DFDFDLPEELIAQTPLLDRTSSRLMV
QUEA_BACSK      --------------------------MDVN----EFDFDLPEELIAQTPLKTRTNSRLLV
QUEA_STRT2      --------------------------MNTN----DFDFELPEELIAQTPLEQRDASKLLV
QUEA_STRTD      --------------------------MNTN----DFDFELPEELIAQTPLEQRDASKLLV
QUEA_STRT1      --------------------------MNTN----DFDFELPEELIAQTPLKQRDASKLLV
QUEA_STRA1      --------------------------MNTN----DFDFYLPEELIAQTPLEKRDASKLLV
QUEA_STRA5      --------------------------MNTN----DFDFYLPEELIAQTPLEKRDASKLLV
QUEA_STRA3      --------------------------MNTN----DFDFYLPEELIAQTPLEKRDASKLLV
QUEA_STRP8      --------------------------MNTN----DFDFELPEELIAQTPLEKRDSSKLLI
QUEA_STRPF      --------------------------MNTN----DFDFELPEELIAQTPLEKRDSSKLLI
QUEA_STRP6      --------------------------MNTN----DFDFELPEELIAQTPLEKRDSSKLLI
QUEA_STRPB      --------------------------MNTN----DFDFELPEELIAQTPLEKRDSSKLLI
QUEA_STRPM      --------------------------MNTN----DFDFELPEELIAQTPLEKRDSSKLLI
QUEA_STRPC      --------------------------MNTN----DFDFELPEELIAQTPLEKRDSSKLLI
QUEA_STRPG      --------------------------MNTN----DFDFELPEELIAQTPLEKRDSSKLLI
QUEA_STRP1      --------------------------MNTN----NFDFELPEELIAQTPLEKRDSSKLLI
QUEA_STRP3      --------------------------MNTN----DFDFELPEELIAQTPLEKRDSSKLLI
QUEA_STRPD      --------------------------MNTN----DFDFELPEELIAQTPLEKRDSSKLLI
QUEA_STRMU      --------------------------MNTS----DFDFNLPEALIAQTPLKKRDSSKLLV
QUEA_STRP2      --------------------------MNTA----DFDFHLPEELIAQTPLEKRDASKLLI
QUEA_STRR6      --------------------------MNTA----DFDFHLPEELIAQTPLEKRDASKLLI
QUEA_STRPN      --------------------------MNTA----DFDFHLPEELIAQTPLEKRDASKLLI
QUEA_STRSV      --------------------------MNTA----DFDFDLPEELIAQTPLEKRDASRLLV
QUEA_LACLM      --------------------------MNIN----DFDFDLPEELIAQTPLEKRSESRLLI
QUEA_LACLA      --------------------------MNIN----DFDFDLPEELIAQTPLEKRSESRLLI
QUEA_LACPL      ------------------------MSLTLE----DFDYDLPHELIAQTPIKKRDSSRLLE
QUEA_LACBA      ------------------------MAYTLD----DFDYDLPHELIAQTPIKQRDTSRLLV
QUEA_PEDPA      ------------------------MTLTTE----DFNYDLPHELIAQTPIKERDESRLLV
QUEA_LACSS      -------------------------MVSTE----DFDYNLPEELIAQTPMIERAASRLLV
QUEA_ENTFA      -------------------------MLSTE----DFDFDLPEELIAQTPLKDRASSRLLV
QUEA_STAAM      --------------------------MNIE----EFDYDLPESLIAQTPLKDRDHSRLLV
QUEA_STAA9      --------------------------MNIE----EFDYDLPESLIAQTPLKDRDHSRLLV
QUEA_STAA2      --------------------------MNIE----EFDYDLPESLIAQTPLKDRDHSRLLV
QUEA_STAA1      --------------------------MNIE----EFDYDLPESLIAQTPLKDRDHSRLLV
QUEA_STAAB      --------------------------MNIE----EFDYDLPESLIAQTPLKDRDHSRLLV
QUEA_STAAW      --------------------------MNIE----EFDYDLPESLIAQTPLKDRDHSRLLV
QUEA_STAAN      --------------------------MNIE----EFDYDLPESLIAQTPLKDRDHSRLLV
QUEA_STAAR      --------------------------MNIE----EFDYDLPESLIAQTPLKDRDHSRLLV
QUEA_STAAS      --------------------------MNIE----EFDYDLPESLIAQTPLKDRDHSRLLV
QUEA_STAAE      --------------------------MNIE----EFDYDLPESLIAQTPLKDRDHSRLLV
QUEA_STAAC      --------------------------MNIE----EFDYDLPESLIAQTPLKDRDHSRLLV
QUEA_STAA8      --------------------------MNIE----EFDYDLPESLIAQTPLKDRDHSRLLV
QUEA_STAAT      --------------------------MNIE----EFDYDLPESLIAQTPLKDRDHSRLLV
QUEA_STAA3      --------------------------MNIE----EFDYDLPESLIAQTPLKDRDHSRLLV
QUEA_STAHJ      --------------------------MNVE----EFDYDLPESLIAQTPLKDRDQSRLLV
QUEA_STAES      --------------------------MNIE----DFDYHLPESLIAQTPLKNRDQSRLLV
QUEA_STAEQ      --------------------------MNIE----DFDYHLPESLIAQTPLKNRDQSRLLV
QUEA_STAS1      --------------------------MDIE----AFDYHLPEALIAQTPLKNRDESRLLI
QUEA_CLOBH      --------------------------MKVK----DFDFYLPEELIAQHPIEKRDEARLLV
QUEA_CLOB1      --------------------------MKVK----DFDFYLPEELIAQHPIEKRDEARLLV
QUEA_CLOBL      --------------------------MKVK----DFDFYLPEELIAQHPMEKRDEARLLV
QUEA_CLOTE      --------------------------MKAK----DFDYYLPEELIAQHPLEKRDECRLMV
QUEA_CLOAB      --------------------------MQLE----DFDYYLPEELIAQHPCDKRDECRLMV
QUEA_CLOK5      --------------------------MEVT----DFDFYLPEELIAQKPLEQRDEGRLMV
QUEA_CLOPE      --------------------------MKVS----DFYFELPEELIAQYPLEKRDSSRLMV
QUEA_CLOP1      --------------------------MKVS----DFYFELPEELIAQYPLEKRDSSRLMV
QUEA_CLOPS      --------------------------MKVS----DFYFELPEELIAQYPLEKRDSSRLMV
QUEA_CLOB8      --------------------------MNVK----DFDFYLPEELIAQHPLEQRDSSRLMV
QUEA_HUNT2      --------------------------MKVS----DFYYDLPQELIAQEPVEKRDMSRLMV
QUEA_CLOD6      --------------------------MKTR----DFKFDLPQELIAQVPIEDRASSRLMV
QUEA_LACP7      --------------------------MKKQ----DFYFDLPEELIAQDPLEDRSGSRLLV
QUEA_ALKMQ      --------------------------MKTN----EFDFDLPDRLIAQTPLEKRDHSRLMV
QUEA_CALS4      --------------------------MKRS----EFYFDLPEELIAQEPLEDRASSRLMI
QUEA_SYMTH      --------------------------MRLS----DFDYDLPKELIAQKPVEPRDASRLMV
QUEA_MOOTA      --------------------------MRIE----EFDYELPPGQIAQQPVEPRDASRLLV
QUEA_DESHY      --------------------------MKLE----DFDFELPEDRIAQHPVEPRDSSRLMV
QUEA_DESRM      --------------------------MQLS----DFDFELPEELIAQEPIKQRDQSRLMI
QUEA_PELTS      --------------------------MNLS----DFDYFLPDELIAQEPLPERDMSRLMV
QUEA_CARHZ      --------------------------MKLK----DFDYYLPEELIAQTPLEKRDESRLLV
QUEA_FUSNN      ----------------MKKLRKRKMSTYLS----DYDYFLPEELIGQKPREPRDSAKLML
QUEA_THEMA      --------------------------MKVS----EFDYELPPELIAQEPVEPRDASRLMV
QUEA_THEP1      --------------------------MKVS----EFDYELPSELIAQEPVEPRDASRLMV
QUEA_THEM4      --------------------------MKLS----DFDYYLPEELIAQKPVEPRDASRLMV
QUEA_DEHMC      --------------------------MKTS----DFDYNLPQEYIAQKPVEPRDSSRLLV
QUEA_DEHMB      --------------------------MKTS----DFDYNLPQEYIAQKPAEPRDSSRLLV
QUEA_DEHM1      --------------------------MKTS----DFDYNLPQEYIAQKPAEPRDSSRLLV
QUEA_FLAJ1      --------------------------MKLS----HFNFNLPKELLAEFPAENRDESRLMV
QUEA_FLAPJ      --------------------------MKLS----HFQFNLPDELLAEYPAENRDESRLMV
QUEA_BACFN      --------------------------MKLS----QFKFKLPEEKIALHPTKYRDESRLMV
QUEA_BACFR      --------------------------MKLS----QFKFKLPEEKIALHPTKYRDESRLMV
QUEA_BACV8      --------------------------MKLS----QFKFKLPEDKIALHPAKYRDESRLMV
QUEA_PARD8      --------------------------MKLS----KFKFNLPSELIALHPAKNRDESRLMV
QUEA_CYTH3      --------------------------MKLS----EFKFALPAELVAQHPAANRDEAKMMV
QUEA_GEOMG      --------------------------MRVD----DFDYELPPELIAQEPLDRRDATRLMT
QUEA_GEOSL      --------------------------MLVT----EFDYHLPPELIAQEPLVQRDATRLMT
QUEA_GEOUR      --------------------------MQLN----DFDYYLPTELIAQQPAQNRDASRLMT
QUEA_PELCD      --------------------------MRLS----DFDFELPEELIAQHPLAQRQASRLMV
QUEA_PELPD      --------------------------MLVK----EFDYHLPEELIARYPAPERDGSRLML
QUEA_PELLD      --------------------------MRVA----DFDYPLPEERIAKYPPLQRGSTRLLV
QUEA_CHLPM      --------------------------MKVS----DFDYSLPEERIAKYPPDNRGATRLLV
QUEA_CHLPD      --------------------------MKVS----DFDYELPESHIARYPPDERGSTRLLV
QUEA_CHLTE      --------------------------MKVS----DFDYALPEERIACYPPAKRGSTRLIV
QUEA_CHLCH      --------------------------MQVA----DFDYHLPEERIAKYPPLERGSTRLLV
QUEA_CAUVC      --------------------------MRLS----DFDFDLPEDRIALRPAEPRDSARFLV
QUEA_CAUSK      --------------------------MRLS----DFDFHLPDAAIALRPAEPRDSARLLV
QUEA_BRUC2      --------------------------MRVD----LFDFDLPEERIALRPVEPRDHAKLLH
QUEA_BRUSU      --------------------------MRVD----LFDFDLPEERIALRPVEPRDHAKLLH
QUEA_BRUA2      --------------------------MRVD----LFDFDLPEERIALRPVEPRDHAKLLH
QUEA_BRUME      --------------------------MRVD----LFDFDLPEERIALRPVEPRDHAKLLH
QUEA_BRUO2      --------------------------MRVD----LFDFDLPEERIALRPVEPRDHAKLLH
QUEA_BRUSI      --------------------------MRVD----LFDFDLPEERIALRPVEPRDHAKLLH
QUEA_BRUAB      --------------------------MRVD----LFDFDLPEERIALRPVEPRDHAKLLH
QUEA_OCHA4      --------------------------MRVD----LFDFDLPEESIALRPAEPRDHARLLR
QUEA_RHILO      --------------------------MRVD----LFDFELPEERIALRPAEPRDSAKMLV
QUEA_CHESB      --------------------------MRVD----LFDFDLPEERIALRPASPRDSARMLV
QUEA_RHIEC      --------------------------MRVD----LFDFDLPDERIALRPAEPRDSARLLV
QUEA_RHIL3      --------------------------MRVD----LFDFDLPDERIALRPAEPRDSARLLV
QUEA_AGRFC      --------------------------MRVD----LFDFDLPEENIALRPANPRDSARLLV
QUEA_RHIME      --------------------------MRVD----LFDFDLPENSIALRPASPRDSARMLV
QUEA_SINMW      --------------------------MRVD----LFDFDLPEDSVALRPASPRDSARMLV
QUEA_RHOPS      --------------------------MRTE----LFDFDLPASSIALRPVSPRDAARMLV
QUEA_RHOPA      --------------------------MRTE----LFDFDLPAENIALRPVSPRDAARMLV
QUEA_RHOP5      --------------------------MRTD----LFDFDLPQGAIALRPASPRDAARMLV
QUEA_NITWN      --------------------------MRTD----LFDFELPAGSIALRPASPRDSARMLV
QUEA_BRASO      --------------------------MRTD----LFDFHLPPENIALRPASPREAARMLV
QUEA_BRASB      --------------------------MRTD----LFDFHLPPENIALRPASPREAARMLV
QUEA_BRADU      --------------------------MRTD----LFDFDLPAERIALRPASPRDSAKMLV
QUEA_AZOC5      --------------------------MRVD----AFDFDLPPERIALRPAEPRESARLLR
QUEA_PARL1      --------------------------MRVS----DFDFDLPEELIALRPARPRDSARMLV
QUEA_MARMM      --------------------------MRVS----DFDFHLPEARIALRPARPRDAARMLH
QUEA_HYPNA      --------------------------MDLS----VFQFDLPEDLIALRPAQPQDAARLLV
QUEA_RHORT      --------------------------MRVD----LFDFDLPRDLIAVRPAVPRDSARLLL
QUEA_SPHWW      --------------------------MRVD----LFDFDLPPENIALRPASPRDSARMLL
QUEA_NOVAD      --------------------------MRVD----LFDFELPSENIALRPARPRDSARLLG
QUEA_SPHAL      --------------------------MRVD----AFDFDLPSERIALRPARPRDAARMLV
QUEA_ERYLH      --------------------------MRVD----LFDFELPQELIALRPAVPRDSARLLV
QUEA_ZYMMO      --------------------------MRVD----LFDFELPTESIALRPAVPRESARLLQ
QUEA_GLUDA      ------------------------MTDLAS----DFDFDLPPALIAEHPARPRDSARLLD
QUEA_GLUOX      ------------------------MTDDLA----PFDFELPRDHIATEPARPRDSATLLH
QUEA_ACICJ      --------------------------MNLA----DFDYHLPPERIAAEPARPRHAARLLH
QUEA_RUEST      --------------------------MKLG----DFDFDLPEELIATRPAVPRSSARLLV
QUEA_RUEPO      --------------------------MKLS----DFDFDLPDDLIATRPAQPRSSARLLV
QUEA_ROSDO      --------------------------MKLS----DFDFDLPEDLIATRPAVPRTSARLLV
QUEA_JANSC      --------------------------MKLD----DFDFDLPDGLIATRPARPRSSARLLV
QUEA_RHOS4      --------------------------MQLS----DFDFDLPERLIATRPARPRTAARLLL
QUEA_RHOS1      --------------------------MQLS----DFDFDLPERLIATRPARPRTAARLLL
QUEA_RHOS5      --------------------------MKLS----DFDFDLPERLIATRPARPRTAARLLL
QUEA_DINSH      --------------------------MHLS----DFDFDLPETLIATRPARPRSSARLLV
QUEA_THET2      -------------------------MEGLE----AYDYHLPPEQIAQEGVEPRDMARLMV
QUEA_THET8      -------------------------MEGLE----AYDYHLPPEQIAQEGVEPRDMARLMV
QUEA_DEIRA      --------------MPDSTADPSTADEVLA----RLHFDLPEDRIAQTGAEPRDTSRLMV
QUEA_RUBXD      --------------------------MRTD----ELDYELPQELIAQRPAEPRDASRLMV
QUEA_ANADF      --------------------------MRLS----DFDYELPEELVAQEPVTPRDASRLLV
QUEA_ANADE      --------------------------MRLS----DFDFALPEGLVAQAPVTPRDASRLMV
QUEA_SORC5      --------------------------MRCE----LLDYELPEALIASRPPEERDGARLLL
QUEA_SYNAS      -------------------------MMKLQ----DFDYQLPQSRIAQSPCAKRDHARMMV
QUEA_SOLUE      --------------------------MNLS----EFDYHLPDELIAQEALADRAASRMLV
QUEA_DESVV      -----------------MKDDATGADFLLS----GYDYELPEDRIAQHPPVERGLSRLLV
QUEA_DESVH      -----------------MKDDATGADFLLS----GYDYELPEDRIAQHPPVERGLSRLLV
QUEA_DESAG      MHSKHPTDTARRCETGTDSSDTAADDYSLA----GYRFELPEEQIAQHPPEHRGASRLFV
QUEA_SYNWW      -----------------MQHDKNEDIYRLS----TYYYDLPPELIAQYPAEYRDSSRLLV
QUEA_NOSS1      --MKKQILQLNLEQTSSAAAEDTNLDCSLA----GYDYVLPPERIAQNPAVPRDSSRLLV
QUEA_TRIV2      --MKKQILQLNLEQTSSAAAEDTNLDCSLA----GYDYVLPPERIAQNPAVPRDSSRLLV
QUEA_THEEB      --------------------MPHPDDFSLD----AYDYQLPPERIAQQPVSPRDRSRLMV
QUEA_SYNE7      ------------------MNEPSPSDWHLD----AYDYELPPDRIAQSAVEPRDHARLLV
QUEA_SYNP6      ------------------MNEPSPSDWHLD----AYDYELPPDRIAQSAVEPRDHARLSV
QUEA_ACAM1      -----------------MLGPTPELDQTLQ----AYDYLLPETFIAQTPLVPRDRSRLLV
QUEA_SYNY3      ----------------------MDQDKYLS----SYDYHLPADCIAQTPAVPRDHSRLLV
QUEA_GLOVI      -----------------MNAPIDERDFLTD----SYDYALPERCIAQQPAEPRDHSRLLV
QUEA_SYNSC      --------------------MPDPRDLQLS----SYDYPLPPERIAQAPVEPRHSARLLM
QUEA_SYNPX      --------------------MPDPRDLQLS----SYDYPLPQERIAQVPAEPRHSARMLM
QUEA_SYNS9      --------------------MPDSLDQQLS----SYAYHLPPERIAQAPVEPRHDARLLI
QUEA_SYNS3      --------------------MPDSRDLQLS----SYDYVLPEDRIAQAPVEPRHDARLLV
QUEA_SYNPW      --------------------MADPRDLQLS----AYDYELPEARIAQRPVEPRHAAKLLM
QUEA_PROMM      -------------------MVLDPRDSLLS----SYDYPLDPERIAQLPVEPRHSARLLI
QUEA_PROM3      -------------------MVLDPRDSLLS----SYDYPLDPERIAQLPVEPRHAARLLI
QUEA_SYNR3      -------------------MLIDPRDSLLS----SYDYELPEACIAQRPLEPRHAARLLM
QUEA_PROMA      -------------------MVIDPRDFLLS----SYDYELNSSLIAQEPIEPRHNARMLH
QUEA_PROMT      --------------------MLDQKDNLLS----SYNYDLPNELIAQSPTKSRHDAKLMI
QUEA_PROM1      --------------------MLDQKDNLLS----SYNYDLPKDLIAQSPTRSRHDAKLMI
QUEA_PROMP      ---------------MNFEIHNEEIDHKLE----AYDYILDETLIANKPSKVRHESRLMI
QUEA_DESPS      ----------------------MEKDLSRE----AYYYHLPEENIAQKPADKRDHSKLMV
QUEA_AQUAE      --------------------------MRIE----EFDYELPEELIAKYPAVPRHSARLMV
QUEA_NITSB      ----------------------MLDPLKVD----SYDYHLPPHLIAKEPVQPADRAKLLI
QUEA_ARCB4      ----------------------MLDPLKTS----SYDYNLPKNQIATYPVTPADSAKLLI
QUEA_CAMJE      ----------------------MNKDLLLS----SYDYTLANELIANYPTNPKEDARLLV
QUEA_SULDN      ---------------------MSSSELLTS----SYDFTLPEELIATQPANPRDSAKLLV
QUEA_HELPJ      -----------------------MKEFDLE----SYDYHLPKELIANYPVLPKEKAKLLV
QUEA_HELPH      -----------------------MKEFDLE----SYDYYLPKELIANYPVLPKEKAKLLV
QUEA_HELPY      -----------------------MKEFDLE----SYDYYLPKELIASYPVLPKEKAKLLV
QUEA_HELAH      -----------------------MKEFDLE----SYDYHLPKELIANYPILPKEKAKLLI
QUEA_HELHP      --------------MTYFDPKIQESDFALS----SYDYTLPFSAIAQNPANPRERAKLLI
QUEA_RICBR      --------------------------MKLS----DFDFDLPLELIAQNPISKRDESNLLI
QUEA_RICB8      --------------------------MKLS----DFDFDLPLELIAQNPISKRDESNLLI
QUEA_RICRS      --------------------------MKLS----DFDFDLPSELIAQYPSSERDNSDLLI
QUEA_RICRO      --------------------------MKLS----DFDFDLPSELIAQYPSSERDNSDLLI
QUEA_RICAH      --------------------------MKLS----AFDFNLPSELIAQSPSSERDNSDLLI
QUEA_RICFE      --------------------------MKLS----DFDFDLPTELIAQYPASERDNSDLLI
QUEA_RICTY      --------------------------MKLS----DFDFNVPNALIAQYPSSERDNSDLLI
QUEA_RICCK      --------------------------MKLS----DFDFDLPSELIAQYPSSKRDHSDLLI
QUEA_BORBP      --------------------------MKTK----EFHFNLPYSLIAQYPSEKRGSSRLMV
QUEA_BORAP      --------------------------MKTK----EFHFNLPYSLIAQYPSEKRGSSRLMV
QUEA_BORBU      --------------------------MKTK----EFHFNLSHSLIEQYPSEKRGSSRLIV
QUEA_TREDE      --------------------------MLTK----EFNFDLPEELIAQSPSEKRGGDRLLI
                                                     : :    :            :  

QUEA_SHISS      LDG-------PTGALTHGTFTDLLDKLNPGDLLVFNNTRVIPARLFGRKA----------
QUEA_ECOHS      LDG-------PTGALTHGTFTDLLDKLNPGDLLVFNNTRVIPARLFGRKA----------
QUEA_SHIFL      LDG-------PTGALTHGTFTDLLDKLNPGDLLVFNNTRVIPARLFGRKA----------
QUEA_SHIDS      LDG-------PTGALTHGTFTDLLDKLNPGDLLVFNNTRVIPARLFGRKA----------
QUEA_ECO57      LDG-------PTGALTHGTFTDLLDKLNPGDLLVFNNTRVIPARLFGRKA----------
QUEA_ECO24      LDG-------PTGALTHGTFTDLLDKLNPGDLLVFNNTRVIPARLFGRKA----------
QUEA_SHIF8      LDG-------PTGALTHGTFTDLLDKLNPGDLLVFNNTRVIPARLFGRKA----------
QUEA_ECOLI      LDG-------PTGALTHGTFTDLLDKLNPGDLLVFNNTRVIPARLFGRKA----------
QUEA_ECOLC      LDG-------PTGALTHGTFTDLLDKLNPGDLLVFNNTRVIPARLFGRKA----------
QUEA_ECOL5      LDG-------PTGALTHGTFTDLLDKLNPGDLLVFNNTRVIPARLFGRKA----------
QUEA_ECOL6      LDG-------PTGALTHGTFTDLLDKLNPGDLLVFNNTRVIPARLFGRKA----------
QUEA_SHIBS      LDG-------PTGALTHGTFTDLLDKLNPGDLLVFNNTRVIPARLFGRKA----------
QUEA_ECOK1      LDG-------PTGALTHGTFTDLLDKLNPGDLLVFNNTRVIPARLFGRKA----------
QUEA_ECOUT      LDG-------PTGALTHGTFTDLLDKLNPGDLLVFNNTRVIPARLFGRKA----------
QUEA_SALPB      LEG-------PTGALTHGTFTDLLDKLNPGDLLVFNNTRVIPARLFGRKA----------
QUEA_SALTY      LEG-------PTGALTHGTFTDLLDKLNPGDLLVFNNTRVIPARLFGRKA----------
QUEA_SALCH      LEG-------PTGALTHGTFTDLLDKLNPGDLLVFNNTRVIPARLFGRKA----------
QUEA_SALPA      LEG-------PTGALTHGTFTDLLDKLNPGDLLVFNNTRVIPARLFGRKA----------
QUEA_SALTI      LEG-------PTGALTHGTFTDLLDKLNPGDLLVFNNTRVIPARLFGRKA----------
QUEA_SALAR      LEG-------PTGALTHGTFTDLLDKLNPGDVLVFNNTRVIPARLFGRKA----------
QUEA_CITK8      LDG-------PTGALTHGTFTDLLDKLNPGDLLVFNNTRVIPARLFGRKA----------
QUEA_ENT38      LDG-------PTGALTHGTFTDLLDKLNPGDLLVFNNTRVIPARLFGRKA----------
QUEA_KLEP7      LDG-------PTGALTHGTFTDILDKLNPGDLLVFNNTRVIPARLFGRKA----------
QUEA_CROS8      LDG-------PTGDLTHGTFTDLLDKLNPGDLLVFNNTRVIPARLFGRKA----------
QUEA_YERPE      LDG-------PTGTLTHGIFTDLLDKLAPGDLLVFNNTRVIPARLFGRKA----------
QUEA_YERPS      LDG-------PTGTLTHGIFTDLLDKLAPGDLLVFNNTRVIPARLFGRKA----------
QUEA_YERP3      LDG-------PTGTLTHGIFTDLLDKLAPGDLLVFNNTRVIPARLFGRKA----------
QUEA_YERE8      LDG-------PTGALTHGIFTDLLDKLVPGDLLVFNNTRVIPARLFGRKA----------
QUEA_SERP5      LDG-------PSGELKHGVFTDLLDNLEAGDLLVFNNTRVIPARMFGRKV----------
QUEA_PECAS      LDG-------PTGDLTHGVFTDLLEKLNPGDLLVFNNTRVIPARLFGRKV----------
QUEA_PHOLL      LDG-------ETGALTHGIFTDVLDKLNAGDLLVFNNTRVIPARIFGRKA----------
QUEA_SODGM      LDG-------QTGALAHQVFTDLLEELAPGDLLVFNNTRVIPARLFGRKV----------
QUEA_BAUCH      LDG-------HSGAIKHNVFTDILDQLSLGDLLVFNNTRVIPARLFGRKI----------
QUEA_VIBCH      LDG-------NSGQLVDGTFKDVLELVEPGDLLVFNNTRVIPARMFGRKA----------
QUEA_VIBC3      LDG-------NSGQLVDGTFKDVLELVEPGDLLVFNNTRVIPARMFGRKA----------
QUEA_VIBPA      MDG-------NTGELIDGTFTDVLNQVQAGDLVVFNNTRVIPARMFGRKE----------
QUEA_VIBCB      MDG-------NTGELIDGTFSDVLEQVQAGDLVVFNNTRVIPARLFGRKE----------
QUEA_VIBVU      LNG-------NTGAVKDGSFKDVLELVQAGDLLVFNNTRVIPARMFGRKE----------
QUEA_VIBVY      LNG-------NTGAVKDGSFKDVLELVQAGDLVVFNNTRVIPARMFGRKE----------
QUEA_ALIF1      LNG-------NSGELNDGQFTDILDLVQAGDLLVFNNTRVIPARMFGMKA----------
QUEA_PHOPR      LTG-------ETGNIQHKGFKDVLDLAESGDLFVFNNTRVIPARIFGRKA----------
QUEA_AERHH      LDG-------QTGALRHGQFVDVLDQLNPGDLLVFNNTRVIPARMFGQKA----------
QUEA_AERS4      LDG-------QSGALRHGQFVDVLDQLNPGDLLVFNNTRVIPARMFGQKA----------
QUEA_COLP3      LNG-------NSGAITDGVFTDIVAQLNSGDLLVFNNTRVIPARMFGQKA----------
QUEA_PSEA6      LA---------TTGLSHLQFTDVVNLINPGDLLIFNNTRVIPARLLGQKA----------
QUEA_SHEPA      LDG-------NSGQLADLQFTDILEQVNPGDLMVFNNTRVIPARMFGTKQ----------
QUEA_SHEHH      LDG-------NSGELTDLQFTDILEQVNLGDLMVFNNTRVIPARMFGQKQ----------
QUEA_SHELP      LDG-------NSGAVADKQFTDILEMVNPGDLMVFNNTRVIPARVFGQKQ----------
QUEA_SHESM      LDG-------NTGTLADKQFTDLLGMINPGDLMVFNNTRVIPARLFGQKA----------
QUEA_SHESA      LDG-------NTGTLADKQFTDLLGMINPGDLMVFNNTRVIPARLFGQKA----------
QUEA_SHESR      LDG-------NTGTLADKQFTDLLGMINPGDLMVFNNTRVIPARLFGQKA----------
QUEA_SHEON      LDG-------NTGTLVDKQFTDLLGMINPGDLMVFNNTRVIPARLFGQKA----------
QUEA_SHESW      LDG-------NSGALGDKQFTDLLEMINPGDLMVFNNTRVIPARMFGQKA----------
QUEA_SHEPC      LDG-------NSGALGDKQFTELLEMINPGDLMVFNNTRVIPARMFGQKA----------
QUEA_SHEB8      LDG-------NSGALGDKQFTDLLGMINPGDLMVFNNTRVIPARMFGQKA----------
QUEA_SHEB9      LDG-------NSGALGDKQFTDLLGMINPGDLMVFNNTRVIPARMFGQKA----------
QUEA_SHEB5      LDG-------NSGALGDKQFTDLLGMINPGDLMVFNNTRVIPARMFGQKA----------
QUEA_SHEFN      LSG-------ENSELADKKFTDLFNLINPGDLMVFNNTRVIPARLFGQKS----------
QUEA_SHEDO      LDG-------PTGALADKQFTDLFEMINPGDLMVFNNTRVIPARLFGQKA----------
QUEA_SHEAM      LDG-------STGALADRQFTDILALIEPGDLMIFNNTRVIPARLFGQKA----------
QUEA_PSEHT      LDG-------PSGVVEHKVFSDLLELVNENDLLVFNNTRVIPARMFGQKA----------
QUEA_HAEIG      LNG-------ENGEIFHRTFSDVLDLIDEGDLLIFNNTRVIPARMFGRKA----------
QUEA_HAEIE      LNG-------ENGEIFHRTFSDVLDLIDEGDLLIFNNTRVIPARMFGRKA----------
QUEA_HAEI8      LNG-------ENGEIFHRTFSDVLDLIDQGDLLIFNNTHVIPARMFGRKA----------
QUEA_HAEIN      LNG-------ENGEIFHRTFSDVLDLIDEGDLLIFNNTRVIPARMFGRKA----------
QUEA_HAES1      LNG-------QNGELFHRTFSDVADLINEGDLLIFNNTRVIPARMFGRKA----------
QUEA_HISS2      LNG-------QNGELFHRTFSDVADLINEGDLLIFNNTRVIPARMFGRKA----------
QUEA_PASMU      LNG-------ENGEITHRTFADILDQIHEGDLLIFNNTRVIPARMFGRKA----------
QUEA_MANSM      LSG-------ENGDISHHTFSDVYDLINEGDLLIFNNTRVIPARMYGRKA----------
QUEA_HAEDU      LNG-------ESGKFSDLHFSDLLDHINPGDLLIFNNTRVIPARLYGRKE----------
QUEA_ACTP2      LNG-------ETGHFEDKQFFDLLDQINEGDLLIFNNTRVIPARLYGRKA----------
QUEA_MARMS      LDG-------HSGEVVHRQFPDVLDLVQPGDLMVFNNTRVIPARVFGQKE----------
QUEA_PSEAB      LDG-------PTGTLAHRQFADLLDYLRPGDLMVFNNTRVIPARLFGQKE----------
QUEA_PSEAE      LDG-------PTGTLAHRQFADLLDYLRPGDLMVFNNTRVIPARLFGQKE----------
QUEA_PSEA7      LDG-------PTGSLAHKQFADLLDYLRPGDLMVFNNTRVIPARLFGQKE----------
QUEA_PSEMY      LDG-------PSGALRHGQFTDLLEQLRPGDLMVFNNTRVIPARLFGQKA----------
QUEA_PSEP1      LDG-------PTGALAHRQFPDLLDYLRPGDLMVFNNTRVIPARLFGQKA----------
QUEA_PSEPK      LDG-------PTGALAHRQFPDLLDYLRPGDLMVFNNTRVIPARLFGQKA----------
QUEA_PSEPG      LDG-------PTGALSHRQFPDLLDYLRPGDLMVFNNTRVIPARLFGQKA----------
QUEA_PSEE4      LDG-------PSGELAHKQFTDLLEYLRPGDLMVFNNTRVIPARLFGQKA----------
QUEA_PSEU2      LDG-------PTGALAHRQFTDLLEHLRPGDLMVFNNTRVIPARLFGQKA----------
QUEA_PSE14      LDG-------PTGALAHRQFTDLLEHLRPGDLMVFNNTRVIPARLFGQKA----------
QUEA_PSESM      LDG-------PTGALAHRQFTDLLEHLRSGDLMVFNNTRVIPARLFGQKA----------
QUEA_PSEF5      LDG-------PTGALAHRQFTDLLEHLRPGDLMVFNNTRVIPARLFGQKA----------
QUEA_PSEPF      LDG-------VSGALAHRQFTDLLEHLRPGDLMVFNNTRVIPARLFGQKA----------
QUEA_SACD2      LDG-------PSGELAHKQFPDLLNLVEEGDLMVFNNTRVIPARVFGQKA----------
QUEA_MARHV      LDG-------LSGQTTHLKFTDLPDLLQPGDLLVFNNTRVIPARLFGQKE----------
QUEA_IDILO      VKA-------NENSIEHKHFKNIVDEINAGDLLVFNDTRVIPARLLGEKV----------
QUEA_CHRSD      LDD-------ATGDIAHRRFTDLLTLLAPGDLLVFNDTRVIPARLFGQKA----------
QUEA_ALKEH      LDR-------DTGAVADRRFPDLVDLLRPEDLLVLNDTRVIPARLFGHKP----------
QUEA_HAHCH      LDA-------ETGEINHRGFKDLLGMVNPGDLLVFNDTRVIPARLFGQKR----------
QUEA_ALCBS      LTC-------DA--LEHQQFPDLLSHVHPGDLLIFNDTRVIPARLFGQKE----------
QUEA_HYDCU      MNA--------DGSVSDCHFPDILSYVNENDCLIFNNTKVIPARLFGQKL----------
QUEA_XYLFT      VPS-------APEQFQDCYVRDLPELLQPGDLLVFNDTRVIPARLFGRKV----------
QUEA_XYLFA      VPS-------APEQFQDCYVRDLPELLQPGDLLVFNDTRVIPARLFGRKV----------
QUEA_XANAC      VPP-------SPQALADRQVRDLPELLQPGDLLIFNDTRVIPARLFGQKA----------
QUEA_XANC5      VPP-------APAAFGDRQVRDLPELLQPGDLLIFNDTRVIPARLFGQKA----------
QUEA_XANOR      VPP-------SPQALADRRARDLPELLQPGDLLIFNDTRVIPARLFGQKA----------
QUEA_XANCP      VPP-------TPAAFSDRQVRDLPELLQPGDLLIFNDTRVIPARLFGQKA----------
QUEA_XANC8      VPP-------TPAAFSDRQVRDLPELLQPGDLLIFNDTRVIPARLFGQKA----------
QUEA_METCA      LDG-------ATGALEDKSFRDIEKLLRPGDLLVFNDTRVLPARLFGRKE----------
QUEA_NITOC      LEG-------ASGIVKDRQFIELPELLSTKDLLIFNNTKVIPARIQGTKD----------
QUEA_CUPMC      VERTAPEDTSEAVRLVDRAFSDILEYLNPDDLLVFNDTRVIKARFFGHKP----------
QUEA_CUPPJ      VERLAPGEQPDAIRLVDRAFSDIIGYLKPEDLLVFNDTRVIKARFFGQKP----------
QUEA_CUPNH      VERLAPADTADAVRMVDRAFSDIVDYLRPDDLLVFNDTRVIKARFFGHKP----------
QUEA_RALSO      ARHDAQGTHFD-----DRQFADLVDYLRPGDLLVFNDTRVIKARFFGHKA----------
QUEA_BURCA      VDG-----SVAPARLVDRHFAELPSCIAPGDLLVFNDTKVLKARFFGQKA----------
QUEA_BURCH      VDG-----SVAPARLVDRHFAELPSCIAPGDLLVFNDTKVLKARFFGQKA----------
QUEA_BURL3      VDG-----TVAPARLVDRHFTELPSCISAGDLLVFNDTKVLKARFFGQKA----------
QUEA_BURVG      VDG-----TVAPARLVDRRFAELPSCIARGDLLVFNDTKVLKARFFGQKA----------
QUEA_BURCM      VDH-----TVEPARLVDRNFVELPSCIAPGDLLVFNDTRVLKARFFGQKA----------
QUEA_BURP0      VDN-T--NPSAPPRLVDRRFAELPACVAPGDLLVFNDTKVLKARFFGRKA----------
QUEA_BURP1      VDN-T--NPSAPPRLVDRRFAELPACVAPGDLLVFNDTKVLKARFFGRKA----------
QUEA_BURP6      VDN-T--NPSAPPRLVDRRFAELPACVAPGDLLVFNDTKVLKARFFGRKA----------
QUEA_BURPS      VDN-T--NPSAPPRLVDRRFAELPACVAPGDLLVFNDTKVLKARFFGRKA----------
QUEA_BURMS      VDN-T--NPSAPPRLIDRRFAELPACVAPGDLLVFNDTKVLKARFFGRKA----------
QUEA_BURM9      VDN-T--NPSAPPRLIDRRFAELPACVAPGDLLVFNDTKVLKARFFGRKA----------
QUEA_BURM7      VDN-T--NPSAPPRLIDRRFAELPACVAPGDLLVFNDTKVLKARFFGRKA----------
QUEA_BURMA      VDN-T--NPSAPPRLIDRRFAELPACVAPGDLLVFNDTKVLKARFFGRKA----------
QUEA_PARXL      VDNPA--GATGPARLIDRRFAELPDCIAAGDLLVFNDTKVLKARFLGQKA----------
QUEA_JANMA      VLP---------EQMTDRNFAYIVDLLSPGDLLVFNDTRVLKARFFGIKE----------
QUEA_HERAR      VAQ---------DGMIDRAFADIVDLLNPGDLLVFNDTRVLKARFFGVKE----------
QUEA_AZOSB      VDG---------DVLADRRFVDLPDFIRPGDLLVFNDTRVLHARLFGVKA----------
QUEA_AROAE      LDG---------ERLDDRGFCDLPELVQPGDLLVFNDTRVIHARLYGTKE----------
QUEA_DECAR      VCG---------EQLVDRRFADLPTLLKAGDLLVFNDTRVIKARFFGQKD----------
QUEA_BORPA      LDA--------ASRLHDRRFPDLAGLLRPHDLLVFNDTRVIKARLTGQKA----------
QUEA_BORBR      LDA--------ASRLHDRRFPDLAGLLRPHDLLVFNDTRVIKARLTGQKA----------
QUEA_BORPE      LDA--------ASRLHDRRFPDLAGLLRPHDLLVFNDTRVIKARLTGQKA----------
QUEA_THIDA      VTA--------AGALHDRMFRELPTLLGADDLLVMNDTRVIKARLFGEKD----------
QUEA_NEIM0      ALPDM--------PLQDRVFGDLPDYVEAGDVLVFNNTKVMKARLFGQKD----------
QUEA_NEIMA      ALPDM--------PLQDRVFGDLPDYVEAGDVLVFNNTKVMKARLFGQKD----------
QUEA_NEIMB      ALPDM--------PLQDRVFGDLPDYVEAGDVLVFNNTKVMKARLFGQKD----------
QUEA_NEIG1      ALSDM--------PLQDRVFGDLPDYVEAGDVLVFNNTKVMKARLFGQKD----------
QUEA_CHRVO      HVDGM--------TLSDLSFADLPSRLQAGDLLVFNDTRVIRARLFGEKA----------
QUEA_NITEU      VNGKH-------ADLRDAAFRNLPDYLKRGDVIVLNNTRVVKARLSGVKS----------
QUEA_NITEC      INSRQ-------SDLRDAAFKDLPAYLKQGDVIVFNNTRVVKARLAGFKS----------
QUEA_NITMU      LDATS-------GALQDRMFADLPSYLRPGDVIVFNDTRVIKARLYGVRD----------
QUEA_POLAQ      VRA----DGMNHAHLVDRQFKDILILAQPGDLLVFNDTKVIPARLHGKKE----------
QUEA_DICNV      AAV----ESAQKVHISNKQMIDFIDFLKPEDLLVINNTRVVPARMFGHKI----------
QUEA_PSYWF      LPA----QKENTAVIQDRQFSDLPELLQAGDLIVFNDTKVMKARLFGQKD----------
QUEA_PSYA2      LPT----NNANSQV-EDKLFSELPDILNAGDLIVFNDTKVMKARLFGQKD----------
QUEA_ACIAD      LDA----HGH----YHDHAFTDILDLINDGDLLVLNDTKVMKARLKGKRA----------
QUEA_LEGPL      YNR-------QTEEYGHYQFREIADFLQPGDLLVMNDSKVIPARLYGHKA----------
QUEA_LEGPH      YNR-------QTEEYGHYQFREIADFLQPGDLLVMNDSKVIPARLYGHKA----------
QUEA_LEGPA      YNR-------QTEEYGHYQFREIADFLQPGDLLVMNDSKVIPARLYGHKA----------
QUEA_LEGPC      YNR-------QTEEYGHYQFREIADFLQPGDLLVMNDSKVIPARLYGHKA----------
QUEA_COXBU      IDR-------SRRTVSHRQFNGFVEQVKPNDLVVLNDTKVIPARLFGHKQ----------
QUEA_COXBN      IDR-------SRRTVSHRQFNGFVEQVKPNDLVVLNDTKVIPARLFGHKQ----------
QUEA_COXBR      IDR-------SRRTVSHRQFNGFVEQVKPNDLVVLNDTKVIPARLFGHKQ----------
QUEA_BUCAI      MYG-------HTGMIFHKRFFNIIDEINSGDLIILNNTQVIPARFFGKKE----------
QUEA_BUCAP      ING-------HTGKIAHKFFFNILNEINSGDLIIFNDTKVIPARLFGYKK----------
QUEA_BLOFL      FDR-------LTTKITHHFFSDLPEILNPGDLLIFNDTRVIPARLYGYSV----------
QUEA_VESOH      K----------RSSIIDIQFNQIGDFFQSGDLLIMNNTKVIPARLFGTKE----------
QUEA_FRATH      LNK-------QTGEIADYKFTDFIDFINPGDLLVFNNSKVMLARLYGSKT----------
QUEA_FRATO      LNK-------QTGEIADYKFTDFIDFINPGDLLVFNNSKVMLARLYGSKT----------
QUEA_FRATF      LNK-------QTGEIADYKFTDFIDFINPGDLLVFNNSKVMLARLYGSKT----------
QUEA_FRATW      LNK-------QTGEIADYKFTDFIDFINPGDLLVFNNSKVMLARLYGSKT----------
QUEA_FRATT      LNK-------QTGEIADYKFTDFIDFINPGDLLVFNNSKVMLARLYGSKT----------
QUEA_FRAT1      LNK-------QTGEIADYKFTDFIDFINPGDLLVFNNSKVMLARLYGSKT----------
QUEA_FRATN      LNK-------QTGEIADHKFTDFIDFISPGDLLVFNNSKVMLARLYGSKT----------
QUEA_FRAP2      LNK-------QTGEILDHKFTDFIDFINPEDLLIFNNSKVMLARLYGEKI----------
QUEA_GEOKA      LDK--RT-----GAIRHETFRNIISYLNPGDCLVLNDTRVMPARLYGEKE----------
QUEA_GEOTN      LDK--QT-----GAIRHETFRNIISYLHPGDCLVLNDTRVMPARLYGEKA----------
QUEA_BACSU      LDK--HT-----GELTDSSFKHIISFFNEGDCLVLNNTRVLPARLFGTKE----------
QUEA_BACVZ      LDK--QT-----GGLTDSSFKEIVSFFNEGDCLVLNNTRVLPARLFGTKE----------
QUEA_BACP2      LNK--QT-----GEVTHDTFSQITDYFQTGDCLVLNNTRVLPARLFGMKE----------
QUEA_BACLD      LDK--KT-----GEITHSTFKHVIDFLNAGDCIVLNDTRVLPARLYGVKE----------
QUEA_BACHD      LDK--HT-----GAVEDKKFPDLLQFIEAGDCLVLNDTRVLPARLFGVKE----------
QUEA_BACHK      LDR--ET-----GDIEHKHFTDILSYLHEGDCLVLNETKVMPARLHGVKE----------
QUEA_BACC1      LDR--ET-----GDIEHKHFTDILSYLHEGDCLVLNETKVMPARLHGVKE----------
QUEA_BACAN      LDR--ET-----GDIEHKHFTDILSYLHEGDCLVLNETKVMPARLHGVKE----------
QUEA_BACCZ      LDR--ET-----GDIEHKHFTDILSYLHEGDCLVLNETKVMPARLQGVKE----------
QUEA_BACCR      LDR--ET-----GDIEHKHFTDILSYLHEGDCLVLNETKVMPARLHGVKE----------
QUEA_BACCN      LDR--ET-----GDIEHKHFSDILAYLHEGDCLVLNETKVMPARLHGVKE----------
QUEA_OCEIH      LDK--QT-----SEITHRSFKDITTYLQAGDCLVLNDTKVLPARLYGVKS----------
QUEA_LISMO      LDK--ES-----GDIKDQHFTDIISYLNEGDALVLNDTRVLPARLHGIKD----------
QUEA_LISMF      LDK--KS-----GDIKDQHFTDIISYLNEGDALVLNDTRVLPARLHGIKD----------
QUEA_LISIN      LDK--ES-----GEIKDQHFTDIISYLNKGDALVLNDTRVLPARLHGIKD----------
QUEA_LISW6      LDK--KS-----GEIKDQHFTDILSYLNEGDALVLNDTRVLPARLHGTKD----------
QUEA_BACSK      VDK--KT-----KAISDRMFPDLIEALSPGDCLVLNDTKVMPARLLGEKV----------
QUEA_STRT2      IDP--VT-----REMTDTHFDHIIDQLNPGDALVMNNTRVLPARLYGEKT----------
QUEA_STRTD      IDP--VT-----REMTDTHFDHIIDQLNPGDALVMNNTRVLPARLYGEKT----------
QUEA_STRT1      IDP--VT-----REMTDTHFDHIIDQLNPRDALVMNNTRVLPARLYGEKT----------
QUEA_STRA1      IDH--KN-----KTMTDSHFDHILDELKPGDALVMNNTRVLPARLYGEKQ----------
QUEA_STRA5      IDH--KN-----KTMTDSHFDHILDELKPGDALVMNNTRVLPARLYGEKQ----------
QUEA_STRA3      IDH--KN-----KTMTDSHFDHILDELKPGDALVMNNTRVLPARLYGEKP----------
QUEA_STRP8      IDH--RQ-----KTMVDSHFDHIIDQLNPGDALVMNNTRVLPARLYGEKP----------
QUEA_STRPF      IDH--RQ-----KTMVDSHFDHIIDQLNPGDALVMNNTRVLPARLYGEKP----------
QUEA_STRP6      IDH--RQ-----KTMVDSHFDHIIDQLNPGDALVMNNTRVLPARLYGEKP----------
QUEA_STRPB      IDH--RQ-----KTMVDSHFDHIIDQLNPGDALVMNNTRVLPARLYGEKP----------
QUEA_STRPM      IDH--RQ-----KTMVDSHFDHIIDQLNPGDALVMNNTRVLPARLYGEKP----------
QUEA_STRPC      IDH--RQ-----KTMVDSHFDHIIDQLNPGDALVMNNTRVLPARLYGEKP----------
QUEA_STRPG      IDH--RQ-----KTMVDSHFDHIIDQLNPGDALVMNNTRVLPARLYGEKP----------
QUEA_STRP1      IDH--RQ-----KTMVDSHFDHIIDQLNPGDALVMNNTRVLPARLYGEKP----------
QUEA_STRP3      IDH--RQ-----KTMVDSHFDHIIDQLNPGDALVMNNTRVLPARLYGEKP----------
QUEA_STRPD      IDH--RQ-----KTMVDSHFDHIIDQLNPGDALVMNNTRVLPARLYGEKP----------
QUEA_STRMU      VDH--QK-----KTMKDTHFDHIIDELNSGDALVMNDTRVLPARLHGEKT----------
QUEA_STRP2      VNR--ET-----GEMQDKHFHSIIDMLEPGDALVMNDTRVLPARLYGQKV----------
QUEA_STRR6      VNR--ET-----GEMQDKHFHSIIDMLEPGDALVMNDTRVLPARLYGQKV----------
QUEA_STRPN      VNR--ET-----GEMQDKHFHSIIDMLEPGDALVMNDTRVLPARLYGQKV----------
QUEA_STRSV      VDK--ET-----GAFSDQHFDQIIDQLQPGDALVMNNTRVLPARLYGIKP----------
QUEA_LACLM      LDP--KT-----EELEDRHFYDIIDELEAGDALVLNNTRVLPARLHGERA----------
QUEA_LACLA      LDP--KT-----EELEDRHFYNIIDELEAGDALVLNNTRVLPARLHGERA----------
QUEA_LACPL      LDR--QT-----GEMQDKHFYDIIDQLNPGDAVVMNNSRVMPARLYGVKP----------
QUEA_LACBA      LDH--QA-----NTLEDKHFYDILDELHAGDAVVMNNSRVMPARLYGIKP----------
QUEA_PEDPA      LDH--ET-----GAMEDKHFYDIIDQLNPGDAVVMNNSRVMPARIYGIKD----------
QUEA_LACSS      MDH--ET-----GALEDKVFYDIIDELNPGDAVVMNNTRVLPARLYGVKP----------
QUEA_ENTFA      VNK--ET-----GDMEDKHFHDILDELQPGDALVMNNTRVLPARLYGEKP----------
QUEA_STAAM      MDR--ET-----GEMKHLHFKDIIEYFRPGDTLVLNDTRVMPARLFGLKE----------
QUEA_STAA9      MDR--ET-----GEMKHLHFKDIIEYFRPGDTLVLNDTRVMPARLFGLKE----------
QUEA_STAA2      MDR--ET-----GEMKHLHFKDIIEYFRPGDTLVLNDTRVMPARLFGLKE----------
QUEA_STAA1      MDR--ET-----GEMKHLHFKDIIEYFRPGDTLVLNDTRVMPARLFGLKE----------
QUEA_STAAB      MDR--ET-----GEMKHLHFKDIIEYFRPGDTLVLNDTRVMPARLFGLKE----------
QUEA_STAAW      MDR--ET-----GEMKHLHFKDIIEYFRPGDTLVLNDTRVMPARLFGLKE----------
QUEA_STAAN      MDR--ET-----GEMKHLHFKDIIEYFRPGDTLVLNDTRVMPARLFGLKE----------
QUEA_STAAR      MDR--ET-----GEMKHLHFKDIIEYFRPGDTLVLNDTRVMPARLFGLKE----------
QUEA_STAAS      MDR--ET-----GEMKHLHFKDIIEYFRPGDTLVLNDTRVMPARLFGLKE----------
QUEA_STAAE      MDR--ET-----GEMKHLHFKDIIEYFRPGDTLVLNDTRVMPARLFGLKE----------
QUEA_STAAC      MDR--ET-----GEMKHLHFKDIIEYFRPGDTLVLNDTRVMPARLFGLKE----------
QUEA_STAA8      MDR--ET-----GEMKHLHFKDIIEYFRPGDTLVLNDTRVMPARLFGLKE----------
QUEA_STAAT      MDR--ET-----GEMKHLHFKDIIEYFRPGDTLVLNDTRVMPARLFGLKE----------
QUEA_STAA3      MDR--ET-----GEMKHLHFKDIIEYFRPGDTLVLNDTRVMPARLFGLKE----------
QUEA_STAHJ      LGR--NS-----GNIEHKHFKDVINYLETGDTLVLNDTRVMPARLFGLKE----------
QUEA_STAES      LSK--DT-----GELTHLHFRDVIHYFEPGDTLVLNDTRVMPARLFGLKE----------
QUEA_STAEQ      LSK--DT-----GELTHLHFRDVIHYFEPGDTLVLNDTRVMPARLFGLKE----------
QUEA_STAS1      LGR--QS-----GYIEHKHFKDVTDYLNEGDTLVLNDTRVMPARLFGMKE----------
QUEA_CLOBH      LDK--ET-----GEIEHKIFKDILDYLTPNDCLVLNNTRVLPARLIGAKE----------
QUEA_CLOB1      LDK--ET-----GEIEHKIFKDILDYLTPNDCLVLNNTRVLPARLIGAKE----------
QUEA_CLOBL      LDK--ET-----GEIEHKIFKDILDYLTPNDCLVLNNTRVLPARLIGSKE----------
QUEA_CLOTE      LDK--ET-----GHVEHKVFKDILDYLNKGDCLVLNDTRVMPARLIGEKE----------
QUEA_CLOAB      VDK--KS-----GEVEHRIFKDVIDYLNPGDCLVLNDTRVLPARLIGNKV----------
QUEA_CLOK5      LDK--KT-----GKVCHKIFKDIVYYLNPGDCVVLNDTRVLPARLIGVRE----------
QUEA_CLOPE      LDK--KT-----GEIEHRKFHDILEYLNEGDTLVLNNTRVLPARLIGEKE----------
QUEA_CLOP1      LDK--KT-----GEIEHRKFHDILEYLNEGDTLVLNNTRVLPARLIGEKE----------
QUEA_CLOPS      LDK--KT-----GEIEHRKFHDILEYLNEGDTLVLNNTRVLPARLIGEKE----------
QUEA_CLOB8      LDK--KT-----GEIKHKKFHDIIEYLNEGDTLVLNNTRVMPARLIGEKE----------
QUEA_HUNT2      LDK--ET-----GKISHKRFKDIVEYINKGDCLVLNDTRVIPARLLGEKE----------
QUEA_CLOD6      LDK--ET-----GNIEHKVFRDIIEYLNPGDCLVLNNTRVIPARLIGEKL----------
QUEA_LACP7      LDK--NT-----GKVTHHIFKEIVKYLKKGDCLVLNNTKVIPARLMGERIIEKTPLAPGH
QUEA_ALKMQ      LDK--NK-----QEIVHKHFYDITDYLNPGDCLVINNTRVLPARLFGVKE----------
QUEA_CALS4      LDR--RT-----GEIKHDIFKNITKYLKEGDCLVLNDTKVIPARLIGQRE----------
QUEA_SYMTH      VHR--AS-----GAIEHRCFRDLPEYLRPGDGLVINETRVMPARLLGSRE----------
QUEA_MOOTA      LHR--EG-----GFLEHRHFYDLPRYLHPGDVLVVNETKVIPARLWGYRA----------
QUEA_DESHY      MNR--WT-----GEIEHRVFRELPELLQAGDVLVVNNTRVIPARLIGEKE----------
QUEA_DESRM      VHR--DI-----DRTEHKTFKDLLQYLQPGDVLVMNDSKVLPARIYGEKV----------
QUEA_PELTS      VRL--DG-----KEFEHRLFKDIVDYLNPGDALVINETKVIPARLVGRKE----------
QUEA_CARHZ      LKR--QT-----GEITHDVFKNLKKYLVPGDLLVVNKTRVIPARLFGVRE----------
QUEA_FUSNN      IDR--KN-----GSVEHKNFYNIIDYLQKGDILVRNATKVIPARIFGHKD----------
QUEA_THEMA      LHR--KT-----QRIEHRIFREIIEYLEPGDLLVLNVSKVIPARLYARKK----------
QUEA_THEP1      LHR--KT-----QRIEHRIFREIIEYLEPGDLLVLNVSKVIPARLYARKK----------
QUEA_THEM4      LNR--KE-----KKIEHKIFRNIVEYLHEGDLLVRNVTKVIPARIYGRKE----------
QUEA_DEHMC      LNR--QS-----GELTNRIFGEITDYFKPGDVLVMNDSRVLPARIKGIKQ----------
QUEA_DEHMB      LNR--QS-----EELTNRIFGEITDYFKPGDVLVMNDSRVLPARIKGIKQ----------
QUEA_DEHM1      LNR--QS-----GELKSCIFRDITGYFQPGDVLVMNNSRVLPARIKGIKQ----------
QUEA_FLAJ1      IDR--QK-----NTIEHKMFKDVINYFDDGDVLILNNTKVFPARLYGNKE----------
QUEA_FLAPJ      VNR--AK-----GTIEHKMFKDVLDYFDEGDVLVLNNTKVFPARLYGNKE----------
QUEA_BACFN      LHK--RT-----GEIEHKMFKDILNYFDDKDVFVFNDTKVFPARLYGNKE----------
QUEA_BACFR      LHK--RT-----GEIEHKMFKDILNYFDDKDVFVFNDTKVFPARLYGNKE----------
QUEA_BACV8      VHK--ST-----GKIEHKVFKDILDYFDDKDVFIFNDTKVFPARLYGNKE----------
QUEA_PARD8      VHR--DT-----GEIEHREFKDILDYYGKGDVFIFNNTKVFPARLYGNKE----------
QUEA_CYTH3      INR--AT-----GTIEHKIFKDIINYFDEGDIMVMNNTKVFPARLYGNKE----------
QUEA_GEOMG      VDR--LK-----GEVGEVSFREITRLFRPGDLLVVNDTRVIPARFFGVKES---------
QUEA_GEOSL      VER--DG-----GGIGEIPFRGIVDLFRPGDLLVINDTRVIPARLLGRKES---------
QUEA_GEOUR      LDR--VN-----GELNETIISEIAALFRDGDLLVINDTRVIPARLLGKKES---------
QUEA_PELCD      LNR--VT-----QQLQLAQFADIADWFRPGDVLVVNDTRVIPARLIGRKQT---------
QUEA_PELPD      LNR--ES-----GTIGHGLFRDIADHLRPGDLLVLNDTRVIPARLFGRKAT---------
QUEA_PELLD      ICR--EG-----GTVSHARYRELDTFLRKGDLLVLNNTRVVKARLMAEKST---------
QUEA_CHLPM      LNR--HT-----GSVQHARYSNLEAFLGYGDLLVINTTKVVRARLFAVKQT---------
QUEA_CHLPD      LQR--ST-----GEIMHSRYAGLHGFLRKGDLLVLNNSRVVKARMFAFKPT---------
QUEA_CHLTE      LNR--AT-----GSITHSAYASLHEELRPGDLLVLNNSRVIRARLIAHKPT---------
QUEA_CHLCH      LNR--QS-----GALTHSLYAHLDTFLQAGDLLLLNNTRVVPARLFATRAT---------
QUEA_CAUVC      VRP-G-------QAVADHIVSDLPDFLRPGDALVFNDTRVIPARLSGLREGRTTGGADGT
QUEA_CAUSK      VRP-G-------EGLEDRIVRDLPDFLRPGDALVFNDTRVIPARLMGRRAGRETGGGDGS
QUEA_BRUC2      VRP-G-------EPFEDRHVYDLPDLLQPGDALVFNDTKVIPAQLEGMRERTGN------
QUEA_BRUSU      VRP-G-------EPFEDRHVYDLPDLLQPGDALVFNDTKVIPAQLEGMRERTGN------
QUEA_BRUA2      VRP-G-------EPFEDRHVYDLPDLLQPGDALVFNDTKVIPAQLEGMRERTGN------
QUEA_BRUME      VRP-G-------EPFEDRHVYDLPDLLQPGDALVFNDTKVIPAQLEGMRERTGN------
QUEA_BRUO2      VRP-G-------EPFEDRHVYDLPDLLQPGDALVFNDTKVIPAQLEGMRERTGN------
QUEA_BRUSI      VRP-G-------EPFEDRHVYDLPDLLQPGDALVFNDTKVIPAQLEGMRERTGN------
QUEA_BRUAB      VRP-G-------EPFEDRHVYDLPDLLQPGDALVFNDTKVIPAQLEGMRERTGN------
QUEA_OCHA4      VRP-G-------QPFEDRQVFELPDLLQPGDALVFNDTKVIPAQLEGMRERDGN------
QUEA_RHILO      VKS-G-------EALDDRKVGDLPSLLRAGDVLVFNDTKVIPAQLKGIRRRGEA------
QUEA_CHESB      VRP-G-------KPLEDCIVRDLPQFLRPGDALVFNDTKVIPARLSGIRRRGET------
QUEA_RHIEC      VDP-DAE-----SALSDHHVCDLPSFLRAGDALVFNDTKVIPAQLEGIRHRDGAG-----
QUEA_RHIL3      IDP-NAE-----NSLSDHRVGDLTSFLRAGDALVFNDTKVIPAQLEGIRHRDGAG-----
QUEA_AGRFC      VDP-N-E-----NRMEDHRVFDLPSFLRPGDALVFNDTRVIPAQLEGVRLREGAP-----
QUEA_RHIME      VRP-DGA-----PVLEDRGVLDLPSFLRPGDALVFNDTKVIPAQLEGVRYRGEDI-----
QUEA_SINMW      VRP-GGE-----PVLEDRGVLDLPSFLRQGDALVFNDTKVIPAQLEGVRYRGEHI-----
QUEA_RHOPS      VRP-G-------ATLEDRAVRDLPALLQPGDQLVVNDTRVIAAQLTGRRIGRAT------
QUEA_RHOPA      VRP-G-------APLEDRIVRDLPALLAPGDQLVVNDTRVIAAQLTGRRIGRGL------
QUEA_RHOP5      VEA-S-------GALHDRVVSELPEWLRPGDALVVNDTKVIAAQLTGRRIGRDT------
QUEA_NITWN      VQP-G-------SGVRDQQVSDLPEWLRPGDQLVVNDTRVIAAQLHGRRIGREA------
QUEA_BRASO      VQG-D-------GVLRDRTIGDLPDWLEPGDQLVVNDTKVIAAQLSGRRISRET------
QUEA_BRASB      VQG-D-------GVLRDRIVADLPDWLEPGDQLVVNDTKVIAAQLSGRRVSRET------
QUEA_BRADU      VEG---------GALRDRTISELPQWLKRGDQLVVNDTKVIAAQLKGRRIGRET------
QUEA_AZOC5      VRP-GAA-----PELEDRTIADLPDLLQPGDALVVNDTKVIPARLDGTRTRAGGS-----
QUEA_PARL1      IGP-A-E-----NALADKSVSDLPSHLREGDILVFNDTKVIPARLFGTRRRGEA------
QUEA_MARMM      VAS-N-------GVFADRGVRDLPDLLQPGDLMVFNDTRVIPAALKGIRPARAV--GGGG
QUEA_HYPNA      VHG-D-------GRLIDATVRDLPKYLNTGDVLVFNDTRVLPAALKGVRPARD---GASR
QUEA_RHORT      VEG-E--------SRRDLGVGDLPGLLDPGDILVFNDTRVIPARLKGRIGDGG-------
QUEA_SPHWW      VEG-SE------GALADRHVSDLPGLLRVGDCLVFNDTRVIPAQLEGRR----------G
QUEA_NOVAD      V-G-RD------GPFRDLIVRDLPDLLNPGDVLVFNDTRVIPAQLEGQR----------G
QUEA_SPHAL      V---DA------GNIVDAGVRDLPQWLRPGDCLVFNDTRVIPAQLEGLR----------G
QUEA_ERYLH      A-A-GA------GAIDDRIVRDLPQLLMPGDVLVFNDTRVIPAQLTGKR----------G
QUEA_ZYMMO      V---TS------QEMDDYHVADLPNLLQEGDLLIFNDTRVIPAYLEGKK----------N
QUEA_GLUDA      IPA-A-------GPFHDRIVRDLPSLLRPGDLLVANDTAVIPAQLDARRG----------
QUEA_GLUOX      VRP-G-------LPPDPHVIRDLPDFLREGDLLIANNTAVIRAQLAATRG----------
QUEA_ACICJ      VRG-D-------G-LDDRTILDLPALLAPGDLLVVNDTRVIPAQLTGRRG----------
QUEA_RUEST      AEQ-D--------RISDGRVTDLLDWLAPGDRLVLNDTRVIPARLSGQRHRNSAQ--GPV
QUEA_RUEPO      ARG-D--------AISDAVVRDLPDWLRPGDRLVLNDTRVIPARLSGTRQRQSAQ--GPV
QUEA_ROSDO      AKG-R--------QISDSIVSDLPNWLSPGDRLVLNDTRVIPARLTGARHRDTAQ--GPM
QUEA_JANSC      ADG-P--------ETHDLTVADLPSMLRRGDRLVLNDTRVIPARLTGTRTRMSAQ--GEV
QUEA_RHOS4      AEG-D--------RIEDRHVRDLVGIFRPGDRLVLNNTRVIPARLTGTRTR------GEA
QUEA_RHOS1      AEG-D--------RIEDRHVRDLVGIFRPGDRLVLNNTRVIPARLTGTRTR------GEA
QUEA_RHOS5      AEG-D--------RIEDRHVRDLVGIFHPGDRLVLNNTRVIPARLVGTRTR------GEA
QUEA_DINSH      AEA-RG-------PFRDRRVTDLVDELQPGDRLVLNNTKVIPARLFGTRHRDSAQ--GPV
QUEA_THET2      VYR-EGP-----FRVAHKRVRDLPEFLRPGDVLVFNESKVIPARLLARKPT---------
QUEA_THET8      VYR-EGP-----FRVAHKRVRDLPEFLRPGDVLVFNESKVIPARLLARKPT---------
QUEA_DEIRA      VGE-Q---------IKHRMFRDLPDLLRPSDLLVFNESRVIPARVLARKPVVNGF----G
QUEA_RUBXD      VDV-PSR------GISHHVFRELPRFLGPGDVLVLNETKVIPARLFASRPG---------
QUEA_ANADF      LP---RE-----GAAEHRAFTDLPDLLAPGDLLVFNDTKVIPARLVGTK-PT--------
QUEA_ANADE      LAP--GE-----GAPAHRGFADLPELLAPGDLLVFNDTRVIPARLLGHK-AS--------
QUEA_SORC5      VDRGRRA-----GEVEHAAIRDLDRYIERGALVIVNDTKVVPARLFGRKRGT--------
QUEA_SYNAS      LDR--RI-----GSLEHRHFYDFPDFVRKGDVLVINDSKVIPARLSGRKETGSRIELLLL
QUEA_SOLUE      VHR--EQ-----GRWEDRCFRDLPEFLRPGDCLVLNDSRVFPARLFGHR---SGVHSLAV
QUEA_DESVV      LDR--TT-----GERIHARFADLAEHLPEGALLVANNSKVLPARLLGHRPT---------
QUEA_DESVH      LDR--TT-----GERIHARFADLAEHLPEGALLVANNSKVLPARLLGHRPT---------
QUEA_DESAG      MDR--KS-----GVNTQASFKDIGSFLPEGALLVANNSRVLPARMLGRRPT---------
QUEA_SYNWW      LDR--KS-----GDLNDRAFKDISLYLKKGDALVLNETRVIPARFFAYKES---------
QUEA_NOSS1      VNSQTTGKE---TPPLHQIFRDLPDILRPGDLLIMNNTKVIPARLYGRK-----------
QUEA_TRIV2      VNSQTTGKE---TPPLHQIFRDLPDILRPGDLLIMNNTKVIPARLYGRK-----------
QUEA_THEEB      VTRDTAA---------DHYFYELPQLLAPGDLLVLNDTRVIPARLIGQKVG---------
QUEA_SYNE7      FPDREQL--------WHRHFYDLPQLLRPGDLLIVNDTRVIPARLYGQKI----------
QUEA_SYNP6      FPDREQL--------WHRHFYDLPQLLRPGDLLIVNDTRVIPARLYGQKI----------
QUEA_ACAM1      VQQQAHQ---------HKIFQDLVALLQPGDLLVFNDTRVIPARLLGRKLNS--------
QUEA_SYNY3      VKDPFTVD--------HQHFYDLGNYLKPGDLLVLNDTKVMPARLHGQK-----------
QUEA_GLOVI      VDGEAHT---------HRYFYDLPGLLRPGDLLVLNDTRVIPARLFGSK-----------
QUEA_SYNSC      VPPQGEPST---D-AAHGQVWDLLEQLQPGDLLVVNDTRVLKARLAVRR-----------
QUEA_SYNPX      VPPATQALE---A-ARHGVVWDLLEELQPGDLLVVNNTRVLKARLKVRR-----------
QUEA_SYNS9      APGQTDGVQ---A-ARHQKVWDLLEELRSGDLLVVNDTRVLKARIKVRR-----------
QUEA_SYNS3      VPPAERSLS---E-LRHQRVWDWQQELQPGDLLVVNDTRVLKARLRVRR-----------
QUEA_SYNPW      VPPLEASSL---Q-GRHGTVWDWQNELRSGDLLVVNDTRVLQARLRVRR-----------
QUEA_PROMM      VQPLGMKPP---I-ARHAEVWDWQEELRAGDLLVINDTRVLKARLRVRR-----------
QUEA_PROM3      VQPLGMKPP---I-ARHAEVWDWQEELRAGDLLVINDTRVLKARLRVRR-----------
QUEA_SYNR3      VEPEAG--------CRDRQVWDLLEELEPGDLLVVNDTRVLRARLQVRR-----------
QUEA_PROMA      VSKRSGEGL---K-AFHLKVWDLLAELRAGDLLVMNDTRVLKARLKVRL-----------
QUEA_PROMT      VKDGLDDSL---N-LVHAKVWDIKDILKPADLLVVNNTRVVKARLKIRL-----------
QUEA_PROM1      IKDGLDDSL---N-LVHAKVWDIKDILKPADLLVVNNTRVVKARLKIRL-----------
QUEA_PROMP      VRDSSLEED---F-TTNKYTKNLLDELRKGDLVVVNDTKVMKARLKVEL-----------
QUEA_DESPS      LNTSTGK-------VEHKIFNNVLEYINPGDMLIVNNTKVFPARLTGHK-----------
QUEA_AQUAE      LNRKDQS-------IKHDTFINLPDYLEEGDLLVFNNTKVIPARLYGRK-----------
QUEA_NITSB      YDRKTDT-------ITHTIFKNLPQFLPQKTHIVFNDTKVIKARIFGHKSSG--------
QUEA_ARCB4      FNRSTNT-------IIHSTFKDILEFLPNDLSIFLNDTKVIKARIFGVKDSG--------
QUEA_CAMJE      FDRKNKE-------IFHTTFKNLQDFLPN-CAIFFNDTKVIKARIYGNKASG--------
QUEA_SULDN      YDRASDE-------ISHVHFYDFEKFIPKNCALIFNDTKVIKARLFGQKESG--------
QUEA_HELPJ      YERRSQT-------ITHTTFEHVLDFFPKNALVVLNDTKVIKARLFGSKHAF--------
QUEA_HELPH      YERRSQK-------ITHTTFEHVLDFFPKNALVVLNDTKVMKARLFGSKHAL--------
QUEA_HELPY      YERRSQK-------ITHTTFEHVLDFFPKNALIVLNDTKVIKARLFGSKHAF--------
QUEA_HELAH      YERHSQK-------ITHTTFEHVLDFFPKNTLVVLNDTKVIKARLFGSKYAF--------
QUEA_HELHP      YQRDSGR-------IIHSDFYHFCDFVPKDTLLVFNDTRVIKARIYAHKLDCNTQ-----
QUEA_RICBR      ASTQQY---------VKTKFYNIIDYLKEGDLLVFNNSKVIKAKLSLDKN----------
QUEA_RICB8      ASTQQY---------VKTKFYNIIDYLKEGDLLVFNNSKVIKAKLSLDKN----------
QUEA_RICRS      AVTPP----------IKTKFYNIIDYLKEGDLLVFNNSKVIKAQLNLGKN----------
QUEA_RICRO      AVTPP----------IKTKFYNIIDYLKEGDLLVFNNSKVIKAQLNLGKN----------
QUEA_RICAH      AAMPP----------IKTKFYNIIDYLKEGDLLVLNNSKVIKAKLHLWKN----------
QUEA_RICFE      ATTPP----------IKTKFYNIIDYLKEGDLLVFNNSKVIKAKLNLERN----------
QUEA_RICTY      AGTKH----------IKTKFYNIIDYLKEGDLLVFNNSKVIKAKLHLGKN----------
QUEA_RICCK      AATPP----------IKTKFYNIIDYLKEGDLLVFNNSKVIKAKLNLEKNRPLSKLAYRD
QUEA_BORBP      LDP------KLQKIYHENSVNNILKYINSDTFIIFNNSKVRKSRMYAESE----------
QUEA_BORAP      LDP------KLQKIYHENSVNNILKYINSDTFIVFNNSKVRKSRMYAESE----------
QUEA_BORBU      LDP------QLQKIYHKNSVNNILKYINSN---IFNNSKARKSRIYAESE----------
QUEA_TREDE      LDK------QSGK-LEDRLFTELPEILPKNALMVFNNSKVRHARIYAKSK----------
                                                 . * : .  : .               

QUEA_SHISS      -----------------------------------SGGKIEVLVERMLD-----------
QUEA_ECOHS      -----------------------------------SGGKIEVLVERMLD-----------
QUEA_SHIFL      -----------------------------------SGGKIEVLVERMLD-----------
QUEA_SHIDS      -----------------------------------SGGKIEVLVERMLD-----------
QUEA_ECO57      -----------------------------------SGGKIEVLVERMLD-----------
QUEA_ECO24      -----------------------------------SGGKIEVLVERMLD-----------
QUEA_SHIF8      -----------------------------------SGGKIEVLVERMLD-----------
QUEA_ECOLI      -----------------------------------SGGKIEVLVERMLD-----------
QUEA_ECOLC      -----------------------------------SGGKIEVLVERMLD-----------
QUEA_ECOL5      -----------------------------------SGGKIEVLVERMLD-----------
QUEA_ECOL6      -----------------------------------SGGKIEVLVERMLD-----------
QUEA_SHIBS      -----------------------------------SGGKIEVLVERMLD-----------
QUEA_ECOK1      -----------------------------------SGGKIEVLVERMLD-----------
QUEA_ECOUT      -----------------------------------SGGKIEVLVERMLD-----------
QUEA_SALPB      -----------------------------------SGGKIEVLVERMLD-----------
QUEA_SALTY      -----------------------------------SGGKIEVLVERMLD-----------
QUEA_SALCH      -----------------------------------SGGKIEVLVERMLD-----------
QUEA_SALPA      -----------------------------------SGGKIEVLVERMLD-----------
QUEA_SALTI      -----------------------------------SGGKIEVLVERMLD-----------
QUEA_SALAR      -----------------------------------SGGKIEVLVERMLD-----------
QUEA_CITK8      -----------------------------------SGGKIEVLVERMLD-----------
QUEA_ENT38      -----------------------------------SGGKIEVLVERMLD-----------
QUEA_KLEP7      -----------------------------------SGGKIEVLVERMLD-----------
QUEA_CROS8      -----------------------------------SGGKIEVLVERMLD-----------
QUEA_YERPE      -----------------------------------SGGKLEVLVERVLD-----------
QUEA_YERPS      -----------------------------------SGGKLEVLVERVLD-----------
QUEA_YERP3      -----------------------------------SGGKLEVLVERVLD-----------
QUEA_YERE8      -----------------------------------SGGKLEVLVERVLD-----------
QUEA_SERP5      -----------------------------------SGGKIEVLVERVLD-----------
QUEA_PECAS      -----------------------------------SGGKLEVLVERVLD-----------
QUEA_PHOLL      -----------------------------------TGGKLEVLVERVLD-----------
QUEA_SODGM      -----------------------------------SGGKIEVLVERVLD-----------
QUEA_BAUCH      -----------------------------------SGGKVEVLVERVLD-----------
QUEA_VIBCH      -----------------------------------SGGKLEVLVERMLD-----------
QUEA_VIBC3      -----------------------------------SGGKLEVLVERMLD-----------
QUEA_VIBPA      -----------------------------------SGGKLEVLVERMLD-----------
QUEA_VIBCB      -----------------------------------SGGKLEVLVERMLN-----------
QUEA_VIBVU      -----------------------------------SGGKLEVLVERMLD-----------
QUEA_VIBVY      -----------------------------------SGGKLEVLVERMLD-----------
QUEA_ALIF1      -----------------------------------SGGKLEVLVERVLD-----------
QUEA_PHOPR      -----------------------------------SGGKIEVLVERILD-----------
QUEA_AERHH      -----------------------------------SGGKLEVLVERMLD-----------
QUEA_AERS4      -----------------------------------SGGKLEVLVERILD-----------
QUEA_COLP3      -----------------------------------SGGKIEVLVERVID-----------
QUEA_PSEA6      -----------------------------------SGGKVEVLIERIID-----------
QUEA_SHEPA      -----------------------------------SGGKLEILVERMLD-----------
QUEA_SHEHH      -----------------------------------SGGKLEILVERMLD-----------
QUEA_SHELP      -----------------------------------TGGKLEILVERMLD-----------
QUEA_SHESM      -----------------------------------SGGKLEILVERMLD-----------
QUEA_SHESA      -----------------------------------SGGKLEILVERMLD-----------
QUEA_SHESR      -----------------------------------SGGKLEILVERMLD-----------
QUEA_SHEON      -----------------------------------SGGKLEILVERMLD-----------
QUEA_SHESW      -----------------------------------SGGKLEILVERMLD-----------
QUEA_SHEPC      -----------------------------------SGGKLEILVERMLD-----------
QUEA_SHEB8      -----------------------------------SGGKLEILVERMLD-----------
QUEA_SHEB9      -----------------------------------SGGKLEILVERMLD-----------
QUEA_SHEB5      -----------------------------------SGGKLEILVERMLD-----------
QUEA_SHEFN      -----------------------------------TGGKLEILVERMLD-----------
QUEA_SHEDO      -----------------------------------TGGKLEILVERMLD-----------
QUEA_SHEAM      -----------------------------------SGGKLEILVERMLD-----------
QUEA_PSEHT      -----------------------------------SGGKVEVLVERVLD-----------
QUEA_HAEIG      -----------------------------------SGGKIEVLVERMLD-----------
QUEA_HAEIE      -----------------------------------SGGKIEVLVERMLD-----------
QUEA_HAEI8      -----------------------------------SGGKIEVLVERMLD-----------
QUEA_HAEIN      -----------------------------------SGGKIEVLVERMLD-----------
QUEA_HAES1      -----------------------------------SGGKIEVLVERVLN-----------
QUEA_HISS2      -----------------------------------SGGKIEVLVERVLN-----------
QUEA_PASMU      -----------------------------------SGGKVEVLVERILS-----------
QUEA_MANSM      -----------------------------------SGGKIEVLIERVLT-----------
QUEA_HAEDU      -----------------------------------SGGKLEVLIERVLD-----------
QUEA_ACTP2      -----------------------------------SGGKLEILVERVLD-----------
QUEA_MARMS      -----------------------------------SGGKVEILVERVIN-----------
QUEA_PSEAB      -----------------------------------SGGKLEVLVERVLD-----------
QUEA_PSEAE      -----------------------------------SGGKLEVLVERVLD-----------
QUEA_PSEA7      -----------------------------------SGGKLEVLVERVLD-----------
QUEA_PSEMY      -----------------------------------SGGRLEVLVERVLD-----------
QUEA_PSEP1      -----------------------------------SGGKLEVLVERVLD-----------
QUEA_PSEPK      -----------------------------------SGGKLEVLVERVLD-----------
QUEA_PSEPG      -----------------------------------SGGKLEVLVERVLD-----------
QUEA_PSEE4      -----------------------------------SGGKLEVLVERVLD-----------
QUEA_PSEU2      -----------------------------------SGGKLEILVERVLD-----------
QUEA_PSE14      -----------------------------------SGGKLEILVERVLD-----------
QUEA_PSESM      -----------------------------------SGGKLEILVERVLD-----------
QUEA_PSEF5      -----------------------------------SGGKLEILVERVLD-----------
QUEA_PSEPF      -----------------------------------SGGKLEILVERVLD-----------
QUEA_SACD2      -----------------------------------SGGKLEILAERILD-----------
QUEA_MARHV      -----------------------------------TGGKVEILVERLLG-----------
QUEA_IDILO      -----------------------------------SGGKVEVLVERLLD-----------
QUEA_CHRSD      -----------------------------------SGGRVEMLLERPLD-----------
QUEA_ALKEH      -----------------------------------TGGRVEVLVERPLD-----------
QUEA_HAHCH      -----------------------------------SGGKVEVMVERVVS-----------
QUEA_ALCBS      -----------------------------------SGGKVEVLIERVVD-----------
QUEA_HYDCU      -----------------------------------TGGKVELLIERVLD-----------
QUEA_XYLFT      -----------------------------------SGGRVELLIERFLG-----------
QUEA_XYLFA      -----------------------------------SGGRVEILIERFLG-----------
QUEA_XANAC      -----------------------------------SGGRVEILIERLLG-----------
QUEA_XANC5      -----------------------------------SGGRVEILIERLLG-----------
QUEA_XANOR      -----------------------------------SGGRVEILIERLLG-----------
QUEA_XANCP      -----------------------------------SGGRVEILIERLLG-----------
QUEA_XANC8      -----------------------------------SGGRVEILIERLLG-----------
QUEA_METCA      -----------------------------------TGGAVEILLERLLG-----------
QUEA_NITOC      -----------------------------------SGGKIEILIERFLD-----------
QUEA_CUPMC      -----------------------------------SGGRIEVLVERVVD-----------
QUEA_CUPPJ      -----------------------------------SGGKVEVLVERVLD-----------
QUEA_CUPNH      -----------------------------------SGGKIEVLVERVVD-----------
QUEA_RALSO      -----------------------------------SGGKIEVLVERLLD-----------
QUEA_BURCA      -----------------------------------SGGKIEVLIERVTG-----------
QUEA_BURCH      -----------------------------------SGGKIEVLIERVTG-----------
QUEA_BURL3      -----------------------------------SGGKIEVLIERVTG-----------
QUEA_BURVG      -----------------------------------SGGKIEVLVERVTG-----------
QUEA_BURCM      -----------------------------------SGGKIEVLIERVTG-----------
QUEA_BURP0      -----------------------------------SGGKIEVLIERVTG-----------
QUEA_BURP1      -----------------------------------SGGKIEVLIERVTG-----------
QUEA_BURP6      -----------------------------------SGGKIEVLIERVTG-----------
QUEA_BURPS      -----------------------------------SGGKIEVLIERVTG-----------
QUEA_BURMS      -----------------------------------SGGKIEVLIERVTG-----------
QUEA_BURM9      -----------------------------------SGGKIEVLIERVTG-----------
QUEA_BURM7      -----------------------------------SGGKIEVLIERVTG-----------
QUEA_BURMA      -----------------------------------SGGKIEVLIERVTG-----------
QUEA_PARXL      -----------------------------------SGGKIEVLVERLTG-----------
QUEA_JANMA      -----------------------------------TGGKVEVLVERVID-----------
QUEA_HERAR      -----------------------------------TGGKVEVLVERVID-----------
QUEA_AZOSB      -----------------------------------TGGQVEVLVERPIG-----------
QUEA_AROAE      -----------------------------------TGGHIEVLIERAIG-----------
QUEA_DECAR      -----------------------------------TGGQVEIMLERIVD-----------
QUEA_BORPA      -----------------------------------TGGKVEVLVERITA-----------
QUEA_BORBR      -----------------------------------TGGKVEVLVERITA-----------
QUEA_BORPE      -----------------------------------TGGKVEVLVERITA-----------
QUEA_THIDA      -----------------------------------SGGRVELLVERVTG-----------
QUEA_NEIM0      -----------------------------------SGGRIEALIERVLD-----------
QUEA_NEIMA      -----------------------------------SGGRIEALIERVLD-----------
QUEA_NEIMB      -----------------------------------SGGRIEALIERVLD-----------
QUEA_NEIG1      -----------------------------------SGGRIEALIERVLD-----------
QUEA_CHRVO      -----------------------------------SGGKVEALIERVLD-----------
QUEA_NITEU      -----------------------------------TGGKVEVMVERILD-----------
QUEA_NITEC      -----------------------------------TGGKVEVMIERILG-----------
QUEA_NITMU      -----------------------------------TGGRVEVLVERVLD-----------
QUEA_POLAQ      -----------------------------------TGGNVELLIERISG-----------
QUEA_DICNV      -----------------------------------SGGKVEVFIERLLS-----------
QUEA_PSYWF      -----------------------------------TGGKVEVLVERLTDDTEF-------
QUEA_PSYA2      -----------------------------------TGGKIEVLIERLVSLSDVNSAYLDE
QUEA_ACIAD      -----------------------------------SGGAIEILVERMLD-----------
QUEA_LEGPL      -----------------------------------TGGKVELLVERITG-----------
QUEA_LEGPH      -----------------------------------TGGKVELLVERITG-----------
QUEA_LEGPA      -----------------------------------TGGKVELLVERITG-----------
QUEA_LEGPC      -----------------------------------TGGKVELLVERITG-----------
QUEA_COXBU      -----------------------------------TGGKVECLVERILS-----------
QUEA_COXBN      -----------------------------------TGGKVECLVERILS-----------
QUEA_COXBR      -----------------------------------TGGKVECLVERILS-----------
QUEA_BUCAI      -----------------------------------SGGKVEVLVEKILG-----------
QUEA_BUCAP      -----------------------------------SGGRVEVLLERILN-----------
QUEA_BLOFL      -----------------------------------TGKKVEILIERILN-----------
QUEA_VESOH      -----------------------------------TGGKVEIMIERILD-----------
QUEA_FRATH      -----------------------------------TGAKLEYLIERIKN-----------
QUEA_FRATO      -----------------------------------TGAKLEYLIERIKN-----------
QUEA_FRATF      -----------------------------------TGAKLEYLIERIKN-----------
QUEA_FRATW      -----------------------------------TGAKLEYLIERIKN-----------
QUEA_FRATT      -----------------------------------TGAKLEYLIERIKT-----------
QUEA_FRAT1      -----------------------------------TGAKLEYLIERIKT-----------
QUEA_FRATN      -----------------------------------TGAKLEYLIERIKN-----------
QUEA_FRAP2      -----------------------------------TGAKLEYLIERVKT-----------
QUEA_GEOKA      ----------------------------------ETGGTVEVLLLKQL----------DG
QUEA_GEOTN      ----------------------------------ETGGMVEVLLLKQL----------DG
QUEA_BACSU      ----------------------------------DTGAKVELLLLKQE----------TG
QUEA_BACVZ      ----------------------------------DTGAKVELLLLKQE----------EN
QUEA_BACP2      ----------------------------------DTGAKVELLLLKQE----------EG
QUEA_BACLD      ----------------------------------ETGAKVEVLLLKQE----------EG
QUEA_BACHD      ----------------------------------ETGAQVEVLLLKQM----------EG
QUEA_BACHK      ----------------------------------DTGAHIEVLLLKQE----------EG
QUEA_BACC1      ----------------------------------DTGAHIEVLLLKQE----------EG
QUEA_BACAN      ----------------------------------DTGAHIEVLLLKQE----------EG
QUEA_BACCZ      ----------------------------------DTGAHIEVLLLKQE----------EG
QUEA_BACCR      ----------------------------------DTGAHIEVLLLKQE----------EG
QUEA_BACCN      ----------------------------------DTGAHIEVLLLKQE----------EG
QUEA_OCEIH      ----------------------------------DTGAKIEVLLLHQQ----------EE
QUEA_LISMO      ----------------------------------ETGAHIEVLLLKQK----------EG
QUEA_LISMF      ----------------------------------ETGAHIEVLLLKQK----------EG
QUEA_LISIN      ----------------------------------ETGAHIEVLLLKQK----------EG
QUEA_LISW6      ----------------------------------ETGAHIEVLLLKQK----------EG
QUEA_BACSK      ----------------------------------ETKAVIELLLLKQL----------EG
QUEA_STRT2      ----------------------------------DTHGHVEFLLLKNT----------QG
QUEA_STRTD      ----------------------------------DTHGHVEFLLLKNT----------QG
QUEA_STRT1      ----------------------------------DTHGHVEFLLLKNT----------QG
QUEA_STRA1      ----------------------------------DTHGHVELLLLKNT----------EG
QUEA_STRA5      ----------------------------------DTHGHVELLLLKNT----------EG
QUEA_STRA3      ----------------------------------DTHGHIELLLLKNT----------EG
QUEA_STRP8      ----------------------------------DTHGHVELLLLKNT----------QG
QUEA_STRPF      ----------------------------------DTHGHVELLLLKNT----------QG
QUEA_STRP6      ----------------------------------DTHGHVELLLLKNT----------QG
QUEA_STRPB      ----------------------------------DTHGHVELLLLKNT----------QG
QUEA_STRPM      ----------------------------------DTHGHVELLLLKNT----------QG
QUEA_STRPC      ----------------------------------DTHGHVELLLLKNT----------QG
QUEA_STRPG      ----------------------------------DTHGHVELLLLKNT----------QG
QUEA_STRP1      ----------------------------------DTHGHVELLLLKNT----------QG
QUEA_STRP3      ----------------------------------DTHGHVELLLLKNT----------QG
QUEA_STRPD      ----------------------------------DTHGHVELLLLKNT----------QG
QUEA_STRMU      ----------------------------------VTHGHVELLLLKNI----------QG
QUEA_STRP2      ----------------------------------ETGSHVELLLLKNT----------SG
QUEA_STRR6      ----------------------------------ETGSHVELLLLKNT----------SG
QUEA_STRPN      ----------------------------------ETGGHVELLLLKNT----------SG
QUEA_STRSV      ----------------------------------ETGGHVELLLLKNT----------QG
QUEA_LACLM      ----------------------------------ETGGHIELLLLKDM----------GE
QUEA_LACLA      ----------------------------------ETGGHIELLLLKDM----------GQ
QUEA_LACPL      ----------------------------------ETGGHAEVLLLHNT----------EG
QUEA_LACBA      ----------------------------------ETGGHVEVLLLHNV----------EG
QUEA_PEDPA      ----------------------------------KTGGHFEVLLLHNI----------EG
QUEA_LACSS      ----------------------------------DTGGHEEVLLLNNT----------HD
QUEA_ENTFA      ----------------------------------ETGGHLEVLLLTNT----------EG
QUEA_STAAM      ----------------------------------ETGAKVEMLMLTQI----------EG
QUEA_STAA9      ----------------------------------ETGAKVEMLMLTQI----------EG
QUEA_STAA2      ----------------------------------ETGAKVEMLMLTQI----------EG
QUEA_STAA1      ----------------------------------ETGAKVEMLMLTQI----------EG
QUEA_STAAB      ----------------------------------ETGAKVEMLMLTQI----------EG
QUEA_STAAW      ----------------------------------ETGAKVEMLMLTQI----------EG
QUEA_STAAN      ----------------------------------ETGAKVEMLMLTQI----------EG
QUEA_STAAR      ----------------------------------ETGAKVEMLMLTQI----------EG
QUEA_STAAS      ----------------------------------ETGAKVEMLMLTQI----------EG
QUEA_STAAE      ----------------------------------ETGAKVEMLMLTQI----------EG
QUEA_STAAC      ----------------------------------ETGAKVEMLMLTQI----------EG
QUEA_STAA8      ----------------------------------ETGAKVEMLMLTQI----------EG
QUEA_STAAT      ----------------------------------ETGAKVEMLMLTQI----------EG
QUEA_STAA3      ----------------------------------ETGAKVEMLMLTQI----------EG
QUEA_STAHJ      ----------------------------------ETGAKVEMLMLTRI----------EN
QUEA_STAES      ----------------------------------ETGAKVEMLMLTQI----------EG
QUEA_STAEQ      ----------------------------------ETGAKVEMLMLTQI----------EG
QUEA_STAS1      ----------------------------------ETGAKVEMLMLTQI----------EG
QUEA_CLOBH      ----------------------------------ETGGKMEFLLLKRK----------EK
QUEA_CLOB1      ----------------------------------ETGGKMEFLLLKRK----------EK
QUEA_CLOBL      ----------------------------------ETGGKMEFLLLKRK----------EK
QUEA_CLOTE      ----------------------------------ETKGKMEFLLLKRT----------DK
QUEA_CLOAB      ----------------------------------GTGGKMEFLLLKRI----------DK
QUEA_CLOK5      ----------------------------------DTMGKIEFLLLKRR----------DN
QUEA_CLOPE      ----------------------------------ETGGKIEFLLLKRI----------EG
QUEA_CLOP1      ----------------------------------ETGGKIEFLLLKRI----------EG
QUEA_CLOPS      ----------------------------------ETGGKIEFLLLKRI----------EG
QUEA_CLOB8      ----------------------------------GTGGKIEFLLLKRI----------EK
QUEA_HUNT2      ----------------------------------GTGGKIEFVLLKRI----------NG
QUEA_CLOD6      ----------------------------------ETGGKIEFLLLKRT----------EE
QUEA_LACP7      SYG-------------------------------KEGTPIELLLLKRK----------PD
QUEA_ALKMQ      ----------------------------------NTGGKMEFLLLKRI----------DL
QUEA_CALS4      ----------------------------------DSGGKVELLLLRRT----------SM
QUEA_SYMTH      ----------------------------------QTGGAMEVLLLKRL----------DR
QUEA_MOOTA      ----------------------------------GTGAKIEVLLLTRQ----------EG
QUEA_DESHY      ----------------------------------GTQAKIECLLLTRR----------DK
QUEA_DESRM      ----------------------------------STGAKIEVLLLRQI----------SA
QUEA_PELTS      ----------------------------------GTGARIELLLLRRL----------DS
QUEA_CARHZ      -----------------------------------QGGEVEILLVKRM----------NF
QUEA_FUSNN      -----------------------------------TGGVLEILLIKRI----------TL
QUEA_THEMA      -----------------------------------TGASIEILLIERL----------EE
QUEA_THEP1      -----------------------------------TGASIEILLIERL----------EE
QUEA_THEM4      -----------------------------------TGAKIEVLLLEKI----------SE
QUEA_DEHMC      ----------------------------------DTSAKIEILLLKRD----------GE
QUEA_DEHMB      ----------------------------------DTSAKIEILLLKRD----------GE
QUEA_DEHM1      ----------------------------------DTSAKIEILLLKSD----------GN
QUEA_FLAJ1      ----------------------------------KTGARIEVFLLREL----------NS
QUEA_FLAPJ      ----------------------------------KTGARIEVFLLREL----------NA
QUEA_BACFN      ----------------------------------KTGARIEVFLLREL----------NE
QUEA_BACFR      ----------------------------------KTGARIEVFLLREL----------NE
QUEA_BACV8      ----------------------------------KTGARIEVFLLREL----------NE
QUEA_PARD8      ----------------------------------KTGARIEVFLLREL----------NE
QUEA_CYTH3      ----------------------------------KTGAKIEVFLLREL----------NA
QUEA_GEOMG      ------------------------------------GGRVEVFL--------------ER
QUEA_GEOSL      ------------------------------------GGKTEIFL--------------VR
QUEA_GEOUR      ------------------------------------GGRVEVFL--------------VR
QUEA_PELCD      ------------------------------------GGRIEVFL--------------VR
QUEA_PELPD      ------------------------------------GGRVEIFL--------------VR
QUEA_PELLD      ------------------------------------GAAIELML--------------LE
QUEA_CHLPM      ------------------------------------GAAIELML--------------LE
QUEA_CHLPD      ------------------------------------GGKIELVL--------------LE
QUEA_CHLTE      ------------------------------------GARIELML--------------LE
QUEA_CHLCH      ------------------------------------GATIELML--------------LE
QUEA_CAUVC      ------------------------------------PVAVEATL--------------HR
QUEA_CAUSK      ------------------------------------PVAVEATL--------------HR
QUEA_BRUC2      ------------------------------------ISQVSATL--------------HM
QUEA_BRUSU      ------------------------------------ISQVSATL--------------HM
QUEA_BRUA2      ------------------------------------ISQVSATL--------------HM
QUEA_BRUME      ------------------------------------ISQVSATL--------------HM
QUEA_BRUO2      ------------------------------------ISQVSATL--------------HM
QUEA_BRUSI      ------------------------------------ISQVSATL--------------HM
QUEA_BRUAB      ------------------------------------ISQVSATL--------------HM
QUEA_OCHA4      ------------------------------------ISQVSATL--------------HM
QUEA_RHILO      ------------------------------------QAQVEATL--------------HM
QUEA_CHESB      ------------------------------------VAQIEATL--------------HM
QUEA_RHIEC      ------------------------------------GQQVSATL--------------HM
QUEA_RHIL3      ------------------------------------GQQVSATL--------------HM
QUEA_AGRFC      ------------------------------------ETAVSATL--------------HM
QUEA_RHIME      ------------------------------------STPVSLTL--------------HM
QUEA_SINMW      ------------------------------------STPVSLTL--------------HM
QUEA_RHOPS      ------------------------------------EPRIEATL--------------IK
QUEA_RHOPA      ------------------------------------EPKIEATL--------------IK
QUEA_RHOP5      ------------------------------------EPKIDATL--------------IK
QUEA_NITWN      ------------------------------------EPRIDATL--------------IK
QUEA_BRASO      ------------------------------------EAKIEATL--------------IK
QUEA_BRASB      ------------------------------------EAKIEATL--------------IK
QUEA_BRADU      ------------------------------------EPKIEATL--------------IK
QUEA_AZOC5      ------------------------------------TVAIEATL--------------IR
QUEA_PARL1      ------------------------------------SARIEVML--------------HK
QUEA_MARMM      ------------------------------------PVEVEVNL--------------HK
QUEA_HYPNA      ------------------------------------DVEVDVNL--------------VE
QUEA_RHORT      ---------------------------------------VEVTL--------------HK
QUEA_SPHWW      ------------------------------------EARIGATL--------------HK
QUEA_NOVAD      ------------------------------------EARVGATL--------------HK
QUEA_SPHAL      ------------------------------------EAKIGATL--------------HK
QUEA_ERYLH      ------------------------------------EATVGVTL--------------HK
QUEA_ZYMMO      ------------------------------------QARISANM--------------IK
QUEA_GLUDA      ------------------------------------EARIGITL--------------DR
QUEA_GLUOX      ------------------------------------EAKIGLTL--------------DR
QUEA_ACICJ      ------------------------------------DARIGITL--------------DR
QUEA_RUEST      ------------------------------------SARIEVTL--------------LE
QUEA_RUEPO      ------------------------------------TARIEITL--------------LE
QUEA_ROSDO      ------------------------------------QARIEVTL--------------LE
QUEA_JANSC      ------------------------------------TARIEVTL--------------ME
QUEA_RHOS4      ------------------------------------EARVEVTL--------------ME
QUEA_RHOS1      ------------------------------------EARVEVTL--------------ME
QUEA_RHOS5      ------------------------------------CAKIEITL--------------ME
QUEA_DINSH      ------------------------------------SAKVEITL--------------LE
QUEA_THET2      ------------------------------------GGKVEILL-------------VRE
QUEA_THET8      ------------------------------------GGKVEILL-------------VRE
QUEA_DEIRA      ------------------------------------GGQVEVLL-------------LRE
QUEA_RUBXD      ------------------------------------GGEVELLF-------------LGE
QUEA_ANADF      ------------------------------------GGKVELLL----------CEPLGG
QUEA_ANADE      ------------------------------------GGKVELLL----------CEPLEG
QUEA_SORC5      ------------------------------------GGQVELFLLHRLDGAPAGAEDLGG
QUEA_SYNAS      SRYSDSPA-------------------------VPETDSTEWPF--------------FR
QUEA_SOLUE      GKNNPKRH-------------------------EFLSGAVEVFL--------------LR
QUEA_DESVV      ------------------------------------GGKVEFLLLTPLPLVTPLAAGPAS
QUEA_DESVH      ------------------------------------GGKVEFLLLTPLPLVTPLAAGPAS
QUEA_DESAG      ------------------------------------GGKVEFLLLTPLPLVQPQTGTD--
QUEA_SYNWW      ------------------------------------GARVEILLLKKLG-----------
QUEA_NOSS1      ----------------------------------SSGAEVEILLLE----------ERKF
QUEA_TRIV2      ----------------------------------SSGAEVEILLLE----------ERKF
QUEA_THEEB      ----------------------------------AAGRTVEVFLLE----------ELSD
QUEA_SYNE7      ----------------------------------ETGVPVEVLLVE----------EHGP
QUEA_SYNP6      ----------------------------------ETGVPVEVLLVE----------EHGP
QUEA_ACAM1      ----------------------------------ELAQPVEVFLLE----------PRQP
QUEA_SYNY3      ----------------------------------ENGVAVEILLLT----------ECTE
QUEA_GLOVI      ----------------------------------ASGGRVEVLLLE----------PRAP
QUEA_SYNSC      ----------------------------------SGGGLSELLVLE----------PRGE
QUEA_SYNPX      ----------------------------------SGGGLSELLVLE----------PRGE
QUEA_SYNS9      ----------------------------------SGGGVSELLVLE----------PRGD
QUEA_SYNS3      ----------------------------------SGGGLGELLVLE----------PRGE
QUEA_SYNPW      ----------------------------------SGGGLGELLVLE----------PRGE
QUEA_PROMM      ----------------------------------SGGGLAELLVLE----------PRGE
QUEA_PROM3      ----------------------------------SGGGLAELLVLE----------PRGE
QUEA_SYNR3      ----------------------------------AGGGLGELLVLQ----------PQGQ
QUEA_PROMA      ----------------------------------RNGTFVELFLLE----------PKGQ
QUEA_PROMT      ----------------------------------SGGGAGELLLME----------PRGD
QUEA_PROM1      ----------------------------------SGGGAGELLIME----------PRGD
QUEA_PROMP      ----------------------------------ENGKLVELLVLE----------KADQ
QUEA_DESPS      ----------------------------------ESGGKVEVFLLELPTY-----IRPGV
QUEA_AQUAE      ----------------------------------PTGGRVEVVLTD----------FIKP
QUEA_NITSB      -------------------------------------GKIELLINRPLE---------NE
QUEA_ARCB4      -------------------------------------GQIELLLNKPLF---------MD
QUEA_CAMJE      -------------------------------------GKIELFLHQPFL---------NS
QUEA_SULDN      -------------------------------------GKIELLINRALD---------AH
QUEA_HELPJ      ----------------------------------LPSKTTEVFFHRFFK---------GN
QUEA_HELPH      ----------------------------------LPSKTTEVFFHRFFK---------DN
QUEA_HELPY      ----------------------------------LPSKTTEVFFHRFFK---------NN
QUEA_HELAH      ----------------------------------LPSKTTEVFFHRFLK---------NN
QUEA_HELHP      ---------------------------------KLSDKTFEIFYHKPLQ---------ST
QUEA_RICBR      ---------------------------------------ITINLNQRLKDNRRATNDDAG
QUEA_RICB8      ---------------------------------------ITINLNQRLKDNRRATNDDAG
QUEA_RICRS      ---------------------------------------ITINLNQKLSD----------
QUEA_RICRO      ---------------------------------------ITINLNQKLSD----------
QUEA_RICAH      ---------------------------------------VTINLNQKLSD----------
QUEA_RICFE      ---------------------------------------ITINLNQKLSD----------
QUEA_RICTY      ---------------------------------------ITINLNKKLSD----------
QUEA_RICCK      KFEGDMECRTAVYTNVREDSSTGSTYKLPLEVELEKRSNITINLNQRLSN----------
QUEA_BORBP      -----------------------------------LGNNIEFLILDRI------------
QUEA_BORAP      -----------------------------------MGSNVEFLILDRI------------
QUEA_BORBU      -----------------------------------MSSNVEFLILDRI------------
QUEA_TREDE      -----------------------------------TNAVCEFLMINPMRD----------
                                                                            

QUEA_SHISS      ---------------DKRILAHIRASKAPKPGAELLLG----------------------
QUEA_ECOHS      ---------------DKRILAHIRASKAPKPGAELLLG----------------------
QUEA_SHIFL      ---------------DKRILAHIRASKAPKPGAELLLG----------------------
QUEA_SHIDS      ---------------DKRILAHIRASKAPKPGAELLLG----------------------
QUEA_ECO57      ---------------DKRILAHIRASKAPKPGAELLLG----------------------
QUEA_ECO24      ---------------DKRILAHIRASKAPKPGAELLLG----------------------
QUEA_SHIF8      ---------------DKRILAHIRASKAPKPGAELLLG----------------------
QUEA_ECOLI      ---------------DKRILAHIRASKAPKPGAELLLG----------------------
QUEA_ECOLC      ---------------DKRILAHIRASKAPKPGAELLLG----------------------
QUEA_ECOL5      ---------------DKRILAHIRASKAPKPGAELLLG----------------------
QUEA_ECOL6      ---------------DKRILAHIRASKAPKPGAELLLG----------------------
QUEA_SHIBS      ---------------DKRILAHIRASKAPKPGAELLLG----------------------
QUEA_ECOK1      ---------------EKRILAHIRASKAPKPGAELLLG----------------------
QUEA_ECOUT      ---------------EKRILAHIRASKAPKPGAELLLG----------------------
QUEA_SALPB      ---------------DKRILAHIRASKAPKPGTELLLG----------------------
QUEA_SALTY      ---------------DKRILAHIRASKAPKPGTELLLG----------------------
QUEA_SALCH      ---------------DKRILAHIRASKAPKPGTELLLG----------------------
QUEA_SALPA      ---------------DKRILAHIRASKAPKPGTELLLG----------------------
QUEA_SALTI      ---------------DKRILAHIRASKAPKPGTELLLG----------------------
QUEA_SALAR      ---------------DKRILAHIRASKAPKPGTELLLG----------------------
QUEA_CITK8      ---------------DKRILAHIRASKAPKPGAELLLG----------------------
QUEA_ENT38      ---------------DKRILAHIRASKAPKPGAELLLG----------------------
QUEA_KLEP7      ---------------DKRILAHIRASKAPKPGAELLLG----------------------
QUEA_CROS8      ---------------DHRVLAHIRASKAPKPGAELLLG----------------------
QUEA_YERPE      ---------------DHRVLAHVKASKAPKPGAELLLG----------------------
QUEA_YERPS      ---------------DHRVLAHVKASKAPKPGAELLLG----------------------
QUEA_YERP3      ---------------DHRVLAHVKASKAPKPGAELLLG----------------------
QUEA_YERE8      ---------------DHRVLAHVKASKAPKPGTELLLG----------------------
QUEA_SERP5      ---------------DHRVLAHVRASKAPKPGTDLLLG----------------------
QUEA_PECAS      ---------------DHRILAHVRASKAPKPGTELLLG----------------------
QUEA_PHOLL      ---------------DKRVLAHVRASKAPKEGTELLLG----------------------
QUEA_SODGM      ---------------DKRVLAHVRASKAPKPGSALLLG----------------------
QUEA_BAUCH      ---------------NQRVLAHIRASKTPKIDTLLLLG----------------------
QUEA_VIBCH      ---------------EHTILAHVRSSKPPKPGTELYLG----------------------
QUEA_VIBC3      ---------------EHTILAHVRSSKPPKPGTELYLG----------------------
QUEA_VIBPA      ---------------EKSILAHVRCSKSPKPGTTIIVG----------------------
QUEA_VIBCB      ---------------EKSILAHVRCSKSPKPGTTILVG----------------------
QUEA_VIBVU      ---------------EKRFLAHVRSSKSPKPGTLVFLG----------------------
QUEA_VIBVY      ---------------EKRFLAHVRSSKSPKPGTLVFLG----------------------
QUEA_ALIF1      ---------------EHSVLAHVRCSKSPKPGTMLLLG----------------------
QUEA_PHOPR      ---------------DKSILAHVRASKSPKPGNELLLG----------------------
QUEA_AERHH      ---------------EHSVLAHVRSSKSPKPGTRLILDGG--A-----------------
QUEA_AERS4      ---------------EHSVLAHVRASKAPKPGTRLILDGG--P-----------------
QUEA_COLP3      ---------------QNTALAHIRASKSPKVGNELFLGNE--D-----------------
QUEA_PSEA6      ---------------EHHVLAHVRASKSPKEGTQLLLE----------------------
QUEA_SHEPA      ---------------DKRVLAHVRCSKSPKVDSIVCLD----------------------
QUEA_SHEHH      ---------------DKRVLAHVRCSKSPKVDSIICLD----------------------
QUEA_SHELP      ---------------DKRILAHVRSSKSPKPGTIICLD----------------------
QUEA_SHESM      ---------------DKRILAHVRSSKSPKVDSIIHLD----------------------
QUEA_SHESA      ---------------DKRILAHVRSSKSPKVDSIIHLD----------------------
QUEA_SHESR      ---------------DKRILAHVRSSKSPKVDSIIHLD----------------------
QUEA_SHEON      ---------------DKRILAHVRSSKSPKVDSIIHLD----------------------
QUEA_SHESW      ---------------DKRILAHVRSSKSPKVDSLIHLD----------------------
QUEA_SHEPC      ---------------DKRILAHVRSSKSPKVDSLIHLD----------------------
QUEA_SHEB8      ---------------DKRILAHVRSSKSPKVDSLILLD----------------------
QUEA_SHEB9      ---------------DKRILAHVRSSKSPKVDSLILLD----------------------
QUEA_SHEB5      ---------------DKRILAHVRSSKSPKVDSFILLD----------------------
QUEA_SHEFN      ---------------DKRILAHVRSSKSPKVDTLIDLD----------------------
QUEA_SHEDO      ---------------DKRILAHVRSSKSPKVDTLINLD----------------------
QUEA_SHEAM      ---------------DKRILAHVRSSKSPKPGAEIILD----------------------
QUEA_PSEHT      ---------------EHRVLAHVRASKSLKPGNEVILE----------------------
QUEA_HAEIG      ---------------EHRFLAHIRSSKSPKEGAELFLGEDKLG-----------------
QUEA_HAEIE      ---------------EHRFLAHIRSSKSPKEGAELFLGEDKLG-----------------
QUEA_HAEI8      ---------------EHRFLAHIRSSKSPKEGAELFLGEDKLG-----------------
QUEA_HAEIN      ---------------EHRFLAHIRSSKSPKEGAELFLGEDKLG-----------------
QUEA_HAES1      ---------------EHHFLAHIRSSKSPKENTVLFLGEDKLG-----------------
QUEA_HISS2      ---------------EHHFLAHIRSSKSPKENTVLFLGEDKLG-----------------
QUEA_PASMU      ---------------DTRFLAHVRSSKAPKEGAELWLGEDKLG-----------------
QUEA_MANSM      ---------------ESRFLAHVRSSKAPKAGTELILGEDKLG-----------------
QUEA_HAEDU      ---------------EHHCLAHIRCSKAPKAGTKLILGEDKLG-----------------
QUEA_ACTP2      ---------------EHRCLAHVRASKAPKEGAELVLGEDKLG-----------------
QUEA_MARMS      ---------------VNEALAHVRASKSPKESSKLILGQD--------------------
QUEA_PSEAB      ---------------QHRVLAHIRASKAPKPGTRILVE----------------------
QUEA_PSEAE      ---------------QHRVLAHIRASKAPKPGTRILVE----------------------
QUEA_PSEA7      ---------------QHRVLAHVRASKAPKPGTRILVE----------------------
QUEA_PSEMY      ---------------QHRVLAHVRSSKSPKPGSQILIE----------------------
QUEA_PSEP1      ---------------SHRVLAHVRASKAPKVGAVILID----------------------
QUEA_PSEPK      ---------------SHRVLAHVRASKAPKVGAVILID----------------------
QUEA_PSEPG      ---------------SHRVLAHVRASKAPKVGAVILID----------------------
QUEA_PSEE4      ---------------SHRVLAHVRASKAPKEGAQILID----------------------
QUEA_PSEU2      ---------------SHRVLAHVRSSKSPKPGSSILID----------------------
QUEA_PSE14      ---------------SHRVLAHVRSSKSPKPGSSILID----------------------
QUEA_PSESM      ---------------SHRVLAHVRASKSPKPGSSILID----------------------
QUEA_PSEF5      ---------------SHRVLAHVRSSKSPKPGSKILID----------------------
QUEA_PSEPF      ---------------THRVLAHVRSSKSPKPGSKILID----------------------
QUEA_SACD2      ---------------AHSILAHVRSSKAPKPGSIIILQ----------------------
QUEA_MARHV      ---------------EKELLAHTRSSKSPKEGQRLLLE----------------------
QUEA_IDILO      ---------------DHRVLAHVRANRAPKAGAELLLE----------------------
QUEA_CHRSD      ---------------AHRGLAHLRASKAPRPGTELIFE----------------------
QUEA_ALKEH      ---------------RHRVLARLRASKVPAPGTVLTLE----------------------
QUEA_HAHCH      ---------------MTEMLAHVRASKAPKPGVEILIE----------------------
QUEA_ALCBS      ---------------DHEALAHVRASKSPKPGSWLEFA----------------------
QUEA_HYDCU      ---------------ERRVLTHIRSSNAPKSGAKLRIE----------------------
QUEA_XYLFT      ---------------THQAVVQLRTSRSLKVGNRILLD----------------------
QUEA_XYLFA      ---------------THQAVVQLRTSRSLKVGNRILLD----------------------
QUEA_XANAC      ---------------ERQARVQIGASKSPKAGSLIALD----------------------
QUEA_XANC5      ---------------EREARVQIGASKSPKAGSVIALD----------------------
QUEA_XANOR      ---------------ERQARVQIGASKSPKAGSLIALD----------------------
QUEA_XANCP      ---------------GQQARAQIGASKSPKAGSVIALD----------------------
QUEA_XANC8      ---------------GQQARAQIGASKSPKAGSVIALD----------------------
QUEA_METCA      ---------------ERLMLAHVRASKAPRPGTWLALE----------------------
QUEA_NITOC      ---------------QHRALAHIRANNPPRAGRRLVME----------------------
QUEA_CUPMC      ---------------THTVLAQVRASKTPVEGSLLHLADD--------------------
QUEA_CUPPJ      ---------------THTVLAQVRASKTPAEGSLLHLAED--------------------
QUEA_CUPNH      ---------------SHTVLAQVRASKTPTEGSILHLADG--------------------
QUEA_RALSO      ---------------EHTVLAQIRSSKSPVAGSTLRLAD---------------------
QUEA_BURCA      ---------------THTALAQIRASKSPGAGTTLRLAD---------------------
QUEA_BURCH      ---------------THTALAQIRASKSPGAGTTLRLAD---------------------
QUEA_BURL3      ---------------THTALAQIRASKSPGAGTTLRLAD---------------------
QUEA_BURVG      ---------------THTALAQIRASKSPGAGTTLRLAD---------------------
QUEA_BURCM      ---------------THTALAQIRASKSPGTGTTLRLAD---------------------
QUEA_BURP0      ---------------ERTALAQIRASKSPPPGTTLTLAD---------------------
QUEA_BURP1      ---------------ERTALAQIRASKSPPPGTTLTLAD---------------------
QUEA_BURP6      ---------------ERTALAQIRASKSPPPGTTLTLAD---------------------
QUEA_BURPS      ---------------ERTALAQIRASKSPPPGTTLTLAD---------------------
QUEA_BURMS      ---------------ERTALAQIRASKSPPPGTTLTLAD---------------------
QUEA_BURM9      ---------------ERTALAQIRASKSPPPGTTLTLAD---------------------
QUEA_BURM7      ---------------ERTALAQIRASKSPPPGTTLTLAD---------------------
QUEA_BURMA      ---------------ERIALAQIRASKSPPPGTTLTLAD---------------------
QUEA_PARXL      ---------------ERTALAQIRASKSPQPGTTIRLAD---------------------
QUEA_JANMA      ---------------QRNVHAQIRASKSPAVGMRIRLAD---------------------
QUEA_HERAR      ---------------SAHVHAQIRASKSPVPGMKIRLAD---------------------
QUEA_AZOSB      ---------------AHEALAQIRASKSPKPGSTLRLAD---------------------
QUEA_AROAE      ---------------PHEALAQVRASKSPRAGSRLRLAD---------------------
QUEA_DECAR      ---------------ATHAICQVRASKAPKAGSTMRLAD---------------------
QUEA_BORPA      ---------------PDRALAHVRASKSPGPGMRLRLAE---------------------
QUEA_BORBR      ---------------PDRALVHVRASKSPGPGMRLRLAE---------------------
QUEA_BORPE      ---------------PDRALAHVRASKSPGPGMRLRLAE---------------------
QUEA_THIDA      ---------------EFEALAFIRASHAPKPGARIRLAD---------------------
QUEA_NEIM0      ---------------SHTALAHIRSSKSPKPGMGLVFEG---------------------
QUEA_NEIMA      ---------------SHTALAHIRSSKSPKPGMGLVFEG---------------------
QUEA_NEIMB      ---------------NHTALAHIRSSKSPKPGMGLVFEG---------------------
QUEA_NEIG1      ---------------NHTALAHIRSSKSPKPGMGLVFEG---------------------
QUEA_CHRVO      ---------------DHTALAHVRASKSPKPGSRLIFAG---------------------
QUEA_NITEU      ---------------THRARVLIRASHALVIGSTLLLEN---------------------
QUEA_NITEC      ---------------THQARALIRASHAPAIGSTLLLEN---------------------
QUEA_NITMU      ---------------SHCALAAIRASHSPKPGSKLFLAG---------------------
QUEA_POLAQ      ---------------EKQAWVQIRASKVPKTGSTVHIYNQSG------------------
QUEA_DICNV      ---------------EQRVKAHIRASKAPLLGSQIVIGAQK-------------------
QUEA_PSYWF      ------TTDESGQSFDNVALCHVRASKAPKLGQRLVLGDGN-------------------
QUEA_PSYA2      IIANSKTIDTTIIAEKHIALCHIKASKALKLGQGLVLADGH-------------------
QUEA_ACIAD      ---------------NQIAHCHIKASNTPKAGAELFVGENG-------------------
QUEA_LEGPL      ---------------DFTFLAHIKASKSLKSNDLIYLDA---------------------
QUEA_LEGPH      ---------------DFTFLAHIKASKSLKSNDLIYLDA---------------------
QUEA_LEGPA      ---------------DFTFLAHIKASKSLKSNDLIYLDA---------------------
QUEA_LEGPC      ---------------DFTFLAHIKASKSLKSNDFIYLDA---------------------
QUEA_COXBU      ---------------KDRFLAHIRASKAPKLGSQIIIAD---------------------
QUEA_COXBN      ---------------KDRFLAHIRASKAPKLGSQIIIAD---------------------
QUEA_COXBR      ---------------KDRFLAHIRASKAPKLGSQIIIAD---------------------
QUEA_BUCAI      ---------------INNILASIKNSKNINIGSKIFFGYK--------------------
QUEA_BUCAP      ---------------KNSILASIKSSNEIKMNSYLFFGKK--------------------
QUEA_BLOFL      ---------------DYQAVAHIYSSELVQLGEKFILGSN--------------------
QUEA_VESOH      ---------------ENQVLAMIKASRAPKIGSCIFLEND--------------------
QUEA_FRATH      ---------------PKLFETHIKANRSPAIGSEIYVE----------------------
QUEA_FRATO      ---------------PKLFETHIKANRSPAIGSEIYVE----------------------
QUEA_FRATF      ---------------PKLFETHIKANRSPAIGSEIYVE----------------------
QUEA_FRATW      ---------------PKLFETHIKANRSPAIGSEIYVE----------------------
QUEA_FRATT      ---------------PKLFETHIKANRSPAIGSEIYVE----------------------
QUEA_FRAT1      ---------------PKLFETHIKANRSPAIGSEIYVE----------------------
QUEA_FRATN      ---------------PKLFETHIKANRSPAIGSEIYVE----------------------
QUEA_FRAP2      ---------------PKIFETHIKANRSPAIGSEIYVQ----------------------
QUEA_GEOKA      DR----------------WETLVKPGKRVKPGTKLTFGEGK-------------------
QUEA_GEOTN      DR----------------WETLVKPGKRVRPGTKLVFGGGK-------------------
QUEA_BACSU      DK----------------WETLAKPAKRVKKGTVVTFGDGR-------------------
QUEA_BACVZ      DT----------------WETLVKPAKRVKKGTVLTFGDGR-------------------
QUEA_BACP2      DK----------------WETLVKPAKRVKKGTVITFGDGR-------------------
QUEA_BACLD      DV----------------WETLVKPAKRVKRGTVLSFGDGR-------------------
QUEA_BACHD      DR----------------WETLVKPAKRLKVGTIIRFGNGE-------------------
QUEA_BACHK      DK----------------WETLVKPAKRVKEGTVISFGEGK-------------------
QUEA_BACC1      DK----------------WETLVKPAKRVKEGTVISFGEGK-------------------
QUEA_BACAN      DK----------------WETLVKPAKRVKEGTVISFGEGK-------------------
QUEA_BACCZ      DK----------------WETLVKPAKRVKEGTVISFGEGK-------------------
QUEA_BACCR      DK----------------WETLVKPAKRVKEGTVISFGEGK-------------------
QUEA_BACCN      DT----------------WETLVKPAKRVKEGTVISFGEGK-------------------
QUEA_OCEIH      DT----------------WEVLVKPAKKVKVGTEIIFGNGK-------------------
QUEA_LISMO      NA----------------WETLVKPAKRIRKGATITFGDGA-------------------
QUEA_LISMF      NA----------------WETLVKPAKRIRKGATITFGDGA-------------------
QUEA_LISIN      NA----------------WETLVKPAKRIRKGATITFGDGA-------------------
QUEA_LISW6      NA----------------WETLVKPAKRIRKGGTITFGNGA-------------------
QUEA_BACSK      DC----------------WETLVKPAKRVKIGTEVSFGDGK-------------------
QUEA_STRT2      DQ----------------WEVLAKPAKRLKVGAKVSFGDGR-------------------
QUEA_STRTD      DQ----------------WEVLAKPAKRLKVGAKVSFGDGR-------------------
QUEA_STRT1      DQ----------------WEVLAKPAKRLKVGAKVSFGYGR-------------------
QUEA_STRA1      DQ----------------WEVLAKPAKRLRVGTKVSFGDGR-------------------
QUEA_STRA5      DQ----------------WEVLAKPAKRLRVGTKVSFGDGR-------------------
QUEA_STRA3      DQ----------------WEVLAKPAKRLRVGTKVSFGDGR-------------------
QUEA_STRP8      DQ----------------WEVLAKPAKRLKVGSQVNFGDGR-------------------
QUEA_STRPF      DQ----------------WEVLAKPAKRLKVGSQVNFGDGR-------------------
QUEA_STRP6      DQ----------------WEVLAKPAKRLKVGSQVNFGDGR-------------------
QUEA_STRPB      DQ----------------WEVLAKPAKRLKVGSQVNFGDGR-------------------
QUEA_STRPM      DQ----------------WEVLAKPAKRLKVGSQVNFGDGR-------------------
QUEA_STRPC      DQ----------------WEVLAKPAKRLKVGSQVNFGDGR-------------------
QUEA_STRPG      DQ----------------WEVLAKPAKRLKVGSQVNFGDGR-------------------
QUEA_STRP1      DQ----------------WEVLAKPAKRLKVGSQVNFGDGR-------------------
QUEA_STRP3      DQ----------------WEVLAKPAKRLKVGSQVNFGDGH-------------------
QUEA_STRPD      DQ----------------WEVLAKPAKRLKVGSQVNFGNGH-------------------
QUEA_STRMU      DQ----------------WEVLAKPAKRLKVGSHISFGDGR-------------------
QUEA_STRP2      DE----------------WEVLAKPAKRLKVGTRISFGDGR-------------------
QUEA_STRR6      DE----------------WEVLAKPAKRLKVGTRISFGDGR-------------------
QUEA_STRPN      DE----------------WEVLAKPAKRLKVGTRISFGDGR-------------------
QUEA_STRSV      DD----------------WEVLAKPAKRLRVGAQISFGDGR-------------------
QUEA_LACLM      NR----------------WETLAKPARKMKVGEEVVFGDGR-------------------
QUEA_LACLA      NR----------------WETLAKPARKMKVGEEVVFGDGR-------------------
QUEA_LACPL      DE----------------WETLMKPAKRAKVGTVISFGDGK-------------------
QUEA_LACBA      DV----------------WETLMKPAKRLRVGTTVTFGDGQ-------------------
QUEA_PEDPA      DR----------------WETLVKPAKRAKTGTKIIFGDGA-------------------
QUEA_LACSS      DE----------------WEVLMKPAKRAKVGTEVVFGDGQ-------------------
QUEA_ENTFA      DT----------------WETLIKPAKRAKVGTEIQFGDGR-------------------
QUEA_STAAM      ND----------------WEVLLKPAKRIKVGNKLNFGNGK-------------------
QUEA_STAA9      ND----------------WEVLLKPAKRIKVGNKLNFGNGK-------------------
QUEA_STAA2      ND----------------WEVLLKPAKRIKVGNKLNFGNGK-------------------
QUEA_STAA1      ND----------------WEVLLKPAKRIKVGNKLNFGNGK-------------------
QUEA_STAAB      ND----------------WEVLLKPAKRIKVGNKLNFGNGK-------------------
QUEA_STAAW      ND----------------WEVLLKPAKRIKVGNKLNFGNGK-------------------
QUEA_STAAN      ND----------------WEVLLKPAKRIKVGNKLNFGNGK-------------------
QUEA_STAAR      ND----------------WEVLLKPAKRIKVGNKLNFGNGK-------------------
QUEA_STAAS      ND----------------WEVLLKPAKRIKVGNKLNFGNGK-------------------
QUEA_STAAE      ND----------------WEVLLKPAKRIKVGNKLNFGNGK-------------------
QUEA_STAAC      ND----------------WEVLLKPAKRIKVGNKLNFGNGK-------------------
QUEA_STAA8      ND----------------WEVLLKPAKRIKVGNKLNFGNGK-------------------
QUEA_STAAT      ND----------------WEVLLKPAKRIKVGNKLNFGNGK-------------------
QUEA_STAA3      ND----------------WEVLLKPAKRIKVGNKLNFGNGK-------------------
QUEA_STAHJ      ND----------------WEVLLKPAKRIKVGNKLSFGEGK-------------------
QUEA_STAES      ND----------------WEVLLKPAKRIKKGHRLNFGDGK-------------------
QUEA_STAEQ      ND----------------WEVLLKPAKRIKKGHRLNFGDGK-------------------
QUEA_STAS1      ND----------------WEVLLKPAKRIKVGNKLTFGEGK-------------------
QUEA_CLOBH      DV----------------WETLVKPGKRAQIGARFIFGNGE-------------------
QUEA_CLOB1      DV----------------WETLVKPGKRAQIGARFIFGNGE-------------------
QUEA_CLOBL      DV----------------WETLVKPGKRAQIGARFIFGNGE-------------------
QUEA_CLOTE      DT----------------WETLVKPGKRAKIGSRFIFGQGE-------------------
QUEA_CLOAB      DT----------------WETLVKPGKRAKVGAEFEFGGGV-------------------
QUEA_CLOK5      FT----------------WETLVKPGRRAKVGNRFNFGSGQ-------------------
QUEA_CLOPE      DK----------------WECLAKPGRKAKVGTVFTFGEGK-------------------
QUEA_CLOP1      DK----------------WECLAKPGRKAKVGTVFTFGEGK-------------------
QUEA_CLOPS      DK----------------WECLAKPGRKAKVGTVFTFGEGK-------------------
QUEA_CLOB8      DR----------------WECLAKPGKSAKVGRKFTFGEGK-------------------
QUEA_HUNT2      DV----------------WEVILKPGKKAKPGARFVFGNGE-------------------
QUEA_CLOD6      DT----------------WQALVKPGKRAKVGTKFSFGNGK-------------------
QUEA_LACP7      DV----------------WETLVRPGKKAKVGTKISFGDGK-------------------
QUEA_ALKMQ      NT----------------WEVLVKPGKKAKIGSRFEFGEGI-------------------
QUEA_CALS4      NE----------------WEVLVKPGKRAKVGKRVVFGNGE-------------------
QUEA_SYMTH      DR----------------WETLVKPGKKARPGERIVFGDGL-------------------
QUEA_MOOTA      DT----------------WETLVRPGRRVPVGAELIFGRGE-------------------
QUEA_DESHY      DV----------------WETLIKPGKRLKAGQTVVFGDGL-------------------
QUEA_DESRM      NQ----------------WETLVKPGKRAKIGEILDFGSGK-------------------
QUEA_PELTS      SR----------------WEALVRPGKKAPKGTAVVFGEGL-------------------
QUEA_CARHZ      RE----------------WEVLVKPGRRARVGTRLIFAPGV-------------------
QUEA_FUSNN      DT----------------WECLLKPAKKLKLGQKLYIGENKE------------------
QUEA_THEMA      GI----------------WKCLVRPGQKVKKGTELVIDEDL-------------------
QUEA_THEP1      GI----------------WKCLVRPGQKVKKGTELVIDEDL-------------------
QUEA_THEM4      NV----------------WEALVKPGSKVKKGTKIYFDDES-------------------
QUEA_DEHMC      GC----------------WEALLKPGKRTKPGTIIDIHQKGGVVS---------------
QUEA_DEHMB      GC----------------WEALLKPSKRTKPGTIIDIHQPNGGIS---------------
QUEA_DEHM1      GC----------------WEALLKPGKRTKPGTIIDIRKQDGQIH---------------
QUEA_FLAJ1      EQRL--------------WDVLVDPARKIRIGNKLYFGDDDS------------------
QUEA_FLAPJ      EQRL--------------WDVLVDPARKIRIGNKLYFGDDDS------------------
QUEA_BACFN      ELRL--------------WDVLVDPARKIRIGNKLYFGDDDS------------------
QUEA_BACFR      ELRL--------------WDVLVDPARKIRIGNKLYFGDDDS------------------
QUEA_BACV8      ELRL--------------WDVLVDPARKIRIGNKLYFGDDDS------------------
QUEA_PARD8      DLRL--------------WDVLVDPARKIRIGNKLYFGEDDS------------------
QUEA_CYTH3      ELHL--------------WDVLVDPARKIRVGNKLYFGESD-------------------
QUEA_GEOMG      RL----------AAVGERWQCLLRSSKPSRPGTRIVLAE---------------------
QUEA_GEOSL      RR----------PGDHETWHCLIRSSKPPRPGVTVLLPE---------------------
QUEA_GEOUR      RL----------LEPGEVWQCLIKASKSPKPGSLIILSE---------------------
QUEA_PELCD      RL----------PGVEEVWACLTKCSKSPRPGTRLILGE---------------------
QUEA_PELPD      RQ----------ETQAERWSCLMRSSKGMRPGQLITLAG---------------------
QUEA_PELLD      KH----------GQE----QSLVLFRGRVKQG-DRLRSH---------------------
QUEA_CHLPM      KH----------EGP----QNLALYRGRLKKG-DRLLAH---------------------
QUEA_CHLPD      KH----------GDE----QNLVLYRGSLKKG-DALLAY---------------------
QUEA_CHLTE      KH----------EEA----QNLALYRGRLRIG-DRLLAH---------------------
QUEA_CHLCH      RH----------HHR----EQLVLYRGQLKAG-EMLQSH---------------------
QUEA_CAUVC      RL------------APDRWSAFMRPGKRLKVGDRVAFGGHEGR-----------------
QUEA_CAUSK      RI------------APDRWVAFMRPGKRLKEGDRIAFGHDQDR-----------------
QUEA_BRUC2      RV------------GPDRWKAFLRPAKRVKEGDRIRFGHSGTS-----------------
QUEA_BRUSU      RV------------GPDRWKAFLRPAKRVKEGDRIRFGHSGTS-----------------
QUEA_BRUA2      RV------------GPDRWKAFLRPAKRVKEGDRIRFGHSGTS-----------------
QUEA_BRUME      RV------------GPDRWKAFLRPAKRVKEGDRIRFGHSGTS-----------------
QUEA_BRUO2      RV------------GPDRWKAFLRPAKRVKEGDRIRFGHSGTS-----------------
QUEA_BRUSI      RV------------GPDRWKAFLRPAKRVKEGDRIRFGHSGTS-----------------
QUEA_BRUAB      RV------------GPDRWKAFLRPAKRVKEGDRIRFGHSGTS-----------------
QUEA_OCHA4      RT------------GPDRWKAFLRPGKRVKEGDRIRFGHSGSS-----------------
QUEA_RHILO      RV------------APDRWLAFMRPGKRIAAGDRIHFGHDGNS-----------------
QUEA_CHESB      RA------------GPDRWKAFLKPAKRVAVGERIQFGHDGES-----------------
QUEA_RHIEC      RI------------GPSRWKAFAKPGKRIKEGDRIAFGHSGES-----------------
QUEA_RHIL3      RT------------SPSRWKAFAKPGKRIKQGDRISFGHSGES-----------------
QUEA_AGRFC      RA------------DQSRWKAFARPGKRIKEGDRIRFGYDRDTVNSSSG-----------
QUEA_RHIME      RV------------APSRWKAFARPARRLKPGDRISFGHGGSA-----------------
QUEA_SINMW      RV------------APDRWKAFARPARRLKPGDRVSFGHGGNA-----------------
QUEA_RHOPS      RL------------DGSRWQALVKPAKKLAEGDVVRFGHDGRV-----------------
QUEA_RHOPA      RL------------DGARWQALVKPAKKLLPGDVVRFGHDGRV-----------------
QUEA_RHOP5      RL------------DGSRWQALVKPAKKLLPGDIVRFGHDGRV-----------------
QUEA_NITWN      RL------------DGSRWSALVRPARKLMAGDIVRLGNEGRV-----------------
QUEA_BRASO      RL------------DGSRWQALVRPAKKLLAGDTIRFGNEGKV-----------------
QUEA_BRASB      RL------------DGSRWQALVRPAKKLAPGDTIRFGHEGKV-----------------
QUEA_BRADU      RL------------DGSRWQALVKPAKKLIAGDRIRFGNEGKV-----------------
QUEA_AZOC5      RL------------SGSAWAAFAKPAKRLAVGETVVFAGASGG-----------------
QUEA_PARL1      RE------------SADEWRAFLRPAKKLNLSETIDFP----------------------
QUEA_MARMM      RI------------DASAWRAFVRPAKRLRMGDEIAFGE---------------------
QUEA_HYPNA      RQ------------GDCLWLALARPGRRLKDGDEIFFAE---------------------
QUEA_RHORT      RV------------GPDAWDCFARPARKLKPGVVILFAE---------------------
QUEA_SPHWW      RE------------GLRQWRAFVRNAKRVRTGDRIDFGA---------------------
QUEA_NOVAD      RI------------DLRRWQAFVRNAKRLREGDVIQFGA---------------------
QUEA_SPHAL      RI------------DLRRWQAFVRNAKRLRVGETVDFGS---------------------
QUEA_ERYLH      RL------------DLRRWQAFVRNAKRLAPGDTVDFGN---------------------
QUEA_ZYMMO      RE------------GLRQWQAFVRNAKRLKSDDIVDFGQ---------------------
QUEA_GLUDA      IL------------PDGTWHALARNARRLRAGDVLTFPGTP-------------------
QUEA_GLUOX      IL------------ANGSWHALARNSRKLKPQDILHFGDDP-------------------
QUEA_ACICJ      PL------------ADGTWRVLLRNARRARPGETIAIDGAGG------------------
QUEA_RUEST      PQ------------ADGSWAGLLKPLKKIKIGETLRFSD---------------------
QUEA_RUEPO      PR------------ADGSWSALAKPLRKLREGETIIFSN---------------------
QUEA_ROSDO      PD------------AQGNWSALIKPLKKVKIAEEIIFSD---------------------
QUEA_JANSC      PQ------------ADGTWSALAKPMRKLKAGEKIIFSN---------------------
QUEA_RHOS4      PA------------AAGGWRAMAKPLRKLKPGETIRFSD---------------------
QUEA_RHOS1      PA------------AAGGWRAMAKPLRKLKPGETIRFSD---------------------
QUEA_RHOS5      PA------------AAGGWRALAKPLRKLKEGETIRFSD---------------------
QUEA_DINSH      PA------------SEG-WTALAKPLRKLAEGEEIVFSD---------------------
QUEA_THET2      R-------------SPGLWEALLGPARKAPPGTRLLLLSPKDL-----------------
QUEA_THET8      R-------------SPGLWEALLGPARKAPPGTRLLLLSPKDL-----------------
QUEA_DEIRA      EFDV----------GANVWSAYLKPAKRA--GHELWLGENE-------------------
QUEA_RUBXD      R--------------GGAWEALARPSRRLRPGMPLSAGEGE-------------------
QUEA_ANADF      GL-------------GSRWRAMGQASKPIREGTTLLFE----------------------
QUEA_ANADE      GL-------------GRRWRAMGQASKPIREGAVLAFD----------------------
QUEA_SORC5      GPQES-------APRSERWRAMGRASKPIRPGSVLDIERDG-------------------
QUEA_SYNAS      VG----------VEE--TWEALLKPGKRIRIGTSIFFDD---------------------
QUEA_SOLUE      AV----------SQDGRDWQALVRPGRKMRTGERIVFDE---------------------
QUEA_DESVV      GTVEP-------GWCVAEVEGLLRASKPLRPGDTLSFG----------------------
QUEA_DESVH      GTVEP-------GWCVAEVEGLLRASKPLRPGDTLSFG----------------------
QUEA_DESAG      ------------GRSCAEAEGLLRASKRVRPGDVMHF-----------------------
QUEA_SYNWW      ----------------DDWEALVKPARRLKAGSRVFLSPD--------------------
QUEA_NOSS1      NC----------------WLALVKPGKRFKKGTQIIFEGLGMRNLGIENSPQYSVA----
QUEA_TRIV2      NC----------------WLALVKPGKRFKKGTQIIFEGLGIRNLGIKNSPHYPLSPEGF
QUEA_THEEB      RQ----------------WLALVKPGRKLRPGAVIQIG----------------------
QUEA_SYNE7      GY----------------WLTLVKPGKRLKPGSAIAFGPNP-------------------
QUEA_SYNP6      GY----------------WLTLVKPGKRLKPGSAIAFGPNP-------------------
QUEA_ACAM1      NT----------------WLALVRPGRRLKPGAQIEFGPPE-------------------
QUEA_SYNY3      NQ----------------WIALVKPGKRLKLGAKVKFPARDG------------------
QUEA_GLOVI      RE----------------WLCLVKPARRLAVGARIDFDG---------------------
QUEA_SYNSC      GR----------------WLCLARPAKRMRPGDILTIDGS--------------------
QUEA_SYNPX      GR----------------WLCLARPAKRMRPGDVLTIDG---------------------
QUEA_SYNS9      GQ----------------WLCLARPAKRMRPGDLLTLDG---------------------
QUEA_SYNS3      GR----------------WLCLARPAKRMRPGDQLWLEALE-------------------
QUEA_SYNPW      GR----------------WLCLARPGKKLRPGDQVWLEALE-------------------
QUEA_PROMM      GC----------------WLCLGRPAKRLRPGDQLWLEALG-------------------
QUEA_PROM3      GR----------------WLCLGRPAKRLRPGDQLWLEALG-------------------
QUEA_SYNR3      GQ----------------WLCLARPAKRLRPGDSIALVADG-------------------
QUEA_PROMA      GR----------------WLCLAKPAKKLRAGDCIWMESSG-------------------
QUEA_PROMT      GR----------------WLCLGRPARRMRGGDQLWLDMSR-------------------
QUEA_PROM1      GR----------------WLCLGRPARRMRGGDQLWLDTSR-------------------
QUEA_PROMP      ST----------------WLCLARPAKKLKINSQLNLKSSL-------------------
QUEA_DESPS      SE----------------SIALIKSSRKPKVGSTLTINE---------------------
QUEA_AQUAE      DE----------------WKALIG-GKKIRPGLVIEVAP---------------------
QUEA_NITSB      R-------------------FNVFIRGKVKVGTTLHFSQGLQ------------------
QUEA_ARCB4      R-------------------YLVMIRGKVRVGTKLLFDENLS------------------
QUEA_CAMJE      HN----------------PLFLAQIKGRIKKDEILYFKEDLK------------------
QUEA_SULDN      N-------------------IHVFTRGKVKIGTKISFGLELF------------------
QUEA_HELPJ      TA-------------------LTQIKGKIKVGDKIFFDANYY------------------
QUEA_HELPH      TA-------------------LTQIKGKIKAGDKIFFDANYH------------------
QUEA_HELPY      TA-------------------LTQIKGKIKVGDKIFFDANYH------------------
QUEA_HELAH      TA-------------------LTQIKGKIKVGDKIFFDENHY------------------
QUEA_HELHP      SSAI--------------PLFLVQIKGRVKCGDKLLINTDSTN-----------------
QUEA_RICBR      RLKS-----------IDYWSAFAKPARKLKVGDEFYFDN---------------------
QUEA_RICB8      RLKS-----------IDYWSAFAKPARKLKVGDEFYFDN---------------------
QUEA_RICRS      ----------------DSWSAFAKPARKLHVNDEFYFDN---------------------
QUEA_RICRO      ----------------DSWSAFAKPARKLHVNDEFYFDN---------------------
QUEA_RICAH      ----------------DSWSAFAKPTRKLHVNDEFYFDN---------------------
QUEA_RICFE      ----------------DSWSAFAKPARKLNIGDEFYSDN---------------------
QUEA_RICTY      ----------------NCWGAFAKPARKLNIGDEFYFDT---------------------
QUEA_RICCK      ----------------NCWSAFAKPARRLNIGDEFHFDN---------------------
QUEA_BORBP      --------------GTDLFTALISKSKKQIVGNVYKFPEG--------------------
QUEA_BORAP      --------------GTDLFTALISKSKKQIVGNVYKFPEG--------------------
QUEA_BORBU      --------------DTNLFTALVSKSKKQIIGNFYKFPEG--------------------
QUEA_TREDE      -------------SDGSLWQVMAKKAKRQKPGKTFLFEDG--------------------
                                                                            

QUEA_SHISS      -------DDESINATMTARHG---ALFEVEFND-ER---SVLDILNSIGHMPLP-PYIDR
QUEA_ECOHS      -------DDESINATMTARHG---ALFEVEFND-ER---SVLDILNSIGHMPLP-PYIDR
QUEA_SHIFL      -------DDESINATMTARHG---ALFEVEFND-ER---SVLDILNSIGHMPLP-PYIDR
QUEA_SHIDS      -------DDESINATMTARHG---ALFEVEFND-ER---SVLDILNSIGHMPLP-PYIDR
QUEA_ECO57      -------DDESINATMTARHG---ALFEVEFND-ER---SVLDILNSIGHMPLP-PYIDR
QUEA_ECO24      -------DDESINATMTARHG---ALFEVEFND-ER---SVLDILNSIGHMPLP-PYIDR
QUEA_SHIF8      -------DDESINATMTARHG---ALFEVEFND-ER---SVLDILNSIGHMPLP-PYIDR
QUEA_ECOLI      -------DDESINATMTARHG---ALFEVEFND-ER---SVLDILNSIGHMPLP-PYIDR
QUEA_ECOLC      -------DDESINATMTARHG---ALFEVEFND-ER---SVLDILNSIGHMPLP-PYIDR
QUEA_ECOL5      -------DDESINATMTARHG---ALFEVEFND-QR---SVLDILNSIGHMPLP-PYIDR
QUEA_ECOL6      -------DDESINATMTARHG---ALFEVEFND-QR---SVLDILNSIGHMPLP-PYIDR
QUEA_SHIBS      -------DDESINATMTARHG---ALFEVEFND-DR---SVLDILNSIGHMPLP-PYIDR
QUEA_ECOK1      -------DDESINATMTARHG---ALFEVEFND-DR---SVLDILNSIGHIPLP-PYIDR
QUEA_ECOUT      -------DDESINATMTARHG---ALFEVEFND-DR---SVLDILNSIGHIPLP-PYIDR
QUEA_SALPB      -------DDESIHATMTARHG---ALFEVEFND-PR---PVLDILNAIGHMPLP-PYIDR
QUEA_SALTY      -------DDESIHATMTARHG---ALFEVEFND-PR---PVLDILNAIGHMPLP-PYIDR
QUEA_SALCH      -------DDESIHATMTARHG---ALFEVEFND-PR---PVLDILNAIGHMPLP-QYIDR
QUEA_SALPA      -------DDESIHATMTARHG---ALFEVEFND-PR---PVLDILNAIGHMPLP-PYIDR
QUEA_SALTI      -------DDESIHATMTARHG---ALFEVEFND-PR---PVLDILNAIGHMPLP-PYIDR
QUEA_SALAR      -------DDENIHATMTARHG---ALFEVEFND-ER---PVLDILNAIGHMPLP-PYIDR
QUEA_CITK8      -------DDESINATMTARHG---ALFEVEFND-AR---PVLEILNAIGHMPLP-PYIDR
QUEA_ENT38      -------DDESINATMVARHD---ALFEVEFND-AR---PVLDILNAIGHMPLP-PYIDR
QUEA_KLEP7      -------DDESIKATMLARHG---ALFEVEFND-ER---PVLEILNGIGHMPLP-PYIDR
QUEA_CROS8      -------DDESVNATMTARHD---ALFEVQFND-AR---PVLDILNSIGHMPLP-PYIER
QUEA_YERPE      -------DDESIRATMLARHD---TLFELRFDD-ER---DVFTILNAVGHMPLP-PYIDR
QUEA_YERPS      -------DDESIRATMLARHD---TLFELCFDD-ER---DVFTILNAVGHMPLP-PYIDR
QUEA_YERP3      -------DDENIRATMLARHD---TLFELRFDD-ER---DVFTILNAVGHMPLP-PYIDR
QUEA_YERE8      -------DDESIHATMLARHD---TLFELRFDD-ER---DVFTILDAVGHMPLP-PYIDR
QUEA_SERP5      -------DDESIAATMVARHD---TLFELRFND-ER---DVFTILNAVGHMPLP-PYIDR
QUEA_PECAS      -------DDESVKATMVARHD---ALFELHFDD-SR---DVLSILNDIGHMPLP-PYIDR
QUEA_PHOLL      -------DNESLKATMLARHD---TLFEIRFDD-ER---DVLSILDDIGHMPLP-PYINR
QUEA_SODGM      -------DDDSIAATMVARHD---ALFELRFDD-AR---DVLTLLNDAGHMPLP-PYIDR
QUEA_BAUCH      -------DNENIRAIIVARHQ---IWFELLFDD-QR---DILTILNDAGHIPLP-YYLDR
QUEA_VIBCH      -------ENDEFHAVMQARHD---ALFEIRFTA-ET---VVLDILNQIGHMPLP-PYIDR
QUEA_VIBC3      -------ENDEFHAVMQARHD---ALFEIRFTA-ET---VVLDILNQIGHMPLP-PYIDR
QUEA_VIBPA      -------ENDEYSAEMVARHD---ALFELKFNS-DK---TVLDILEEIGHMPLP-PYIDR
QUEA_VIBCB      -------ENDEYSAQMVARHD---ALFELKFNS-DK---TVLEILEEIGHMPLP-PYIDR
QUEA_VIBVU      -------EEDQYSAEMVARQD---ALFELHLKA-DK---TILEVLEEIGHMPLP-PYIDR
QUEA_VIBVY      -------EEDQYSAEMVARQD---ALFELHLKA-DK---TILEVLEEIGHMPLP-PYIDR
QUEA_ALIF1      -------ENQEHEAEMVARHD---TLFEIRFTS-DK---KVLDILDEIGHMPLP-PYIDR
QUEA_PHOPR      -------ENDDYQAEMIARHD---TLFEIRFNS-DK---TVLEILEEVGHMPLP-PYIDR
QUEA_AERHH      -------DGEKVEAEMRARHD---ALFEIHFLD-PR---PVLEILEAIGHMPLP-PYIDR
QUEA_AERS4      -------DGEKVDAEMRARHD---ALFEIHFLD-PR---PVLEILEAIGHMPLP-PYIDR
QUEA_COLP3      -------SDVKVKATMVARHG---ALFELKFNS-DE---SVLTILDKIGHMPLP-PYIDR
QUEA_PSEA6      ---------GKVEMEMVGRQD---ALFTLKLLN-PE---PILEILEQYGHMPLP-PYIDR
QUEA_SHEPA      ---------GGYEMVMLARHD---ALFELSLQS-DK---TILEVLEEVGHMPLP-PYIDR
QUEA_SHEHH      ---------GGYEMIMVARHD---ALFELELQS-DK---TILEVLEDVGHMPLP-PYIDR
QUEA_SHELP      ---------GGYEMTMLARHD---TLFELELNS-ES---TILEVLEEVGHMPLP-PYIDR
QUEA_SHESM      ---------GGYEMKMAARHD---ALFELELLS-DL---TILEVLEAVGHMPLP-PYIDR
QUEA_SHESA      ---------GGYEMKMAARYD---ALFELELLS-DL---TILEVLEAVGHMPLP-PYIDR
QUEA_SHESR      ---------GGYEMKMAARHD---ALFELELLS-DL---TILEVLEAVGHMPLP-PYIDR
QUEA_SHEON      ---------GGYEMKMMARHD---ALFELQLLS-EL---SILEVLEAVGHMPLP-PYIDR
QUEA_SHESW      ---------GGYQMKMVARHD---TLFELELLS-EL---TILEVLEAVGHMPLP-PYIDR
QUEA_SHEPC      ---------GGYQMKMVARHD---TLFELELLS-EL---TILEVLEAVGHMPLP-PYIDR
QUEA_SHEB8      ---------GGYQMKMVARHD---TLFELELLS-EL---TILEVLEAVGHMPLP-PYIDR
QUEA_SHEB9      ---------GGYQMKMVARHD---TLFELELLS-EL---TILEVLEAVGHMPLP-PYIDR
QUEA_SHEB5      ---------GGYQMKMVARHD---TLFELELLS-EL---TILEVLEAVGHMPLP-PYIDR
QUEA_SHEFN      ---------GGYQMKMLARHD---ALFELELQS-DK---TILEVLEDVGHMPLP-PYIDR
QUEA_SHEDO      ---------GEHQMKMIARHD---ALFELELLS-EL---TILEVLEQVGHMPLP-PYIDR
QUEA_SHEAM      ---------GGFKMTMDARHD---ALFELSLKD-DK---TILEVLEAVGHMPLP-PYIDR
QUEA_PSEHT      ---------GKAKATMVARHD---TLFELEFEH-SQ---NVLDILNDIGHMPLP-PYIDR
QUEA_HAEIG      -------ENNGIKAVMKARHS---SLFEVELSDKST---ALLDVLQTIGHMPLP-PYIDR
QUEA_HAEIE      -------ENNGIKAVMKARHS---SLFEVELSDKST---ALLDVLQTIGHMPLP-PYIDR
QUEA_HAEI8      -------ENNGIKAVMKARHS---SLFEVELSDKST---ALLDVLQTIGHMPLP-PYIDR
QUEA_HAEIN      -------ENNGIKAVMKARHG---ALFEVELSDKST---ALLDVLQTIGHMPLP-PYIDR
QUEA_HAES1      -------EGKGVEMLMKARHE---NLFELELSDKST---ALLDILQKIGHMPLP-PYIDR
QUEA_HISS2      -------EGKGVEMLMKARHE---NLFELELSDKST---ALLDILQKIGHMPLP-PYIDR
QUEA_PASMU      -------EHHGVKMIMVARHD---TLFELEIAQKQT---ALLDVLQQIGHMPLP-PYIDR
QUEA_MANSM      -------EGKGVKAVMIGRQD---ALFELEITEKST---ALLDILQKIGHMPLP-PYIDR
QUEA_HAEDU      -------IGNGLEATMISRHD---TLFELRFNA-TT---PLFTLLQQAGHIPLP-PYIDR
QUEA_ACTP2      -------EGNGFKAIMTARHD---ALFELHFNE-EQ---PLFDLLQQAGHMPLP-PYIDR
QUEA_MARMS      -------KGEHIEATMIGRSG---ALFHLVFDE------PVLDVLMRAGHMPLP-PYIER
QUEA_PSEAB      ---------GGGSAEMLQRHD---ALFELAFAEP------VLPLLERVGHMPLP-PYIDR
QUEA_PSEAE      ---------GGGSAEMLQRHD---ALFELAFAEP------VLPLLERVGHMPLP-PYIDR
QUEA_PSEA7      ---------GGGSAEMLQRHD---ALFELAFAEP------VLPLLERVGHMPLP-PYIDR
QUEA_PSEMY      ---------GGGEAEMVARHD---ALFELRFAEP------VLPLLERVGHMPLP-PYIDR
QUEA_PSEP1      ---------GGGEAEMVARHD---TLFELRFTEE------VLPLLDRVGHMPLP-PYIDR
QUEA_PSEPK      ---------GGGEAEMVARHD---TLFELRFTEE------VLPLLDRVGHMPLP-PYIDR
QUEA_PSEPG      ---------GGGEAEMVARHD---TLFELRFTEE------VLPLLDRVGHMPLP-PYIDR
QUEA_PSEE4      ---------GGGEAEMVARHD---TLFELRFSEE------VLPLLERVGHMPLP-PYIDR
QUEA_PSEU2      ---------GGGEAEMVARHD---ALFELRFAEE------VLPLLERVGRMPLP-PYIDR
QUEA_PSE14      ---------GGGEAEMVARHH---ALFELRFAEE------VLPLLERVGHMPLP-PYIDR
QUEA_PSESM      ---------GGGEAEMVARHD---ALFELRFAEE------VLPLLDRVGHMPLP-PYIDR
QUEA_PSEF5      ---------GGGEAEMLARHD---TLFELGFAEE------VLPLLDRVGHMPLP-PYIDR
QUEA_PSEPF      ---------GGGEAEMLARHD---ALFELGFAEE------VLPLLDRVGHMPLP-PYIDR
QUEA_SACD2      ---------DGTEVEMVARHE---ALFELRFPADT----TALDVLENIGHMPLP-PYIDR
QUEA_MARHV      ---------DGAALRMLARKD---ALFHFVYEG-DE---AFLDVLERIGHMPLP-PYMER
QUEA_IDILO      ---------GHVKITMLARHD---ALFELKFEH-DE---TVLELLEQYGHMPLP-PYIDR
QUEA_CHRSD      ---------GDVHAVVEARHD---ALFELRFLGET----PMIELLENHGHMPLP-PYIDR
QUEA_ALKEH      ---------GGVAAEVTGREG---EFFTLRFTAEQ----TVLELLEHHGHMPLP-PYIRR
QUEA_HAHCH      ---------ENYVLTMVEREG---DLFRLRVSQGG----SVSELLERCGHMPLP-PYIDR
QUEA_ALCBS      ---------KGIRAQVTGRRG---ALFILHFSLPGNGCDTLLSALELIGHVPLP-PYIDR
QUEA_HYDCU      ---------EAFDAEVLGREG---ALFEVQLSKDEAPELTALELIEAHGHMPLP-PYIER
QUEA_XYLFT      ---------AGGHAEVLGRDG---EFYLLSFDVESP----LEQWLSDVGQLPLP-PYIHR
QUEA_XYLFA      ---------AGGHAGVLGRDG---DFYLLSFDVESP----LEQWLSDVGQLPLP-PYIHR
QUEA_XANAC      ---------AGGQAEVLGRDG---EFYLLRFEIPTP----LEHWLLEAGRLPLP-PYIRR
QUEA_XANC5      ---------AGGQAEVLGRDG---EFYLLRFQIPTP----LEHWLLEAGRLPLP-PYIRR
QUEA_XANOR      ---------AGGQAEVLGRDG---AFYLLRFEIPTP----LEHWLLEAGRLPLP-PYIRR
QUEA_XANCP      ---------AGGQAEVLGRDG---EFYLLRFDIPAP----LEHWLLDAGRLPLP-PYIRR
QUEA_XANC8      ---------AGGQAEVLGRDG---EFYLLRFDIPAP----LEHWLLDAGRLPLP-PYIRR
QUEA_METCA      ---------AEHRVRVVERDG---DLFLLELAGEEP----LQTVLEQIGHMPLP-PYITR
QUEA_NITOC      ---------QSVEVEVKGRVK---ELFELRFLDPRP----LPQLLEAIGQMPLP-PYIQR
QUEA_CUPMC      ----------AFAVTVGPRVD---QFFTLRFPE------PALDLIERYGRLPLP-PYITH
QUEA_CUPPJ      ----------AFAVTVGPRVD---QFFTLRFPA------PALDLIEQYGRLPLP-PYITH
QUEA_CUPNH      ----------AFAVTVGPRVD---QFFTLRFPE------PALDLIERYGRLPLP-PYIRH
QUEA_RALSO      ----------AFDVTVGPRHE---PFFTLRFPQ------PALELIEQYGRLPLP-PYIEH
QUEA_BURCA      ----------AFDVTVGERVE---PFFTLHFPA------PCLDLIEQHGRLPLP-PYIEH
QUEA_BURCH      ----------AFDVTVGERVE---PFFTLHFPA------PCLDLIEQHGRLPLP-PYIEH
QUEA_BURL3      ----------AFDVTVGERVD---PFFTLNFPE------PCLDLIEQYGRLPLP-PYIEH
QUEA_BURVG      ----------AFDVTVGERVE---PFFTLHFPQ------PCLTLIEQYGRLPLP-PYIEH
QUEA_BURCM      ----------AFDVTVGERVE---PFFTLHFPQ------PCLTLIEQHGRLPLP-PYIEH
QUEA_BURP0      ----------AFDVTVGERVE---PFFTLHFPD------DCLVLIERHGRLPLP-PYIEH
QUEA_BURP1      ----------AFDVTVGERVE---PFFTLHFPD------DCLVLIERHGRLPLP-PYIEH
QUEA_BURP6      ----------AFDVTVGERVE---PFFTLHFPD------DCLVLIERHGRLPLP-PYIEH
QUEA_BURPS      ----------AFDVTVGERVE---PFFTLHFPD------DCLVLIERHGRLPLP-PYIEH
QUEA_BURMS      ----------AFDVTVGERVE---PFFTLHFPD------NCLVLIERHGRLPLP-PYIEH
QUEA_BURM9      ----------AFDVTVGERVE---PFFTLHFPD------NCLVLIERHGRLPLP-PYIEH
QUEA_BURM7      ----------AFDVTVGERVE---PFFTLHFPD------NCLVLIERHGRLPLP-PYIEH
QUEA_BURMA      ----------AFDVTVGERVE---PFFTLHFPD------NCLVLIERHGRLPLP-PYIEH
QUEA_PARXL      ----------AFDVTVGERVE---PFYTLHFPA------DCLTLIEQFGRLPLP-PYIEH
QUEA_JANMA      ----------AFDVIVGERAG---EFYELQFPD------DVFELIEAHGRLPLP-PYIEH
QUEA_HERAR      ----------AFDVIVGERAG---EFYELQFPG------DIFALIEAHGRLPLP-PYIEH
QUEA_AZOSB      ----------AVDVTVLGRSG---EFFHLRFPDDE----NVVDVLERYGKLPLP-PYIQR
QUEA_AROAE      ----------AFDVTVLGRVG---EFFHLRFPDSH----DVLDLLEHHGKLPLP-PYIDR
QUEA_DECAR      ----------AFTVKMTGRAGADGDFFALELAEPG----DFWELSERYGKLPLP-PYIEH
QUEA_BORPA      ----------AFEAEVLGREG---ELFDLRFPA------PVLDLLDAHGATPLP-PYITH
QUEA_BORBR      ----------AFEAEVLGREG---ELFDLRFPA------PVLDLLDAHGATPLP-PYITH
QUEA_BORPE      ----------AFEAEVLGREG---ELFDLRFPA------PVLDLLDAHGATPLP-PYITH
QUEA_THIDA      ----------DVALDVLDKQH---DLTRLHFPA------PVLDVLDRCGRLPLP-PYIEH
QUEA_NEIM0      ----------GIRAVMVGREG---ELFCLRFEGGE----TVYELLEQNGHLPLP-PYIER
QUEA_NEIMA      ----------GIRAVMVGREG---ELFCLRFEGGE----TVYELLEQNGHLPLP-PYIER
QUEA_NEIMB      ----------GIRAVTVGREG---ELFCLRFEGGE----TVYELLEQNGHLPLP-PYIER
QUEA_NEIG1      ----------GIRAVMVGREG---ELFCLRFEGGQ----TVYELLEQNGHLPLP-PYIER
QUEA_CHRVO      ----------RWEAEMVERHD---SMFKLRFLAEE----NVYDILEASGKLPLP-PYIER
QUEA_NITEU      ----------KITAQVEAREQ---DIYTLCFMHSL----PLIELLDQFGHTPLP-PYIGR
QUEA_NITEC      ----------AITVQVEAREQ---DIYTLRFIHSQ----PLIELLDQYGHTPLP-PYIGR
QUEA_NITMU      ----------AIEVTVLSREH---GFYILQFEHES----GVMELLERYGNLPLP-PYISR
QUEA_POLAQ      ---------ETFSVEMIGYDG---RFYEVLFPD------HVFSLLERFGKLPLP-PYIEH
QUEA_DICNV      -------------VTIEDKKD---GIYTVFSEM------PWTKLMAQQGKMPIP-PYLAR
QUEA_PSYWF      -----------IECVMIGRHE---NLFILSFKN------PILPDLEQYGELPIP-PYFER
QUEA_PSYA2      -----------MTGIMIGRQE---NLFILAFDT------PILPDLEQYGELPIP-PYFER
QUEA_ACIAD      -----------IKVTVQGRHE---NLFVVEFSE------PILSVLDRYGQLPIP-PYFNR
QUEA_LEGPL      ----------GKRLEVLQRQD---DLFLC--KASEN----ILDLLNDLGHIPLP-PYIDR
QUEA_LEGPH      ----------GKRLEVLQRQD---DLFLC--KACEN----ILDLLNDLGHIPLP-PYIAR
QUEA_LEGPA      ----------GKRLEVLERQD---DLFLC--KASEN----ILDLLNDLGHIPLP-PYIAR
QUEA_LEGPC      ----------GKRLEVLERQD---DLFLC--KASEN----ILDLLNDLGHIPLP-PYIAR
QUEA_COXBU      ----------NFKIIIEGRYN---DLFECVLHSSAS----ILDLLYQHGRIPLP-PYIQR
QUEA_COXBN      ----------NFKIIIEGRYN---DLFECVLHSSAS----ILDLLYQHGRIPLP-PYIQR
QUEA_COXBR      ----------NFKIIIEGRYN---DLFECVLHSSAS----ILDLLYQHGRIPLP-PYIQR
QUEA_BUCAI      ---------DKIKGSVVD--CK-NSFFEIFFHD-NI--DSAIDIINNIGEIPLP-PYIKR
QUEA_BUCAP      ---------NKIKSFIIG--YK-NPFYIIKFLH-NK--KSVIDIFNNIGHIPLP-PYIKR
QUEA_BLOFL      ---------LNIYIYVIKIYYS-YKLFKIYFDNINY--NNVLSLLNDIGHIPIP-PYFHR
QUEA_VESOH      ---------VNIIVYQKD-----NGFYTLIFET-----DSLFDLLNNIGHTPLP-PYIKR
QUEA_FRATH      ----------DTLAKVLDKDG---GMYLLEIQGDKD----IYQLMEEFGHIPLP-PYMKR
QUEA_FRATO      ----------DTLAKVLDKDG---GMYLLEIQGDKD----IYQLMEEFGHIPLP-PYMKR
QUEA_FRATF      ----------DTLAKVLDKDG---GMYLLEIQGDKD----IYQLMEEFGHIPLP-PYMKR
QUEA_FRATW      ----------DTLAKVLDKDG---GMYLLEIQGDKD----IYQLMEEFGHIPLP-PYMKR
QUEA_FRATT      ----------DTLAKVLDKDG---GMYLLEIQGDKD----IYQLMEEFGHIPLP-PYMKR
QUEA_FRAT1      ----------DTLAKVLDKDG---GMYLLEIQGDKD----IYQLMEEFGHIPLP-PYMKR
QUEA_FRATN      ----------DTLAKVLDKDG---GMYLLEIQGDKD----IYQLMEEFGHIPLP-PYMKR
QUEA_FRAP2      ----------DTLAKILEKDG---GMYLLELQGNKD----IYQLMEEFGHIPLP-PYMKR
QUEA_GEOKA      ----------LEAVCL-DTLEHGGRVLEFSY------DGLFYEVLAELGEMPLP-PYIKE
QUEA_GEOTN      ----------LQAVCL-DTLEHGGRVLEFSY------EGLFYQVLAELGEMPLP-PYIKE
QUEA_BACSU      ----------LKAICT-EELEHGGRKMEFQY------DGIFYEVLESLGEMPLP-PYIKE
QUEA_BACVZ      ----------LTAVCT-EELDHGGRKIEFRY------DGIFYEVLESLGEMPLP-PYIKE
QUEA_BACP2      ----------LQAVCT-EELEHGGRKVEFQY------TGIFYEVLESLGEMPLP-PYIKE
QUEA_BACLD      ----------LTAVCT-EELEHGGRKIEFRY------EGIFYEVLESLGEMPLP-PYIKE
QUEA_BACHD      ----------LTATCV-QELEHGGRVLEFSY------EGIFHEVLDQLGEMPLP-PYIKE
QUEA_BACHK      ----------LKATCT-GTADQGGRQLEFSY------DGIFYEILDELGEMPLP-PYIKE
QUEA_BACC1      ----------LKATCT-GTADQGGRQLEFSY------DGIFYEILDELGEMPLP-PYIKE
QUEA_BACAN      ----------LKATCT-GTADQGGRQLEFSY------DGIFYEILDELGEMPLP-PYIKE
QUEA_BACCZ      ----------LKATCT-GTADQGGRQLEFSY------DGIFYEILDELGEMPLP-PYIKE
QUEA_BACCR      ----------LKATCT-GTADQGGRQLEFSY------DGIFYEILDELGEMPLP-PYIKE
QUEA_BACCN      ----------LKATCV-GTADQGGRQLEFSY------DGIFYEILDELGEMPLP-PYIKE
QUEA_OCEIH      ----------LKATCI-DLKDHGGRIMTFSY------TGIFYEILDQLGEMPLP-PYIKE
QUEA_LISMO      ----------LKATCL-EELEHGGRILEFSY------EGIFYEVLEQLGEMPLP-PYIKE
QUEA_LISMF      ----------LKAICL-EELEHGGRILEFSY------EGIFYEVLEQLGEMPLP-PYIKE
QUEA_LISIN      ----------LKATCL-EELEHGGRILEFSY------EGIFYEVLEQLGEMPLP-PYIKE
QUEA_LISW6      ----------LKATCL-EELEHGGRILEFSY------EGIFYEVLEQLGEMPLP-PYIKE
QUEA_BACSK      ----------LTAICT-AVQPQGGRIFEFRY------SGVFYELLEELGTMPLP-PYIKE
QUEA_STRT2      ----------LTATVT-EELDHGGRIVEFSY------NGIFLEVLESLGEMPLP-PYIHE
QUEA_STRTD      ----------LTATVT-KELDHGGRIVEFSY------DGIFLEVLESLGEMPLP-PYIHE
QUEA_STRT1      ----------LTATVT-EELDHGGRIVEFSY------DGIFLEVLESLGEMPLP-PYIHE
QUEA_STRA1      ----------LIATVT-KELEHGGRIVEFSY------DGIFLEVLESLGEMPLP-PYIHE
QUEA_STRA5      ----------LIATVT-KELEHGGRIVEFSY------DGIFLEVLESLGEMPLP-PYIHE
QUEA_STRA3      ----------LIATVT-KELEHGGRIVEFSY------DGIFLEVLESLGEMPLP-PYIHE
QUEA_STRP8      ----------LKATII-DELEHGGRIVEFSY------DGIFLEVLESLGEMPLP-PYIHE
QUEA_STRPF      ----------LKATII-DELEHGGRIVEFSY------DGIFLEVLESLGEMPLP-PYIHE
QUEA_STRP6      ----------LKATII-DELEHGGRIVEFSY------DGIFLEVLESLGEMPLP-PYIHE
QUEA_STRPB      ----------LKATII-DELEHGGRIVEFSY------DGIFLEVLESLGEMPLP-PYIHE
QUEA_STRPM      ----------LKATII-DELEHGGRIVEFSY------DGIFLEVLESLGEMPLP-PYIHE
QUEA_STRPC      ----------LKATII-DELEHGGRIVEFSY------DGIFLEVLESLGEMPLP-PYIHE
QUEA_STRPG      ----------LKATII-DELEHGGRIVEFSY------DGIFLEVLESLGEMPLP-PYIHE
QUEA_STRP1      ----------LKATII-DELEHGGRIVEFSY------DGIFLEVLESLGEMPLP-PYIHE
QUEA_STRP3      ----------LKATII-DELEHGGRIVEFSY------DGIFLEVLESLGEMPLP-PYIHE
QUEA_STRPD      ----------LKATII-DELEHGGRIVEFSY------DGIFLEVLESLGEMPLP-PYIHE
QUEA_STRMU      ----------LKAIIK-EELDHGGRIVEFSY------EGIFLEVLESLGEMPLP-PYIHE
QUEA_STRP2      ----------LSAVVT-EELTHGGRIVRFEY------QRIFLEVLESLGEMPLP-PYIHE
QUEA_STRR6      ----------LSAVVT-EELTHGGRIVRFEY------QRIFLEVLESLGEMPLP-PYIHE
QUEA_STRPN      ----------LSAVVT-EELTHGGRIVRFEY------QGIFLEVLESLGEMPLP-PYIHE
QUEA_STRSV      ----------LTATVI-EELEHGGRIVRFSY------EGIFLEVLESLGEMPLP-PYIHE
QUEA_LACLM      ----------LKAVVV-EILEHGGRIVEFKY------DGIFLEILESLGEMPLP-PYIHE
QUEA_LACLA      ----------LKAVVV-EVLDHGGRIVEFKY------DGIFLEILESLGEMPLP-PYIHE
QUEA_LACPL      ----------LTATVT-AEKEDGIRMIEFHY------DGIFMEILESLGETPLP-PYIKE
QUEA_LACBA      ----------LTATVT-EEREDGIRLIEFHY------DGIFMEILEQLGETPLP-PYIKE
QUEA_PEDPA      ----------LTATVT-KELEHGGREIVFDY------DGIFMEVLEKLGEMPLP-PYIKE
QUEA_LACSS      ----------LRAIVT-KELEHGGRMIEFKY------DGIFMQILEALGEMPLP-PYIKE
QUEA_ENTFA      ----------LKAVVK-EELEHGGRIIEFKY------DGIFLEILESLGEMPLP-PYIKE
QUEA_STAAM      ----------IIAECI-KEMDQGGRIMRLHY------EGILQERLDELGEMPLP-PYIKE
QUEA_STAA9      ----------IIAECI-KEMDQGGRIMRLHY------EGILQERLDELGEMPLP-PYIKE
QUEA_STAA2      ----------IIAECI-KEMDQGGRIMRLHY------EGILQERLDELGEMPLP-PYIKE
QUEA_STAA1      ----------IIAECI-KEMDQGGRIMRLHY------EGILQERLDELGEMPLP-PYIKE
QUEA_STAAB      ----------IIAECI-KEMDQGGRIMRLHY------EGILQERLDELGEMPLP-PYIKE
QUEA_STAAW      ----------IIAECI-KEMDQGGRIMRLHY------EGILQERLDELGEMPLP-PYIKE
QUEA_STAAN      ----------IIAECI-KEMDQGGRIMRLHY------EGILQERLDELGEMPLP-PYIKE
QUEA_STAAR      ----------IIAECI-KEMDQGGRIMRLHY------EGILQERLDELGEMPLP-PYIKE
QUEA_STAAS      ----------IIAECI-KEMDQGGRIMRLHY------EGILQERLDELGEMPLP-PYIKE
QUEA_STAAE      ----------IIAECI-KEMDQGGRIMRLHY------EGILQERLDELGEMPLP-PYIKE
QUEA_STAAC      ----------IIAECI-KEMDQGGRIMRLHY------EGILQERLDELGEMPLP-PYIKE
QUEA_STAA8      ----------IIAECI-KEMDQGGRIMRLHY------EGILQERLDELGEMPLP-PYIKE
QUEA_STAAT      ----------IIAECI-KEMDQGGRIMRLHY------EGILQERLDELGEMPLP-PYIKE
QUEA_STAA3      ----------IIAECI-KEMDQGGRIMRLHY------EGILQERLDELGEMPLP-PYIKE
QUEA_STAHJ      ----------IIAECI-EELDQGGRIMRLHY------EGILEERLNELGEMPLP-PYIKE
QUEA_STAES      ----------IVAECI-EELEQGGRIMRLHY------EGILQERLDELGEMPLP-PYIKE
QUEA_STAEQ      ----------IVAECI-EELEQGGRIMRLHY------EGILQERLDELGDMPLP-PYIKE
QUEA_STAS1      ----------IIAECI-EELDQGGRIMRLHY------DGILQERLDELGEMPLP-PYIKE
QUEA_CLOBH      ----------LKAEVI-GMGEEGSRIVKFYY------EGIFEEILDQLGQMPLP-PYIKE
QUEA_CLOB1      ----------LKAEVI-GMGEEGSRIVKFYY------EGIFEEILDQLGQMPLP-PYIKE
QUEA_CLOBL      ----------LEAEVI-GMGEEGSRIVKFYY------EGIFEEILDQLGQMPLP-PYIKE
QUEA_CLOTE      ----------LKAEVI-GMAEEGSRIVKFEY------DGIFEEVLDRLGQMPLP-PYITE
QUEA_CLOAB      ----------LKAVIK-SIGEDGNRVVEFKY------EGIFEEILDKLGQMPLP-PYITE
QUEA_CLOK5      ----------LKAEVV-SINEDGNRIVRFEY------NGVFEEILDKLGQIPLP-PYIKE
QUEA_CLOPE      ----------LKAIVR-EIGEEGNRIIEFKY------DGIFEQVLDELGQMPLP-PYIHE
QUEA_CLOP1      ----------LKAIVR-EIGEEGNRIIEFKY------DGIFEQVLDELGQMPLP-PYIHE
QUEA_CLOPS      ----------LKAIVR-EIGEEGNRIIEFKY------DGIFEQVLDELGQMPLP-PYIHE
QUEA_CLOB8      ----------LKAEVV-EVEENGNRIVEFFY------DGIFEEVLDSLGEMPLP-PYIHE
QUEA_HUNT2      ----------LKAEVI-EIVEEGNRLVRFEY------DGIFEEILDRIGIVPLP-PYITK
QUEA_CLOD6      ----------LIGEVV-DLSDEGSRIIKFHY------DGIFEEILDELGNMPLP-PYITA
QUEA_LACP7      ----------LIGEII-DVVEEGNRLVKFTY------QGIFEEILDELGQMPLP-PYITH
QUEA_ALKMQ      ----------LKAEVL-SMADEGARIVRFEY------EGVFEELLDQLGKMPLP-PYITE
QUEA_CALS4      ----------LVAEII-DTTEAGGRIARFYY------DGVFEEVLDRLGEMPVP-PYIKK
QUEA_SYMTH      ----------LVGTVV-GPTDYGGRVIDFHY------EGVFENLLERLGQMPLP-PYIHE
QUEA_MOOTA      ----------LQARVK-GVTPAGGRIMEFSYQ-----EGPWEALLERLGEMPLP-PYIKE
QUEA_DESHY      ----------LRGELL-EILPDGNRLVRFNY------QGIFEEVLDQLGNMPLP-PYITE
QUEA_DESRM      ----------MKGKIV-DHTDVGGRVIEFSC------QEPFLQVLEQIGSMPLP-PYIKK
QUEA_PELTS      ----------LACRIL-DSTAYGGRVVEFSF------EGLFEEVLERVGVMPLP-PYIKK
QUEA_CARHZ      ----------LEGEIV-AQTEVG-RIIKFSF------QGVFEEILNQLGQTPLP-PYIKE
QUEA_FUSNN      ----------LIAELL-EIKEDGNRILKFYY------EGSFEEILDKLGSMPLP-PYITR
QUEA_THEMA      -----------SAVCL-GRGEDGTRILKFQP--------QDDRLIFEKGRTPLP-PYIKN
QUEA_THEP1      -----------SAVCL-GRGEDGTRILKFQP--------QDDRLIFEKGRTPLP-PYIKN
QUEA_THEM4      -----------YCVCL-DWGDEGSRILEFNI--------TEEEL-FKLGEAPLP-PYVKN
QUEA_DEHMC      ----------IQAEVL-ADKEDGIKLLRFSD----------ETHLMKLGEVPLP-PYIHT
QUEA_DEHMB      ----------TQAKVL-ADKDDSIKLLRFSD----------ETHLMKLGEVPLP-PYIHT
QUEA_DEHM1      ----------IQAEVL-ADKEDGIKLLRFSD----------ETLLMKLGEVPLP-PYIHT
QUEA_FLAJ1      ----------LVAEVI-DNTTSRGRTLRFLYDG---SYEEFRNKLTELGETPIP-KYINR
QUEA_FLAPJ      ----------LVAEVI-DNTTSRGRTLRFLYDG---SYEEFRNKLTELGETPIP-KYISR
QUEA_BACFN      ----------MVAEVI-DNTTSRGRTLRFLYDG---PHDEFKKALYALGETPLPHTILNR
QUEA_BACFR      ----------MVAEVI-DNTTSRGRTLRFLYDG---PHDEFKKALYALGETPLPHTILNR
QUEA_BACV8      ----------MVAEVI-DNTTSRGRTLRFLYDG---SHDEFKKALYALGEAPLP-SFIRR
QUEA_PARD8      ----------MVAEVI-DNTTSRGRTLRFLYDG---NHDEFKKALYALGETPLP-KYIER
QUEA_CYTH3      ----------LVAEVV-DNTTSRGRTIRFLFDG---NSEDFSKIIETIGETPLP-RYIKR
QUEA_GEOMG      ---------GVSAEVI-GRSDGDTWCVSFTP------VTGFDEWLERNGAMPLP-PYIRR
QUEA_GEOSL      ---------GVRAVVR-EPGDGETWLVSFTP------GEGFQEWLDRNGAMPLP-PYIRR
QUEA_GEOUR      ---------GVVARVL-ERSELDTWAVSFSP------VEGFLDRLERIGSMPLP-PYIRR
QUEA_PELCD      ---------GLEGTVV-EGGEPPYRHVRFSF------QGDFSQVLEQVGRIPLP-PYIRR
QUEA_PELPD      ---------AMTALVV-ERLEPEGWLLEFQG------AEPFSVWLEREGEMPLP-PYLQR
QUEA_PELLD      ---------GHEFLVE-EIVDHGVARLSLPE------GRSIQPVFEAHAEVPIP-PYLRR
QUEA_CHLPM      ---------GHELIVE-ELAGQGVARLSVEG------IESVHALFQNHAEVPIP-PYLKR
QUEA_CHLPD      ---------GCEFGVE-ELVGQGVAVLSVKG------EGTVQDVFERYAAMPIP-PYLKR
QUEA_CHLTE      ---------GVELSVE-ALPSDGIARLSC-A------TGNLADLFDAHGSVPIP-PYLKR
QUEA_CHLCH      ---------GHTLLVE-EVLPQGLARLALAD------GGDLHQFFTQFGSVPIP-PYLKR
QUEA_CAUVC      ----VGDLGRLDAVIA-EKHDGGEVVLAFDL-----SGPDLDVGIAQHGDMPLP-PYIAA
QUEA_CAUSK      ----ACQAGMLDATVI-AKHEGGEIELAFDF-----AGVDLDLAVAAHGEMPLP-PYIAA
QUEA_BRUC2      -----CFLGTLDATVA-EKGDSGEALLVFDL-----SGAVLDEAIAAVGHIPLP-PYIAS
QUEA_BRUSU      -----CFLGTLDATVA-EKGDSGEALLVFDL-----SGAVLDEAIAAVGHIPLP-PYIAS
QUEA_BRUA2      -----CFLGTLDATVA-EKGDSGEALLVFDL-----SGAVLDEAIAAVGHIPLP-PYIAS
QUEA_BRUME      -----CFLGTLDATVA-EKGDSGEALLVFDL-----SGAVLDEAIAAVGHIPLP-PYIAS
QUEA_BRUO2      -----CFLGTLDATVA-EKGDSGEALLVFDL-----SGAVLDEAIAAVGHIPLP-PYIAS
QUEA_BRUSI      -----CFLGTLDATVA-EKGDSGEALLVFDL-----SGAVLDEAIAAVGHIPLP-PYIAS
QUEA_BRUAB      -----CFLGTLDATVA-EKGDSGEALLVFDL-----SGAVLDEAIAAVGHIPLP-PYIAS
QUEA_OCHA4      -----CFLGTLDATVA-EKGDAGEALLVFDL-----SGAMLDEAIASVGHIPLP-PYIAS
QUEA_RHILO      -----CFLGQLDATVI-EKGEGGEALLGFDL-----SGPFLDEALHAVGHIPLP-PYIAS
QUEA_CHESB      -----CFLGSLDATVA-EKGEGGEALLVFDF-----SGPVLDEAIAAAGHVPLP-PYIAS
QUEA_RHIEC      -----CMIGSLDATVE-EKGEAGEVTLAFDL-----SGPVLDEAIAAVGHIPLP-PYIAA
QUEA_RHIL3      -----CFLGSLDATVE-EKGEAGEVTLLFDL-----SGPALDEAIAAVGHIPLP-PYIAA
QUEA_AGRFC      ----ACGLAHLEATVE-EKGEEGEITLLFDI-----SGPVLDEAIASVGHIPLP-PYIAA
QUEA_RHIME      -----CLLGSLEAVVE-EKGDAGEVTLRFDL-----SGPSLDEAIMAVGHIPLP-PYIAS
QUEA_SINMW      -----CLLGSLDAMVE-EKGDAGEVTLRFDL-----SGPSLDEAIMSVGHIPLP-PYIAS
QUEA_RHOPS      -----CLLGHLDATVE-AKGDAGEVTLAFTF-----HGPALDQAIAELGATPLP-PYIAS
QUEA_RHOPA      -----CLLGHLDATVE-AKGDAGEVTLVFSF-----HGPVLDQAIAEVGATPLP-PYIAS
QUEA_RHOP5      -----CLLGQLDATVE-AKGEAGEIILAFTL-----HGPVLDQAIAELGAPPLP-PYIAS
QUEA_NITWN      -----CFLGHLDARVE-SKGEEGEVTFAFSF-----HGPMLDQAIAELGSTPLP-PYIAS
QUEA_BRASO      -----CLLGHLDATVE-AKGEEGEVTLSFVF-----HGPALDQAIADLGRPPLP-PYIAG
QUEA_BRASB      -----CLLGHLDATVE-AKGEEGEVTLSFVF-----HGPALDQAIADLGRPPLP-PYIAG
QUEA_BRADU      -----CLLGHLDAEVE-AKGSEGEVTLSFSF-----HGPALDQAIADLGSPPLP-PYIAS
QUEA_AZOC5      ---------TLEARVL-DKLESGEVHFAFAL-----SGPELDAAIDAIGHMPLP-PYIAA
QUEA_PARL1      --------GGLSAAVE-EKGEGGEAGLRFSL-----SGPALDAAIAAAGEMPLP-PYIAR
QUEA_MARMM      ---------TLKAEVT-GKSEGGDVRLVFNA-----AGAALDAAIAVAGEMPLP-PYIAR
QUEA_HYPNA      ---------GFSARIA-SRREGGEILLDFNC-----EGEAMIAALDAHGAMPLP-PYIAR
QUEA_RHORT      ---------GFTATVA-ARGEDGEATLRFDR-----AGAALMAALEAYGHIPLP-PYIK-
QUEA_SPHWW      ---------GVSAIAA-ERGEDGSILLDFEG-----DEP-VELLLERAGTMPLP-PYIAG
QUEA_NOVAD      ---------GVTATAE-MRLPDGSWTLFFPG-----EEP-VEVLLERAGRMPLP-PYIAG
QUEA_SPHAL      ---------GVAALAE-ERLADGSFVLAFAG-----DEP-VELLLERAGTMPLP-PYIAG
QUEA_ERYLH      ---------DVSADVE-DRADDGSFTFAFRG-----DEP-VEVLLDRAGTMPLP-PYIAG
QUEA_ZYMMO      ---------DVSARVV-HRNDDGSVLFEFLG-----NEP-VEILLERAGNMPLP-PYIAH
QUEA_GLUDA      ----------NTAAVI-SRDDEGGVVLRFDT-----EGAAFDAFLQAAGVLALP-PYIAR
QUEA_GLUOX      ----------VTATVI-ENEGDGAVSIRFSV-----EGDEFDAFLERVGALALP-PYIER
QUEA_ACICJ      ----------IAAEVI-DRAPDGSATLRFDC-----DAETFRAMLDRAASLALP-PYIPR
QUEA_RUEST      ---------ALSAELV-DVV-DGQGRLRFNL-----AGDDFDAALAEAGAMPLP-PYIAA
QUEA_RUEPO      ---------DLSADVE-AIE-DGQALLRFNL-----TGPDFDAALAQAGAMPLP-PYIAA
QUEA_ROSDO      ---------RLRATLR-AVK-DGQGVLQFNL-----EGDDFDAALNAAGAMPLP-PYIAT
QUEA_JANSC      ---------ALQADVH-AMD-EGL-RLAFNV-----EGDDFDAALNAAGAMPLP-PYIAG
QUEA_RHOS4      ---------ALSAEVA-EKG-ETDLRLVFDR-----AGAAFDAALAEAGAMPLP-PYIAA
QUEA_RHOS1      ---------ALSAEVA-EKG-ETDLRLVFDR-----AGAAFDAALAEAGAMPLP-PYIAA
QUEA_RHOS5      ---------ALSAEVA-EKG-ETDLRLVFDR-----AGEDFDAALAEAGAMPLP-PYIAA
QUEA_DINSH      ---------ALRATVA-ERG-ADRVRLVFNC-----TGDDFDAALAQAGAMPLP-PYIAA
QUEA_THET2      -----APVPGLQAEVV-AVEEDG--VRLLRF------QGDLVAHLEEVGEVPLP-PYIKA
QUEA_THET8      -----APVPGLQAEVV-AVEEDG--VRLLRF------QGDLVAHLEEVGEVPLP-PYIKA
QUEA_DEIRA      -------ATGHRAEVV-GVLDDG--ARLLRF------DHDIKPHLDEIGRLPLP-PYINA
QUEA_RUBXD      -----------RLEVV-EELGEG--RWLVR-------GRDVPGLLERAGRMPLP-PYIEP
QUEA_ANADF      ---------GLEARVE-ASEGEGFYVVTLDR-----EGEALEAALARAGRIPLP-PYIRR
QUEA_ANADE      ---------GLEARVD-AVEGEGFYRVTLDR-----QGAELEAALGRAGRIPLP-PYIRR
QUEA_SORC5      ---------ALVAEVL-ERAEDGVLTVQLSSP----AGLSVAAAIDAYGHVPLP-PYLGR
QUEA_SYNAS      ---------HSRATVI-ERINEKKWLLTFNT------ALPFDLFLQRYGKAPLP-PYIKR
QUEA_SOLUE      ---------GLEAEII-ARGEFGERTVRFLG------SGDLYAAFDRIGHVPLP-PYIKR
QUEA_DESVV      --------DDLRVEVV-HKGEF-GRSMVLLF-----WRGELATLFAREGHLPLP-PYIRR
QUEA_DESVH      --------DDLRVEVV-HKGEF-GRSMVLLF-----WRGELATLFAREGHLPLP-PYIRR
QUEA_DESAG      --------DGLDVEVL-HTADF-GRCAVRMH-----WKGDLAGLFLRQGHLPLP-PYIRR
QUEA_SYNWW      --------KPLVIEIV-EELDFAGGRRVRFQ-----DSVDEDTLLQEQGHIPLP-PYINR
QUEA_NOSS1      ------SPHQLTATVLETDKATGGRLLQFDLP----EGQSLVQLLDKFGEIPLP-PYITT
QUEA_TRIV2      PPSPVPNPHQLTATVLETDKATGGRLLQFDLP----EGESLVQLLDKFGEIPLP-PYITA
QUEA_THEEB      ---------PLQATVQTIDEETRGRVIEFDLP----PGDRLWSYLDHLGEVPLP-PYIDH
QUEA_SYNE7      ------EDPLLVADVEASDPATGGRWLRFRG-----EAEAFWSQLATLGEMPLP-PYIHT
QUEA_SYNP6      ------EDPLLVADVEASDPATGGRWLRFRG-----EAEAFWSQLATLGEMPLP-PYIHT
QUEA_ACAM1      -------RPLLRAEILATDADTRGRIIQFESL----VEEPFEDLLEQLGEVPLP-PYIQE
QUEA_SYNY3      ------EKPDLWATILQRDDATGGRLLEFVLE----PGQRLWDVLPDYGEIPFP-PYIGD
QUEA_GLOVI      ---------VLAARVTELDAETGGRWLRFEG------EEDFEAALERVGHTPLP-PYLKT
QUEA_SYNSC      --------TSISLTVLAEDPASGGRLVQFPSDCR--DAETIEGLLNDVGEVPLP-PYIER
QUEA_SYNPX      --------TSIGLTVLEDDAASGGRLVQFPTDCR--DAETIETLLNQWGEVPLP-PYIDR
QUEA_SYNS9      --------TAITLRVLHEDPASGGRIVQFPLDCR--DAESIEALLNQCGEVPLP-PYIDR
QUEA_SYNS3      -------QEPLSLAVLANDAASGGRIVQFPPDCV--DALSLEGLLERYGEVPLP-PYITR
QUEA_SYNPW      -------QDPLPLQVLASDPASGGRIVQFPPAFV--DAMAIEALLQRYGEVPLP-PYITC
QUEA_PROMM      -------EEPIALQVISKDSASGGRVVQFPSHYA--NAEQLELLLERYGEVPLP-PYIQR
QUEA_PROM3      -------EEPIALQVISKDSASGGRVVQFPSHYA--NAEQLELLLERYGEVPLP-PYIKC
QUEA_SYNR3      -------EPDLPLQVLAVEESSGGRLIQFPPECV--DAASLEPLLLRYGVMPLP-PYIHQ
QUEA_PROMA      -------EESIPLKIIDQDISTGGRIVQFPELFS--DRRKIEPLLEKFGEIPLP-PYINR
QUEA_PROMT      -------DNSLILKVIDKDERTGGRIIQFSNEFT--SWTEMENILDLCGEVPLP-PYIDK
QUEA_PROM1      -------DNSLILKVIDKDEKTGGRIIQFSNEFT--SWTEMENLLDLCGEVPLP-PYIDK
QUEA_PROMP      -------AKDIKLHISGTDKETGGRFIKFPENIN--DLISMNNLLDIYGETPLP-PYIKS
QUEA_DESPS      -----------ALSCRVTEQLAGGK-ARLQLHYD--KDVDVTEILAGIGEIPLP-PYIKR
QUEA_AQUAE      ---------DFKVEVLEHIEEGKFRVKLLGEE--------PLKLIDKYGHIPIP-PYLKR
QUEA_NITSB      -------------AIVEELIEDGTRIVTFYHDEKRLSFHELLPILDTIGSIPLP-PYIDR
QUEA_ARCB4      -------------AIVEEVDEDGSRIVEFFQDEKKLDFLSLVEILNKIGHLPLP-PYMNR
QUEA_CAMJE      -------------VRVVELLNDGLRKVQFFQNDKTLDTSNLYNLLDKIGHIPLP-PYIKR
QUEA_SULDN      -------------AKIIELLEDGSRVVNFYKNDSILRFEEILPIIDKIGHIPLP-PYIQR
QUEA_HELPJ      -------------AEVLELLHNGQRLIAFYDNQTPLNQENILKLLEQYGHMPLP-PYIKR
QUEA_HELPH      -------------AEVLELLHNGQRLIAFYNHKTPLNQENILKLLEQYGHMPLP-PYIKR
QUEA_HELPY      -------------AEVLELLHNGQRLIAFYDNKTPLNQENILKLLEQYGHMPLP-PYIKR
QUEA_HELAH      -------------AEVLELLNNGQRLIAFYDNKTPLDQASILKLLEQYGHMPLP-PYIKR
QUEA_HELHP      ---------PFLIAQVQECLDNGLRVVSFMQNEHALEYIQVLDMLEKYGHTPLP-PYIKR
QUEA_RICBR      -----------HKIIITEKLEMGEIKIKFELAN-----ISVFEFLDKYGEMPLP-LYIKR
QUEA_RICB8      -----------HKIIITEKLEMGEIKIKFELAN-----ISVFEFLDKYGEMPLP-LYIKR
QUEA_RICRS      -----------HKVIITEKLAMGEIKVKFKLND-----ISVFEFLNKYGEMPLP-VYIRR
QUEA_RICRO      -----------HKVIITEKLAMGEIKVKFKLND-----ISVFEFLNKYGEMPLP-VYIRR
QUEA_RICAH      -----------HKVIITEKLVMGEIKVKFDLDN-----ISVFEFLDKYGEMPLP-VYIRR
QUEA_RICFE      -----------HKVIITEKFAMGEIKVKFELDN-----ISVFEFLDKYGEMPLP-VYIRR
QUEA_RICTY      -----------HKIIITEKLAMGEIKVKFILNN-----ISMIKFLDKYGEMPLP-FYIKR
QUEA_RICCK      -----------HKVIIVEKLAIGEIKVKFELDD-----ISVFEFLDKYGEMPLP-LYIRH
QUEA_BORBP      ----------LMGEILSKN----NSEIVLKFDN-----NVDEDYFEKHGFVPIP-PYIKR
QUEA_BORAP      ----------LMGKILSKN----SSEIVLKFND-----DVREDYFEKHGFVPIP-PYIKR
QUEA_BORBU      ----------LMDEILSKN----SSEVVLKFNN-----NVGEDYFEKHCFVPLP-SYIKR
QUEA_TREDE      ----------TEAEIIESEIPLESEFRCMKFNR-----VIDDEWLDKYGHMPLP-PYIHR
                                                                   ..*   .  

QUEA_SHISS      PD--------------------------------------EDAD-----RELYQTVYSEK
QUEA_ECOHS      PD--------------------------------------EDAD-----RELYQTVYSEK
QUEA_SHIFL      PD--------------------------------------EDAD-----RELYQTVYSEK
QUEA_SHIDS      PD--------------------------------------EDAD-----RELYQTVYSEK
QUEA_ECO57      PD--------------------------------------EDAD-----RELYQTVYSEK
QUEA_ECO24      PD--------------------------------------EDAD-----RELYQTVYSEK
QUEA_SHIF8      PD--------------------------------------EDAD-----RELYQTVYSEK
QUEA_ECOLI      PD--------------------------------------EDAD-----RELYQTVYSEK
QUEA_ECOLC      PD--------------------------------------EDAD-----RELYQTVYSEK
QUEA_ECOL5      PD--------------------------------------EDAD-----RELYQTVYSEK
QUEA_ECOL6      PD--------------------------------------EDAD-----RELYQTVYSEK
QUEA_SHIBS      PD--------------------------------------EDAD-----RELYQTVYSEK
QUEA_ECOK1      PD--------------------------------------EDAD-----RELYQTVYSEK
QUEA_ECOUT      PD--------------------------------------EDAD-----RELYQTVYSEK
QUEA_SALPB      PD--------------------------------------EDAD-----RELYQTVYSEK
QUEA_SALTY      PD--------------------------------------EDAD-----RELYQTVYSEK
QUEA_SALCH      PD--------------------------------------EDAD-----RELYQTVYSEK
QUEA_SALPA      PD--------------------------------------EDAD-----RELYQTVYSEK
QUEA_SALTI      PD--------------------------------------EDAD-----RELYQTVYSEK
QUEA_SALAR      PD--------------------------------------EDAD-----RELYQTVYSEK
QUEA_CITK8      PD--------------------------------------EDAD-----RELYQTVYSEK
QUEA_ENT38      PD--------------------------------------EDAD-----RELYQTVYSQK
QUEA_KLEP7      PD--------------------------------------EDAD-----RELYQTVYGTR
QUEA_CROS8      PD--------------------------------------EEAD-----RELYQTVYSQK
QUEA_YERPE      PD--------------------------------------EDAD-----RELYQTVYSQR
QUEA_YERPS      PD--------------------------------------EDAD-----RELYQTVYSQR
QUEA_YERP3      PD--------------------------------------EDAD-----RELYQTVYSQR
QUEA_YERE8      PD--------------------------------------EDAD-----RELYQTVYSQR
QUEA_SERP5      PD--------------------------------------EDAD-----RELYQTVYSEK
QUEA_PECAS      PD--------------------------------------EDAD-----RELYQTVYSQR
QUEA_PHOLL      PD--------------------------------------EEAD-----RELYQTVYSER
QUEA_SODGM      PD--------------------------------------DVAD-----RELYQTVYGER
QUEA_BAUCH      PD--------------------------------------YSLD-----RELYQTVYSQH
QUEA_VIBCH      PD--------------------------------------EEAD-----KERYQTVYNQK
QUEA_VIBC3      PD--------------------------------------EETD-----KERYQTVYNQK
QUEA_VIBPA      PD--------------------------------------EDAD-----KERYQTVYNQK
QUEA_VIBCB      PD--------------------------------------EDAD-----KERYQTVYNQK
QUEA_VIBVU      PD--------------------------------------EDAD-----KERYQTVYNQK
QUEA_VIBVY      PD--------------------------------------EDAD-----KERYQTVYNQK
QUEA_ALIF1      PD--------------------------------------EDAD-----KERYQTVYNKK
QUEA_PHOPR      PD--------------------------------------EDAD-----KERYQTVYNAK
QUEA_AERHH      PD--------------------------------------EDAD-----KERYQTVYNQK
QUEA_AERS4      PD--------------------------------------EDAD-----KERYQTVYNQK
QUEA_COLP3      PD--------------------------------------EDSD-----KERYQTVYNEK
QUEA_PSEA6      PD--------------------------------------EESD-----KERYQTVYNEK
QUEA_SHEPA      PD--------------------------------------EDAD-----KERYQTVYNQN
QUEA_SHEHH      PD--------------------------------------EDAD-----KERYQTVYNQN
QUEA_SHELP      PD--------------------------------------EDAD-----KERYQTVYNQN
QUEA_SHESM      PD--------------------------------------EDAD-----KERYQTVYNQN
QUEA_SHESA      PD--------------------------------------EDAD-----KERYQTVYNQN
QUEA_SHESR      PD--------------------------------------EDAD-----KERYQTVYNQN
QUEA_SHEON      PD--------------------------------------EDAD-----KERYQTVYNQN
QUEA_SHESW      PD--------------------------------------EDAD-----KERYQTVYNQN
QUEA_SHEPC      PD--------------------------------------EDAD-----KERYQTVYNQN
QUEA_SHEB8      PD--------------------------------------EDAD-----KERYQTVYNQN
QUEA_SHEB9      PD--------------------------------------EDAD-----KERYQTVYNQN
QUEA_SHEB5      PD--------------------------------------EDAD-----KERYQTVYNQN
QUEA_SHEFN      PD--------------------------------------EDTD-----KERYQTVYNQT
QUEA_SHEDO      PD--------------------------------------EDAD-----KERYQTVYNKT
QUEA_SHEAM      PD--------------------------------------EDTD-----KERYQTVYNER
QUEA_PSEHT      PD--------------------------------------NEAD-----RERYQTVYGEK
QUEA_HAEIG      PD--------------------------------------EEAD-----KECYQTVYSKV
QUEA_HAEIE      PD--------------------------------------EEAD-----KECYQTVYSKV
QUEA_HAEI8      PD--------------------------------------EEAD-----KECYQTVYSKV
QUEA_HAEIN      PD--------------------------------------EEAD-----QECYQTVYSKV
QUEA_HAES1      PD--------------------------------------EDAD-----KERYQTVYNKV
QUEA_HISS2      PD--------------------------------------EDAD-----KERYQTVYNKV
QUEA_PASMU      PD--------------------------------------EEAD-----KERYQTVYNKV
QUEA_MANSM      PD--------------------------------------EDAD-----QERYQTVYSKI
QUEA_HAEDU      PD--------------------------------------EDFD-----QERYQTVYSKV
QUEA_ACTP2      PD--------------------------------------EDAD-----QERYQTVYSKV
QUEA_MARMS      PD--------------------------------------EDSD-----QERYQTVYNQK
QUEA_PSEAB      PD--------------------------------------DAAD-----RERYQTVYAQR
QUEA_PSEAE      PD--------------------------------------DAAD-----RERYQTVYAQR
QUEA_PSEA7      PD--------------------------------------DAAD-----RERYQTVYAQR
QUEA_PSEMY      PD--------------------------------------DEAD-----RERYQTVYAEK
QUEA_PSEP1      PD--------------------------------------EGAD-----RERYQTVYAQR
QUEA_PSEPK      PD--------------------------------------EGAD-----RERYQTVYAQR
QUEA_PSEPG      PD--------------------------------------EGAD-----RERYQTVYAQR
QUEA_PSEE4      PD--------------------------------------EGAD-----RERYQTVYAER
QUEA_PSEU2      PD--------------------------------------EGAD-----RERYQTVYAQR
QUEA_PSE14      PD--------------------------------------EGAD-----RERYQTVYAQR
QUEA_PSESM      PD--------------------------------------EGAD-----RERYQTVYAQR
QUEA_PSEF5      PD--------------------------------------EGAD-----RERYQTVYAQR
QUEA_PSEPF      PD--------------------------------------EGSD-----RERYQTVYAEK
QUEA_SACD2      ED--------------------------------------EADD-----KERYQTVYGTQ
QUEA_MARHV      ED--------------------------------------EQSD-----RERYQTVYAKE
QUEA_IDILO      PD--------------------------------------ESSD-----KERYQTVYNRE
QUEA_CHRSD      ED--------------------------------------ELDD-----RERYQTVYARR
QUEA_ALKEH      AD--------------------------------------VAAD-----RERYQTVFARR
QUEA_HAHCH      ED--------------------------------------DLSD-----RERYQTVYSRQ
QUEA_ALCBS      PD--------------------------------------EDGD-----MERYQTVYARE
QUEA_HYDCU      ED--------------------------------------QLED-----KERYQTVYSEK
QUEA_XYLFT      EP--------------------------------------DEYD-----RERYQTVFARS
QUEA_XYLFA      EP--------------------------------------DEYD-----RERYQTVFARA
QUEA_XANAC      EP--------------------------------------GVED-----RERYQTVFARE
QUEA_XANC5      EP--------------------------------------GVED-----RERYQTVFARE
QUEA_XANOR      EP--------------------------------------GVED-----RERYQTVFARE
QUEA_XANCP      EP--------------------------------------GLDD-----RERYQTVFARE
QUEA_XANC8      EP--------------------------------------GLDD-----RERYQTVFARE
QUEA_METCA      PD--------------------------------------TSAD-----LERYQTVYATR
QUEA_NITOC      KT--------------------------------------VPVD-----KERYQTIYASR
QUEA_CUPMC      DP--------------------------------------DAYD-----ETRYQTVYARN
QUEA_CUPPJ      DP--------------------------------------DAYD-----ETRYQTVYARN
QUEA_CUPNH      DP--------------------------------------DAYD-----ETRYQTVYARS
QUEA_RALSO      TP--------------------------------------DSFD-----ETRYQTVYART
QUEA_BURCA      DA--------------------------------------DATD-----ETRYQTVYASN
QUEA_BURCH      DA--------------------------------------DATD-----ETRYQTVYASN
QUEA_BURL3      DP--------------------------------------DATD-----ETRYQTVYASN
QUEA_BURVG      DA--------------------------------------DATD-----ETRYQTVYASN
QUEA_BURCM      DA--------------------------------------DAND-----ETRYQTVYASN
QUEA_BURP0      AP--------------------------------------DAAD-----ETRYQTVFAAN
QUEA_BURP1      AP--------------------------------------DAAD-----ETRYQTVFAAN
QUEA_BURP6      AP--------------------------------------DAAD-----ETRYQTVFAAN
QUEA_BURPS      AP--------------------------------------DAAD-----ETRYQTVFAAN
QUEA_BURMS      AP--------------------------------------DAAD-----ETRYQTVFAAN
QUEA_BURM9      AP--------------------------------------DAAD-----ETRYQTVFAAN
QUEA_BURM7      AP--------------------------------------DAAD-----ETRYQTVFAAN
QUEA_BURMA      AP--------------------------------------DAAD-----ETRYQTVFAAN
QUEA_PARXL      DP--------------------------------------DATD-----ETRYQTVFAQN
QUEA_JANMA      AA--------------------------------------DAYD-----ETRYQTVYAKT
QUEA_HERAR      AA--------------------------------------DAYD-----ETRYQTVYAKT
QUEA_AZOSB      AA--------------------------------------GDAD-----EARYQTVFARA
QUEA_AROAE      SA--------------------------------------DEHD-----ESRYQTVYARE
QUEA_DECAR      PA--------------------------------------EGTD-----ETRYQTVYARE
QUEA_BORPA      AA--------------------------------------DATD-----ERRYQTVYARE
QUEA_BORBR      AA--------------------------------------DATD-----ERRYQTVYARE
QUEA_BORPE      AA--------------------------------------DATD-----ERRYQTVYARE
QUEA_THIDA      AP--------------------------------------TEED-----EARYQTVYANE
QUEA_NEIM0      AA--------------------------------------DADD-----DSRYQTVYAKY
QUEA_NEIMA      AA--------------------------------------DADD-----DSRYQTVYAKY
QUEA_NEIMB      AA--------------------------------------DADD-----DSRYQTVYAKY
QUEA_NEIG1      AA--------------------------------------DADD-----DSRYQTVYAKY
QUEA_CHRVO      SA--------------------------------------EHDD-----DERYQTVYARE
QUEA_NITEU      NA--------------------------------------TVSD-----ENRYQTVFAQE
QUEA_NITEC      IA--------------------------------------TASD-----ESRYQTVFAQE
QUEA_NITMU      PV--------------------------------------EKSD-----ELRYQTVYAAR
QUEA_POLAQ      QP--------------------------------------DGED-----AQRYQTVVAKN
QUEA_DICNV      DA--------------------------------------EALD-----SERYQTVYAQI
QUEA_PSYWF      HA--------------------------------------DETD-----NVRYQTVFHDP
QUEA_PSYA2      HA--------------------------------------DATD-----NTRYQTVFHDP
QUEA_ACIAD      EA--------------------------------------EEID-----TERYQTVFHDP
QUEA_LEGPL      ED--------------------------------------ESLD-----KERYQTVYAKC
QUEA_LEGPH      ED--------------------------------------ESLD-----KERYQTVYAKC
QUEA_LEGPA      ED--------------------------------------ESLD-----KERYQTVYAKC
QUEA_LEGPC      ED--------------------------------------ESLD-----KERYQTVYAKC
QUEA_COXBU      EP--------------------------------------DKDD-----QARYQTIFAER
QUEA_COXBN      EP--------------------------------------DKDD-----QARYQTIFAER
QUEA_COXBR      EP--------------------------------------DKDD-----QARYQTIFAER
QUEA_BUCAI      FR--------------------------------------NKLD-----VDLYQTVYKKK
QUEA_BUCAP      FN--------------------------------------EKID-----SSLYQTVYKKN
QUEA_BLOFL      LD--------------------------------------EIID-----YELYQTVYGSK
QUEA_VESOH      TN--------------------------------------NVQD-----LSRYQTVYAQK
QUEA_FRATH      DD--------------------------------------EEFD-----AERYQTVYAQD
QUEA_FRATO      DD--------------------------------------EEFD-----AERYQTVYAQD
QUEA_FRATF      DD--------------------------------------EEFD-----AERYQTVYAQD
QUEA_FRATW      DD--------------------------------------EEFD-----AERYQTVYAQD
QUEA_FRATT      DD--------------------------------------EEFD-----AERYQTVYAQD
QUEA_FRAT1      DD--------------------------------------EEFD-----AERYQTVYAQD
QUEA_FRATN      DD--------------------------------------EEFD-----AERYQTVYAQD
QUEA_FRAP2      DD--------------------------------------EEFD-----AERYQTVYAKD
QUEA_GEOKA      ----------------------------------------KLDD-----PERYQTVYARE
QUEA_GEOTN      ----------------------------------------KLDN-----PERYQTVYARE
QUEA_BACSU      ----------------------------------------QLDD-----KERYQTVYSKE
QUEA_BACVZ      ----------------------------------------QLDD-----KERYQTVFSKE
QUEA_BACP2      ----------------------------------------QLDD-----RERYQTVYSKE
QUEA_BACLD      ----------------------------------------QLDD-----RERYQTVYSKK
QUEA_BACHD      ----------------------------------------QLDD-----KDRYQTVFAKN
QUEA_BACHK      ----------------------------------------TLED-----RDRYQTVYAKE
QUEA_BACC1      ----------------------------------------TLED-----RDRYQTVYAKE
QUEA_BACAN      ----------------------------------------TLED-----RDRYQTVYAKE
QUEA_BACCZ      ----------------------------------------TLED-----RDRYQTVYAKE
QUEA_BACCR      ----------------------------------------TLED-----RDRYQTVYAKE
QUEA_BACCN      ----------------------------------------TLED-----RDRYQTVYAKE
QUEA_OCEIH      ----------------------------------------QLPE-----QDRYQTVYAKE
QUEA_LISMO      ----------------------------------------QLAD-----QDRYQTVYAKE
QUEA_LISMF      ----------------------------------------QLAD-----QDRYQTVYGKE
QUEA_LISIN      ----------------------------------------QLAD-----QDRYQTVYAKE
QUEA_LISW6      ----------------------------------------QLAD-----QDRYQTVYAKE
QUEA_BACSK      ----------------------------------------RLED-----ADRYQTVYAKQ
QUEA_STRT2      ----------------------------------------KLED-----RDRYQTVYAKE
QUEA_STRTD      ----------------------------------------KLED-----RDRYQTVYAKE
QUEA_STRT1      ----------------------------------------KLED-----RDRYQTVYAKE
QUEA_STRA1      ----------------------------------------KLED-----RDRYQTVYAKE
QUEA_STRA5      ----------------------------------------KLED-----RDRYQTVYAKE
QUEA_STRA3      ----------------------------------------KLED-----RDRYQTVYAKE
QUEA_STRP8      ----------------------------------------KLED-----AERYQTVYAKE
QUEA_STRPF      ----------------------------------------KLKD-----AERYQTVYAKE
QUEA_STRP6      ----------------------------------------KLED-----AERYQTVYAKE
QUEA_STRPB      ----------------------------------------KLED-----AERYQTVYAKE
QUEA_STRPM      ----------------------------------------KLED-----AERYQTVYAKE
QUEA_STRPC      ----------------------------------------KLED-----AERYQTVYAKE
QUEA_STRPG      ----------------------------------------KLED-----AERYQTVYAKE
QUEA_STRP1      ----------------------------------------KLED-----AERYQTVYAKE
QUEA_STRP3      ----------------------------------------KLED-----AERYQTVYAKE
QUEA_STRPD      ----------------------------------------KLED-----AERYQTVYAKE
QUEA_STRMU      ----------------------------------------KLED-----RDRYQTVYAKE
QUEA_STRP2      ----------------------------------------KLDD-----RERYQTVYAKE
QUEA_STRR6      ----------------------------------------KLDD-----RERYQTVYAKE
QUEA_STRPN      ----------------------------------------KLDD-----RERYQTVYAKE
QUEA_STRSV      ----------------------------------------KLAD-----RERYQTVYAKE
QUEA_LACLM      ----------------------------------------QLED-----QERYQTVFAKE
QUEA_LACLA      ----------------------------------------QLQD-----QERYQTVFAKE
QUEA_LACPL      ----------------------------------------KLDD-----PDRYQTVYAKE
QUEA_LACBA      ----------------------------------------KLDD-----PDRYQTVYAKE
QUEA_PEDPA      ----------------------------------------KLDD-----PERYQTVYSKE
QUEA_LACSS      ----------------------------------------KLDD-----PEMYQTVYAKE
QUEA_ENTFA      ----------------------------------------RLDD-----PDRYQTVYAEE
QUEA_STAAM      ----------------------------------------RLDD-----PDRYQTVYAKE
QUEA_STAA9      ----------------------------------------RLDD-----PDRYQTVYAKE
QUEA_STAA2      ----------------------------------------RLDD-----PDRYQTVYAKE
QUEA_STAA1      ----------------------------------------RLDD-----PDRYQTVYAKE
QUEA_STAAB      ----------------------------------------RLDD-----PDRYQTVYAKE
QUEA_STAAW      ----------------------------------------RLDD-----PDRYQTVYAKE
QUEA_STAAN      ----------------------------------------RLDD-----PDRYQTVYAKE
QUEA_STAAR      ----------------------------------------RLDD-----PDRYQTVYAKE
QUEA_STAAS      ----------------------------------------RLDD-----PDRYQTVYAKE
QUEA_STAAE      ----------------------------------------RLDD-----PDRYQTVYAKE
QUEA_STAAC      ----------------------------------------RLDD-----PDRYQTVYAKE
QUEA_STAA8      ----------------------------------------RLDD-----PDRYQTVYAKE
QUEA_STAAT      ----------------------------------------RLDD-----PDRYQTVYAKE
QUEA_STAA3      ----------------------------------------RLDD-----PDRYQTVYAKE
QUEA_STAHJ      ----------------------------------------RLDD-----PDRYQTVYAKE
QUEA_STAES      ----------------------------------------RLDD-----PDRYQTVYAKE
QUEA_STAEQ      ----------------------------------------RLDD-----PDRYQTVYAKE
QUEA_STAS1      ----------------------------------------RLDD-----QERYQTVYAKA
QUEA_CLOBH      ----------------------------------------KLDD-----KEMYQTVYSKE
QUEA_CLOB1      ----------------------------------------KLDD-----KEMYQTVYSKE
QUEA_CLOBL      ----------------------------------------KLDD-----KEMYQTVYSKE
QUEA_CLOTE      ----------------------------------------KLED-----KEKYQTVYSKE
QUEA_CLOAB      ----------------------------------------ELEN-----KEEYQTVYSKN
QUEA_CLOK5      ----------------------------------------KLEN-----KELYQTVYSKE
QUEA_CLOPE      ----------------------------------------KLED-----KERYQTVYSKE
QUEA_CLOP1      ----------------------------------------KLED-----KERYQTVYSKE
QUEA_CLOPS      ----------------------------------------KLED-----KERYQTVYSKE
QUEA_CLOB8      ----------------------------------------RLED-----RERYQTVYSKE
QUEA_HUNT2      ----------------------------------------KLDD-----AERYQTVYSRY
QUEA_CLOD6      ----------------------------------------RLDE-----KERYQTVYSKH
QUEA_LACP7      ----------------------------------------ELAD-----KNRYQTVYAKH
QUEA_ALKMQ      ----------------------------------------ELAD-----RERYQTVYSKH
QUEA_CALS4      ----------------------------------------KLKD-----KNRYQTVYAKY
QUEA_SYMTH      ----------------------------------------QLEE-----PERYQTVYARE
QUEA_MOOTA      ----------------------------------------KPAD-----PGRYQTVYARE
QUEA_DESHY      ----------------------------------------QLQD-----KERYQTIYAKE
QUEA_DESRM      ----------------------------------------PLTD-----KQRYQTVYARQ
QUEA_PELTS      ----------------------------------------PLLD-----QQRYQTIYARQ
QUEA_CARHZ      ----------------------------------------KLKD-----PERYQTIYAKE
QUEA_FUSNN      ----------------------------------------KLEN-----KDRYQTVYAQR
QUEA_THEMA      ----------------------------------------EVP------LERYQTVYAKE
QUEA_THEP1      ----------------------------------------EVP------LERYQTVYAKE
QUEA_THEM4      ----------------------------------------KVS------FERYQTIYSRE
QUEA_DEHMC      ----------------------------------------PVAD-----PERYQTVYALT
QUEA_DEHMB      ----------------------------------------PVAD-----PERYQTVYALT
QUEA_DEHM1      ----------------------------------------PVSD-----PERYQTVYALT
QUEA_FLAJ1      DV--------------------------------------TPED-----AERYQTIYAKE
QUEA_FLAPJ      EV--------------------------------------TPED-----AERYQTIYAKE
QUEA_BACFN      PV--------------------------------------EEED-----AERFQSIFAKN
QUEA_BACFR      PV--------------------------------------EEED-----AERFQSIFAKN
QUEA_BACV8      PV--------------------------------------EEED-----AERFQTIFAKN
QUEA_PARD8      EV--------------------------------------EPED-----EDRYQNIFAAE
QUEA_CYTH3      PI--------------------------------------EEAD-----KDRYQTIFAEN
QUEA_GEOMG      SAADA--------------------------------------D-----RERYQTVFSRQ
QUEA_GEOSL      EADAA--------------------------------------D-----RDRYQTVFARN
QUEA_GEOUR      SAGDD--------------------------------------D-----RERYQTVFARA
QUEA_PELCD      EATPD--------------------------------------D-----RSRYQTVFARE
QUEA_PELPD      PAESG--------------------------------------D-----QLRYQTVFARS
QUEA_PELLD      PAEPV--------------------------------------D-----RERYQTVFAEH
QUEA_CHLPM      DAEAV--------------------------------------D-----RERYQTVFAEH
QUEA_CHLPD      EAEEI--------------------------------------D-----RERYQTVFAEQ
QUEA_CHLTE      DAEEL--------------------------------------D-----RERYQTVFAEL
QUEA_CHLCH      NAEAV--------------------------------------D-----RERYQTVFAAH
QUEA_CAUVC      KRGED------------------------------------ERD-----RADYQTVYARE
QUEA_CAUSK      KRAED------------------------------------DRD-----RADYQTVYARE
QUEA_BRUC2      KRPED------------------------------------ERD-----RKDYQTVYARE
QUEA_BRUSU      KRPED------------------------------------ERD-----RKDYQTVYARE
QUEA_BRUA2      KRPED------------------------------------ERD-----RKDYQTVYARE
QUEA_BRUME      KRPED------------------------------------ERD-----RKDYQTVYARE
QUEA_BRUO2      KRPED------------------------------------ERD-----RKDYQTVYARE
QUEA_BRUSI      KRPED------------------------------------ERD-----RKDYQTVYARE
QUEA_BRUAB      KRPED------------------------------------ERD-----RKDYQTVYARE
QUEA_OCHA4      KRAED------------------------------------ERD-----RKDYQTVYARE
QUEA_RHILO      KRDDD------------------------------------ERD-----RADYQTIYARE
QUEA_CHESB      KRPDD------------------------------------ERD-----RADYQTIYARE
QUEA_RHIEC      KRPED------------------------------------ERD-----RADYQTIYARE
QUEA_RHIL3      KRPED------------------------------------ERD-----RADYQTIYARE
QUEA_AGRFC      KRPED------------------------------------QQD-----QTDYQTIYARE
QUEA_RHIME      KRADD------------------------------------ERD-----RTDYQTVYARE
QUEA_SINMW      KRADD------------------------------------ARD-----RTDYQTVYARE
QUEA_RHOPS      KRTPD------------------------------------DQD-----AADYQTMFAAN
QUEA_RHOPA      KRAPD------------------------------------AQD-----IADYQTMFASN
QUEA_RHOP5      KRAPD------------------------------------DRD-----AADYQTMFAAN
QUEA_NITWN      KRAPD------------------------------------DRD-----ASDYQTMFATH
QUEA_BRASO      KRPAD------------------------------------EQD-----AQDYQTMFAAK
QUEA_BRASB      KRPAD------------------------------------EQD-----AADYQTMFAAK
QUEA_BRADU      KRTPD------------------------------------DQD-----FADYQTMFAAN
QUEA_AZOC5      KRPED------------------------------------DRD-----RTDYQPVFARV
QUEA_PARL1      KRAAD------------------------------------DED-----VADYQTLHADE
QUEA_MARMM      KRGVD------------------------------------EKD-----EADYQTLFATH
QUEA_HYPNA      RRPAD------------------------------------AED-----RETYQTRFAGE
QUEA_RHORT      -RPDD------------------------------------ARD-----RADYQTIYARE
QUEA_SPHWW      KRPTD------------------------------------DRD-----RDDYQTMFARE
QUEA_NOVAD      KRPTD------------------------------------EQD-----REDYQTMFAAK
QUEA_SPHAL      KRGAD------------------------------------EAD-----RDDYQTMFARE
QUEA_ERYLH      KRATD------------------------------------ERD-----RDDYQTMFARE
QUEA_ZYMMO      KRPAD------------------------------------QQD-----RQDYQTIFAEK
QUEA_GLUDA      PFGPT------------------------------------EQD-----RVDYATIFSAH
QUEA_GLUOX      PFGPT------------------------------------KQD-----DADYRTIFSQY
QUEA_ACICJ      PAGIS------------------------------------EQD-----RQDYQTMFAAE
QUEA_RUEST      KRPAD------------------------------------EQD-----KTDYQTVWARN
QUEA_RUEPO      KRAAD------------------------------------EQD-----KTDYQTVWARH
QUEA_ROSDO      RRPAD------------------------------------ERD-----KSDYQTVFAQN
QUEA_JANSC      KRAPD------------------------------------ARD-----YHDYQTIWAKR
QUEA_RHOS4      RRAPD------------------------------------TQD-----DEDYQTVFARH
QUEA_RHOS1      RRAPD------------------------------------AQD-----DEDYQTVFARH
QUEA_RHOS5      RRAPD------------------------------------AQD-----REDYQTVFARH
QUEA_DINSH      KRAAD------------------------------------AQD-----RDDYQTVFAAR
QUEA_THET2      -----------------------------------------KIP-----MERYQTVYARR
QUEA_THET8      -----------------------------------------KIP-----MERYQTVYARR
QUEA_DEIRA      GDS-D------------------------------------ETW-----RERYQTVYAKT
QUEA_RUBXD      ----T------------------------------------PEA-----EASYQTVYART
QUEA_ANADF      AP--S------------------------------------DVD-----RERYQTIWARA
QUEA_ANADE      AP--D------------------------------------AED-----AARYQTIWARA
QUEA_SORC5      GD--D------------------------------------ASD-----RERYQTIFARV
QUEA_SYNAS      EKKNAQ----------------------------------MPED-----RDRYQTIYARS
QUEA_SOLUE      DDS--------------------------------------PAD-----RERYQTVFARE
QUEA_DESVV      ADGDE--------------------------------------D-----RDRYQTVFARE
QUEA_DESVH      ADGDE--------------------------------------D-----RDRYQTVFARE
QUEA_DESAG      PDGED--------------------------------------D-----HSRYQTVYSRQ
QUEA_SYNWW      PDEEL--------------------------------------D-----RERYQTVYACK
QUEA_NOSS1      S----------------------------------------QAA-----DEQYQTVYAEE
QUEA_TRIV2      S----------------------------------------QAA-----DEQYQTVYAEQ
QUEA_THEEB      P----------------------------------------LAD-----TEQYQTVYARR
QUEA_SYNE7      T----------------------------------------ASD-----PERYQTVYSRE
QUEA_SYNP6      T----------------------------------------ASD-----PERYQTVYSRE
QUEA_ACAM1      S----------------------------------------TAQ-----PEQYQTVYAQH
QUEA_SYNY3      R----------------------------------------QAT-----NDQYQTIYAEK
QUEA_GLOVI      G----------------------------------------RTR-----DERYQTLWASR
QUEA_SYNSC      H----D----------------------------------PS-D-----SQRYQTRYADR
QUEA_SYNPX      H----D----------------------------------PD-D-----VERYQTRYADR
QUEA_SYNS9      H----D----------------------------------PG-D-----AERYQTRYADR
QUEA_SYNS3      H----D----------------------------------SS-D-----QERYQTRYATR
QUEA_SYNPW      H----D----------------------------------DS-D-----QERYQTRYASR
QUEA_PROMM      H----D----------------------------------PS-D-----SERYQTRYASR
QUEA_PROM3      H----D----------------------------------PS-D-----SERYQTRYASR
QUEA_SYNR3      Q----D----------------------------------ES-D-----NARYQTCFASK
QUEA_PROMA      C----D----------------------------------FK-D-----VNRYQTRYAST
QUEA_PROMT      D----K----------------------------------SSDH-----EESYQTRFASK
QUEA_PROM1      D----R----------------------------------SSGH-----EENYQTRFASK
QUEA_PROMP      AE---E----------------------------------ESFH-----ENSYQTEYASN
QUEA_DESPS      EEG--T----------------------------------TPED-----VTRYQTVYANV
QUEA_AQUAE      E----E----------------------------------EPID-----RVYYQTIFAKE
QUEA_NITSB      AA--------------------------------------KKED-----ETNYQPIFAKK
QUEA_ARCB4      ED--------------------------------------EKQD-----EQNYQTLFAKN
QUEA_CAMJE      ED--------------------------------------EKSD-----LKDYQSIFAKN
QUEA_SULDN      ED--------------------------------------NKDD-----EIEYQSVFAKE
QUEA_HELPJ      AD--------------------------------------ESLD-----AHEYQSVFAKH
QUEA_HELPH      TD--------------------------------------ESLD-----AHEYQSVFAKH
QUEA_HELPY      AD--------------------------------------ESLD-----AHEYQSVFAKH
QUEA_HELAH      AD--------------------------------------ESLD-----TLEYQSVFAKH
QUEA_HELHP      ED--------------------------------------SCQD-----AHFYQSVFSKQ
QUEA_RICBR      PERQ-------------------------------------KSD-----DERYQTVYSNI
QUEA_RICB8      PERQ-------------------------------------KSD-----DERYQTVYSNI
QUEA_RICRS      SHSLCHPV-------ATTTGSKT--YLNNDWIPWSNHGMTNTQN----DNDRYQTVYSQI
QUEA_RICRO      SHSLCHPV-------ATTTGSKT--YLNNDWIPWSNHGMTNTQN----DNDRYQTVYSQI
QUEA_RICAH      SHSLYHTT-------STLCHTRENGYSEKLDAFFRRNDIKDKDNDIVYDNERYQTIYSQI
QUEA_RICFE      SKRHGEEE-------ESSDEAIS---SQNPEIATESKRTPSNDDK--LDSLRYQTIYSQI
QUEA_RICTY      TSSVCCSNMALFCDHDNTLKITSISHNSNTVNFRSTDSMIDSTN----DNDRYQTIYSQI
QUEA_RICCK      HEAQ-------------------------------------KSN-----NERYQNIYSSI
QUEA_BORBP      DY--------------------------------------DKID-----EDRYQTVYSKY
QUEA_BORAP      DY--------------------------------------DKID-----EDRYQTIYSKY
QUEA_BORBU      DY--------------------------------------DKID-----EDRYQTIYSKY
QUEA_TREDE      KD--------------------------------------TQED-----ADRYQTVYAEI
                                                                    :       

QUEA_SHISS      P---GAVAAPTAGLHFDEPLLEKLRAKGVEMAFVTLHVGAGTFQPVRVDTIEDHIMHSEY
QUEA_ECOHS      P---GAVAAPTAGLHFDEPLLEKLRAKGVEMAFVTLHVGAGTFQPVRVDTIEDHIMHSEY
QUEA_SHIFL      P---GAVAAPTAGLHFDEPLLEKLRAKGVEMAFVTLHVGAGTFQPVRVDTIEDHIMHSEY
QUEA_SHIDS      P---GAVAAPTAGLHFDEPLLEKLRAKGVEMAFVTLHVGAGTFQPVRVDTIEDHIMHSEY
QUEA_ECO57      P---GAVAAPTAGLHFDEPLLEKLRAKGVEMAFVTLHVGAGTFQPVRVDTIEDHIMHSEY
QUEA_ECO24      P---GAVAAPTAGLHFDEPLLEKLRAKGVEMAFVTLHVGAGTFQPVRVDTIEDHIMHSEY
QUEA_SHIF8      P---GAVAAPTAGLHFDEPLLEKLRAKGVEMAFVTLHVGAGTFQPVRVDTIEDHIMHSEY
QUEA_ECOLI      P---GAVAAPTAGLHFDEPLLEKLRAKGVEMAFVTLHVGAGTFQPVRVDTIEDHIMHSEY
QUEA_ECOLC      P---GAVAAPTAGLHFDEPLLEKLRAKGVEMAFVTLHVGAGTFQPVRVDTIEDHIMHSEY
QUEA_ECOL5      P---GAVAAPTAGLHFDEPLLEKLRAKGVEMAFVTLHVGAGTFQPVRVDTIEDHIMHSEY
QUEA_ECOL6      P---GAVAAPTAGLHFDEPLLEKLRAKGVEMAFVTLHVGAGTFQPVRVDTIEDHIMHSEY
QUEA_SHIBS      P---GAVAAPTAGLHFDEPLLEKLRAKGVEMAFVTLHVGAGTFQPVRVDTIEDHIMHSEY
QUEA_ECOK1      P---GAVAAPTAGLHFDEPLLEKLRAKGVEMAFVTLHVGAGTFQPVRVDTIEDHIMHSEY
QUEA_ECOUT      P---GAVAAPTAGLHFDEPLLEKLRAKGVEMAFVTLHVGAGTFQPVRVDTIEDHIMHSEY
QUEA_SALPB      P---GAVAAPTAGLHFDEPLLAALREKGVEMAFVTLHVGAGTFQPVRVDTIEDHIMHSEY
QUEA_SALTY      P---GAVAAPTAGLHFDEPLLAALREKGVEMAFVTLHVGAGTFQPVRVDTIEDHIMHSEY
QUEA_SALCH      P---GAVAAPTAGLHFDEPLLAALREKGVEMAFVTLHVGAGTFQPVRVDTIEDHIMHSEY
QUEA_SALPA      P---GAVAAPTAGLHFDEPLLAALREKGVEMAFVTLHVGAGTFQPVRVDTIEDHIMHSEY
QUEA_SALTI      P---GAVAAPTAGLHFDEPLLAALREKGVEMAFVTLHVGAGTFQPVRVDTIEDHIMHSEY
QUEA_SALAR      P---GAVAAPTAGLHFDKPLLAALREKGIEMAFVTLHVGAGTFQPVRVDTIEDHIMHSEY
QUEA_CITK8      P---GAVAAPTAGLHFDDPLLAALREKGIEMAFVTLHVGAGTFQPVRVETIEDHIMHSEY
QUEA_ENT38      P---GAVAAPTAGLHFDEPLLERLREKGIEMAFVTLHVGAGTFQPVRVDTIEDHIMHSEY
QUEA_KLEP7      P---GAVAAPTAGLHFDEPLLDKLRAKGVEMAFVTLHVGAGTFQPVRVDSIEEHTMHSEY
QUEA_CROS8      P---GAVAAPTAGLHFDEPLLERLRAKGIEMAFVTLHVGAGTFQPVRVESIEDHVMHSEY
QUEA_YERPE      P---GAVAAPTAGLHFDEPMLAALQEKGIEMAFVTLHVGAGTFQPVRVDTIEDHIMHSEY
QUEA_YERPS      P---GAVAAPTAGLHFDEPMLAALQEKGIEMAFVTLHVGAGTFQPVRVDTIEDHIMHSEY
QUEA_YERP3      P---GAVAAPTAGLHFDEPMLAALQEKGIEMAFVTLHVGAGTFQPVRVDTIEDHIMHSEY
QUEA_YERE8      L---GAVAAPTAGLHFDEPMLAALREKGIEMAFVTLHVGAGTFQPVRVETIEDHIMHSEY
QUEA_SERP5      P---GAVAAPTAGLHFDEPLLAALREKGIEMAFVTLHVGAGTFQPVRVETIEEHVMHAEY
QUEA_PECAS      P---GAVAAPTAGLHFDEPMLAALRAKGIEMAFVTLHVGAGTFQPVRVDTIEDHIMHAEY
QUEA_PHOLL      P---GAVAAPTAGLHFDEPLLEALRKKGVEMVFVTLHVGAGTFQPVRVETIEDHIMHAEY
QUEA_SODGM      P---GSVAAPTAGLHFDEPLLAALRAKGVEMAFVTLHVGAGTFQPVRVDQIEHHQMHSEY
QUEA_BAUCH      P---GAIAAPTAGLHFDQQLLSALRVKGVEMVFITLHVGTGTFQPIKVKKIEHHHMYSEY
QUEA_VIBCH      P---GAVAAPTAGLHFDQALLEQIQAKGVELAYVTLHVGAGTFQPVRVENIHDHHMHAEY
QUEA_VIBC3      P---GAVAAPTAGLHFDQALLEQIQAKGVELAYVTLHVGAGTFQPVRVENIHDHHMHAEY
QUEA_VIBPA      P---GAVAAPTAGLHFDDVLLDKIKAKGAEFAYVTLHVGAGTFQPVKVDNINDHHMHAEY
QUEA_VIBCB      P---GAVAAPTAGLHFDDVLLEKITAKGAEFAYVTLHVGAGTFQPVKVDDIDDHHMHAEY
QUEA_VIBVU      P---GAVAAPTAGLHFDNQLLEQIKAKGAEFAYVTLHVGAGTFQPVKVDNILEHHMHSEY
QUEA_VIBVY      P---GAVAAPTAGLHFDNQLLEQIKAKGAEFAYVTLHVGAGTFQPVKVDNILEHHMHSEY
QUEA_ALIF1      P---GAVAAPTAGLHFDTEILEKMKAKGVEFAYVTLHVGAGTFQPVRVDNILEHHMHSEY
QUEA_PHOPR      P---GAVAAPTAGLHFDDKLMAALKAKGVNFAFVTLHVGAGTFQPVRVDNIDDHHMHSEY
QUEA_AERHH      P---GAVAAPTAGLHFDEPLLEKIRAKGVETAFVTLHVGAGTFQPVRVDKIEDHHMHSEY
QUEA_AERS4      P---GAVAAPTAGLHFDEPLLAKIRAKGVETAFVTLHVGAGTFQPVRVDKIEDHHMHSEY
QUEA_COLP3      P---GAVAAPTAGLHFDEALLERIKAKGVELAFVTLHVGAGTFQPVKVDEIADHIMHAEY
QUEA_PSEA6      P---GAVAAPTAGLHFDDVILKQLRDKGVNTEFVTLHVGAGTFQPVRVDNILEHQMHSEY
QUEA_SHEPA      P---GAVAAPTAGLHFDDAILAALKAKGVNTAFVTLHVGAGTFQPVRVDNILDHKMHSEW
QUEA_SHEHH      P---GAVAAPTAGLHFDDAMLAALKDKGVNTAFVTLHVGAGTFQPVRVDNILDHKMHSEW
QUEA_SHELP      P---GAVAAPTAGLHFDDALLAALKEKGVNVAFVTLHVGAGTFQPVRVDSILDHKMHSEW
QUEA_SHESM      P---GAVAAPTAGLHFDDAMLDALKAKGVNIAFVTLHVGAGTFQPVRVDNVLEHKMHSEW
QUEA_SHESA      P---GAVAAPTAGLHFDDAMLDALKAKGVNIAFVTLHVGAGTFQPVRVDNVLEHKMHSEW
QUEA_SHESR      P---GAVAAPTAGLHFDDAMLEALKAKGVNIAFVTLHVGAGTFQPVRVDNVLEHKMHSEW
QUEA_SHEON      P---GAVAAPTAGLHFDDAMLEALKAKGVNIAFVTLHVGAGTFQPVRVDNVLEHKMHSEW
QUEA_SHESW      P---GAVAAPTAGLHFDDAMLDALKAKGVNIAFVTLHVGAGTFQPVRVDTIVEHKMHSEW
QUEA_SHEPC      P---GAVAAPTAGLHFDDAMLDALKAKGVNIAFVTLHVGAGTFQPVRVDNVLEHKMHSEW
QUEA_SHEB8      P---GAVAAPTAGLHFDDAMLDALKAKGVNIAFVTLHVGAGTFQPVRVDTILEHKMHSEW
QUEA_SHEB9      P---GAVAAPTAGLHFDDAMLDALKAKGVNIAFVTLHVGAGTFQPVRVDTILEHKMHSEW
QUEA_SHEB5      P---GAVAAPTAGLHFDDAMLDALKAKDVNIAFVTLHVGAGTFQPVRVDTILEHKMHSEW
QUEA_SHEFN      P---GAVAAPTAGLHFDDAMLADLKAKGVNIAFVTLHVGAGTFQPVRVDNVLEHKMHSEW
QUEA_SHEDO      P---GAVAAPTAGLHFDDAMLSALKHKGVNIAFVTLHVGAGTFQPVRVDNVLEHKMHSEW
QUEA_SHEAM      P---GAVAAPTAGLHFDESILAALKAKGVDMAFVTLHVGAGTFQPVRVDNVLEHKMHSEW
QUEA_PSEHT      P---GAVAAPTAGLHFDDKLMTALKNKGVQMAFVTLHVGAGTFQPVRVATVDEHIMHSEY
QUEA_HAEIG      P---GAVAAPTAGLHFDENLLEKLKAKGVNFEFVTLHVGAGTFQPVRVENIEDHVMHAEY
QUEA_HAEIE      P---GAVAAPTAGLHFDENLLEKLKAKGVNFEFVTLHVGAGTFQPVRVENIEDHVMHAEY
QUEA_HAEI8      P---GAVAAPTAGLHFDKNLLEKLKAKGVNFEFVTLHVGAGTFQPVRVENIEDHVMHAEY
QUEA_HAEIN      P---GAVAAPTAGLHFDENLLEKLKAKGVNFEFVTLHVGAGTFQPVRVENIEDHVMHAEY
QUEA_HAES1      P---GAVAAPTAGLHFDDELLTQLKNKGVNFAFVTLHVGAGTFQPVRVENIEDHKMHAEY
QUEA_HISS2      P---GAVAAPTAGLHFDDELLTQLKNKGVNFAFVTLHVGAGTFQPVRVENIEDHKMHAEY
QUEA_PASMU      P---GAVAAPTAGLHFDDALLAQLKAKGVNFAFVTLHVGAGTFQPVRVEQIEDHKMHAEY
QUEA_MANSM      P---GAVAAPTAGLHFDEELLAKLKAKGVNFAFVTLHVGAGTFQPVRVNNIEEHHMHAEY
QUEA_HAEDU      L---GAVAAPTAGLHFDNPMLDKLKAKGVNMAFVTLHVGAGTFQPVRVENILEHNMHAEY
QUEA_ACTP2      L---GAVAAPTAGLHFDNPTLEKLKAKGVNIAFVTLHVGAGTFQPVRVDNILDHKMHAEY
QUEA_MARMS      P---GAVAAPTAGLHFDEALLEKLKAKGVETAFVTLHVGAGTFQPMKVENVKDHIMHAEY
QUEA_PSEAB      A---GAVAAPTAGLHFDEALLEAIRAKGVDTAFVTLHVGAGTFQPVRVERIEDHVMHREW
QUEA_PSEAE      A---GAVAAPTAGLHFDEALLEAIRAKGVDTAFVTLHVGAGTFQPVRVERIEDHVMHREW
QUEA_PSEA7      A---GAVAAPTAGLHFDEALLEAIRAKGVDTAFVTLHVGAGTFQPVRVERIEDHVMHREW
QUEA_PSEMY      A---GAVAAPTAGLHFDDELLAAIRAKGVETAFVTLHVGAGTFQPVRVERIEDHHMHSEW
QUEA_PSEP1      A---GAVAAPTAGLHFDEALLEKIADKGVERAFVTLHVGAGTFQPVRVDKIEDHHMHKEW
QUEA_PSEPK      A---GAVAAPTAGLHFDEALLEKIADKGVERAFVTLHVGAGTFQPVRVDKIEDHHMHKEW
QUEA_PSEPG      A---GAVAAPTAGLHFDEALLEKIAAKGVERAFVTLHVGAGTFQPVRVDKIEDHHMHKEW
QUEA_PSEE4      A---GAVAAPTAGLHFDEALLEKIAAKGVERAFVTLHVGAGTFQPVRVDKIEDHTMHKEW
QUEA_PSEU2      A---GAVAAPTAGLHFDQPLLEAIAAKGVETAFVTLHVGAGTFQPVRVEQIEDHHMHSEW
QUEA_PSE14      A---GAVAAPTAGLHFDQPLLEAIAAKGVETAFVTLHVGAGTFQPVRVEQIEDHHMHSEW
QUEA_PSESM      A---GAVAAPTAGLHFDQPLMEAIAAKGVETAFVTLHVGAGTFQPVRVEQIEDHHMHSEW
QUEA_PSEF5      L---GAVAAPTAGLHFDQPLLEAIAAKGVETAFVTLHVGAGTFQPVRVERIEDHHMHHEW
QUEA_PSEPF      L---GAVAAPTAGLHFDQTLMEAISAKGVETAFVTLHVGAGTFQPVRVEKIEDHHMHTEW
QUEA_SACD2      K---GAVAAPTAGLHFDDVLLAKLKDKGVQQAFVTLHVGAGTFQPVRVDNIFEHHMHSEV
QUEA_MARHV      A---GAVAAPTAGLHFDDVVLSALKAKGIEFAYVTLHVGAGTFQPVRVDKIEDHVMHSEI
QUEA_IDILO      P---GAVAAPTAGLHFDDEILQQLRDKGVNSAYVTLHVGAGTFQPVRVEDINDHVMHSEY
QUEA_CHRSD      E---GAVAAPTAGLHFDTPLMEALRERGVEMGYVTLHVGAGTFQPVRVDDIREHHMHSEW
QUEA_ALKEH      P---GAVAAPTAGLHFDNELLARIGARGVDTAWVTLHVGSGTFAPLRVSDPREHRMHSEW
QUEA_HAHCH      P---GAVAAPTAGLHFDEALLLAMSQKGVETAFVTLHVGAGTFQPVRVDVVQDHQMHSEY
QUEA_ALCBS      P---GAVAAPTAGLHFDDAMLAALEQRGVDIGFVTLHVGAGTFQPVRVDKVEDHHMHSER
QUEA_HYDCU      P---GAVAAPTAGLHFDNDLLDKIKAKGAAAGFVTLHVGAGTFKPVQVDDISEHVMHSEV
QUEA_XYLFT      V---GAVAAPTAGLHFDESLLARLRARGVEFGYITLHVGAGTFQPVRVALLQEHVMHSEW
QUEA_XYLFA      V---GAVAAPTAGLHFDESLLARLRARGVEFGYITLHVGAGTFQPVRVALLQQHVMHSEW
QUEA_XANAC      V---GAVAAPTAGLHFDEPLLARLRERGVEFGHVTLHVGAGTFQPVRVDKLDQHVMHKEW
QUEA_XANC5      V---GAVAAPTAGLHFDEPLLARLRERGVEFGHVTLHVGAGTFQPVRVDKLDQHVMHKEW
QUEA_XANOR      V---GAVAAPTAGLHFDEALLARLRERGVEFGHVTLHVGAGTFQPVRVDKLDQHVMHKEW
QUEA_XANCP      V---GAVAAPTAGLHFDEALLARLRERGVEFGHVTLHVGAGTFQPVRVDALDKHVMHTEW
QUEA_XANC8      V---GAVAAPTAGLHFDEALLARLRERGVEFGHVTLHVGAGTFQPVRVDALDKHVMHTEW
QUEA_METCA      P---GAVAAPTAGLHFDTELLGRLRGAGIDMARVTLHVGAGTFQPVRTENLEDHRMHAEY
QUEA_NITOC      P---GAVAAPTAGLHFDKPLLKRLQAQGIRSGYITLHVGAGTFQPVRVKNITQHQMHSEY
QUEA_CUPMC      P---GAVAAPTAGLHFDDALFARLDAAGIRRAFLTLHVGAGTFQPVRTENLSEHKMHSEW
QUEA_CUPPJ      P---GAVAAPTAGLHFDDALFARLDAAGVRRAFLTLHVGAGTFQPVRTENIAEHKMHSEW
QUEA_CUPNH      P---GAVAAPTAGLHFDDALFARLNAAGVRRAFLTLHVGAGTFQPVRTENLAEHKMHSEW
QUEA_RALSO      P---GAVAAPTAGLHFDDALFARLDAMGVRRGFLTLHVGAGTFSPVRVENIAEHRMHSEW
QUEA_BURCA      P---GAVAAPTAGLHFDQPLLDKLDAMGVERATLTLHVGAGTFQPVRVENIAEHKMHSEW
QUEA_BURCH      P---GAVAAPTAGLHFDQPLLDKLDAMGVERATLTLHVGAGTFQPVRVENIAEHKMHSEW
QUEA_BURL3      P---GAVAAPTAGLHFDQPMLDRLDAMGVERATLTLHVGAGTFQPVRVDNIAEHKMHSEW
QUEA_BURVG      P---GAVAAPTAGLHFDQPLLEKLDAMGVERATLTLHVGAGTFQPVRVENIAEHRMHSEW
QUEA_BURCM      P---GAVAAPTAGLHFDLPLLEQLDAMGVERATLTLHVGAGTFQPVRVENIAEHRMHSEW
QUEA_BURP0      P---GAVAAPTAGLHFDDAVLAALEARGVERATLTLHVGAGTFQPVRVENLAEHRMHSES
QUEA_BURP1      P---GAVAAPTAGLHFDDAVLAALEARGVERATLTLHVGAGTFQPVRVENLAEHRMHSES
QUEA_BURP6      P---GAVAAPTAGLHFDDAVLAALEARGVERATLTLHVGAGTFQPVRVENLAEHRMHSES
QUEA_BURPS      P---GAVAAPTAGLHFDDAVLTALEARGVERATLTLHVGAGTFQPVRVENLAEHRMHSES
QUEA_BURMS      P---GAVAAPTAGLHFDDAVLAALEARGVERATLTLHVGAGTFQPVRVENLAEHRMHSES
QUEA_BURM9      P---GAVAAPTAGLHFDDAVLAALEARGVERATLTLHVGAGTFQPVRVENLAEHRMHSES
QUEA_BURM7      P---GAVAAPTAGLHFDDAVLAALEARGVERATLTLHVGAGTFQPVRVENLAEHRMHSES
QUEA_BURMA      P---GAVAAPTAGLHFDDAVLAALEARGVERATLTLHVGAGTFQPVRVENLAEHRMHSES
QUEA_PARXL      P---GAVAAPTAGLHFDEALLARLDAAGVERATLTLHVGAGTFQPVRVENLAEHKMHSEW
QUEA_JANMA      P---GAVAAPTAGLHFDQALLDALTAKGVKLAYITLHVGAGTFQPVRNENLAEHNMHSEW
QUEA_HERAR      P---GAVAAPTAGLHFDQALLDTLKAKGVQFAYVTLHVGAGTFQPVRNENLAEHNMHSEW
QUEA_AZOSB      P---GSVAAPTAGLHFDDAVLDRLRARGAGCAWVTLHVGAGTFQPVRVDDLAQHRMHSER
QUEA_AROAE      R---GSVAAPTAGLHFDQPMLAELAKKGVHGAWLTLHVGAGTFQPVRVNDLGEHRMHRER
QUEA_DECAR      P---GAVAAPTAGLHFDEDMLATLQAQGINTAFLTLHVGAGTYRPMRVEKIADHRMHSER
QUEA_BORPA      P---GAVAAPTAGLHFDQPMLEQLAAQGVQRAFVTLHVGAGTFQPVRVQNLAEHIMHAEW
QUEA_BORBR      P---GAVAAPTAGLHFDQPMLEQLAAQGVQRAFVTLHVGAGTFQPVRVQNLAEHIMHAEW
QUEA_BORPE      P---GAVAAPTAGLHFDQPMLEQLAAQGVQRAFVTLHVGAGTFQPVRVQNLAEHIMHAEW
QUEA_THIDA      P---GAVAAPTAGLHFDAAMLGTLQTQGVRTARVTLHVGAGTFQPVRVAEVADHVMHSER
QUEA_NEIM0      Q---GAVAAPTAGLHFTEELLRRLKDKGAVTAEVTLHVGAGTFQPVRVDKIEEHKMHSEW
QUEA_NEIMA      Q---GAVAAPTAGLHFTEELLRRLKDKGAVTAEVTLHVGAGTFQPVRVDKIEEHKMHSEW
QUEA_NEIMB      Q---GAVAAPTAGLHFTEELLHRLKDKGAVTAEVTLHVGAGTFQPVRVDKIEEHKMHSEW
QUEA_NEIG1      Q---GAVAAPTAGLHFTEELLRRLKDKGAVTAEVTLHVGAGTFQPVRVDKIEEHKMHSEW
QUEA_CHRVO      Q---GAVAAPTAGLHFTDAMLATLQAQGIATAFVTLHVGAGTFQPVKVDNVAEHKMHSEI
QUEA_NITEU      S---GAVAAPTAGLHFDETMLQTLRTLGVKIIYVTLHVGAGTFQPVRVQNIDQHVMHTEP
QUEA_NITEC      T---GAVAAPTAGLHFDETMLTTLQTLGIKIAWVTLHVGAGTFQPVRVENINQHIMHTEQ
QUEA_NITMU      P---GAVAAPTAGLHFDEHMLGLLRKMGVVMAHVTLHVGSGTFQPVRVENIADHRMHSEV
QUEA_POLAQ      P---GAVAAPTAGLHFDEVILQKLKDVGVNQATVTLHVGAGTFTPVREEDLSKHQMHYEW
QUEA_DICNV      A---GAVAAPTAGLHFDQKLLERIAAKGVKRAAITLHVGAGTFQPVRVENLNEHVMHQEW
QUEA_PSYWF      TK-LASVAAPTASLHFDDKVLKQLADKGINTAYVTLHVGAGTFAPVKTDNLLNHTMHSEY
QUEA_PSYA2      AK-LASVAAPTASLHFDDIVLEKLAAKGIQTAFVTLHVGAGTFAPVKTDNLLNHTMHSEY
QUEA_ACIAD      QK-IASVAAPTASLHFDQDLLEKLAAKNIQKTFVTLHVGAGTFMPVRTDDIKNHIMHSEW
QUEA_LEGPL      A---GSVAAPTAGLHFDEAVLSSIRARGVNIAYITLHVGAGTFRPVRCERIQDHKMHSEW
QUEA_LEGPH      A---GSVAAPTAGLHFDDAVLSSIRARGVNIAYVTLHVGAGTFRPVRCERIQDHKMHSEW
QUEA_LEGPA      A---GSVAAPTAGLHFDDAVLSSIRARGVNIAYVTLHVGAGTFRPVRCERIQDHKMHSEW
QUEA_LEGPC      A---GSVAAPTAGLHFDDAVLSSIRARGVNIAYVTLHVGAGTFRPVRCERIQDHKMHSEW
QUEA_COXBU      A---GAVAAPTAGLHFNEETFDALRKKGAAITYVTLHVGAGTFQPVRADSLADHRMHHEW
QUEA_COXBN      A---GAVAAPTAGLHFNEETFDALRKKGAAITYVTLHVGAGTFQPVRADSLADHRMHHEW
QUEA_COXBR      A---GAVAAPTAGLHFNEETFDALRKKGAAITYVTLHVGAGTFQPVRADSLADHRMHHEW
QUEA_BUCAI      T---GSIAAPTAGLHFDLPLLEALHNKGVDIDYITLHIGSGTFQPIRRVQIEEHIMHSES
QUEA_BUCAP      L---GSVAAPTAGLHFDLPLLEALSKKGVDIDFLTLHIGSGTFQPIRTAKIEKHIMHSEL
QUEA_BLOFL      L---GSIAAPTAGLHFDTLLINRLLNLGIEISFITLHIGSATFQPVRVTLIEHHVMHDEY
QUEA_VESOH      D---GAVAAPTAGLHFDDSLLAQLKIQGIDHLFVTLHIGSGTFTPIRTDNIKNHVMHSEI
QUEA_FRATH      L---GSVAALTAGLHFSKELMQQIKDKGVDIAYITLHVGSGTFKPVQVDDVESHKMHAEV
QUEA_FRATO      L---GSVAALTAGLHFSKELMQQIKDKGVDIAYITLHVGSGTFKPVQVDDVESHKMHAEV
QUEA_FRATF      L---GSVAALTAGLHFSKELMQQIKDKGVDIAYITLHVGSGTFKPVQVDDVESHKMHAEV
QUEA_FRATW      L---GSVAAPTAGLHFSKELMQQIKDKGVDIAYITLHVGSGTFKPVQVDDVESHKMHAEV
QUEA_FRATT      L---GSVAAPTAGLHFSKELMQQIKDKGVDIAYITLHVGSGTFKPVQVDDVESHKMHAEV
QUEA_FRAT1      L---GSVAAPTAGLHFSKELMQQIKDKGVDIAYITLHVGSGTFKPVQVDDVESHKMHAEV
QUEA_FRATN      L---GSVAAPTAGLHFSKELMQQIKNKGVDIAYITLHVGSGTFKPVQVDDVESHKMHAEV
QUEA_FRAP2      L---GSVAAPTAGLHFSEELMQQIKAKGTDIAYITLHVGSGTFKPVQVDDVNNHKMHSEV
QUEA_GEOKA      IG---SAAAPTAGLHFTEELLDAIREKGVHIVFITLHVGLGTFRPVQVDDVEKHDMHAEF
QUEA_GEOTN      IG---SAAAPTAGLHFTEELLDAIREKGIHIAFITLHVGLGTFRPVQVDDIEKHNMHAEF
QUEA_BACSU      IG---SAAAPTAGLHFTEEILQQLKDKGVQIEFITLHVGLGTFRPVSADEVEEHNMHAEF
QUEA_BACVZ      IG---SAAAPTAGLHFTEEILDELKQKGVRIEFITLHVGLGTFRPVSADDVEEHNMHAEF
QUEA_BACP2      VG---SAAAPTAGLHFTNELLDALKEKGVHIAFITLHVGLGTFRPVSADRIEEHEMHAEF
QUEA_BACLD      QG---SAAAPTAGLHFTEEILDALREKGVHIAFITLHVGLGTFRPVSAENVEEHDMHAEF
QUEA_BACHD      RG---SAAAPTAGLHFTEELLDQLKQKGVHLAFITLHVGLGTFRPVSVEEIEEHEMHAEF
QUEA_BACHK      IG---SAAAPTAGLHFTEELLEKLKQKGVELAFITLHVGLGTFRPVSADTIEEHHMHAEY
QUEA_BACC1      IG---SAAAPTAGLHFTEELLEKLKQKGVELAFITLHVGLGTFRPVSADTIEEHHMHAEY
QUEA_BACAN      IG---SAAAPTAGLHFTEELLEKLKQKGVELAFITLHVGLGTFRPVSADTIEEHHMHAEY
QUEA_BACCZ      IG---SAAAPTAGLHFTEELLEKLKQKGVELAFITLHVGLGTFRPVSADTIEEHHMHAEY
QUEA_BACCR      IG---SAAAPTAGLHFTEELLEKLKQKGVQLAFITLHVGLGTFRPVSADTIEEHHMHAEY
QUEA_BACCN      IG---SAAAPTAGLHFTEELLEKLQQKGVKLAFITLHVGLGTFRPVSTDKIEDHHMHAEY
QUEA_OCEIH      KG---SAAAPTAGLHFTDKLLEDIKAMGVNIVFVTLHVGLGTFRPVSVDSVEDHDMHSEF
QUEA_LISMO      NG---SAAAPTAGLHFTEDLLEQISAKGVEIIFVTLHVGLGTFRPVDVEDTTNHKMHSEF
QUEA_LISMF      NG---SAAAPTAGLHFTEDLLAKISAKGVEIIFVTLHVGLGTFRPVDVEDTTNHKMHSEF
QUEA_LISIN      NG---SAAAPTAGLHFTEELLAQISAKGVEIIFVTLHVGLGTFRPVDVEDTQNHKMHSEF
QUEA_LISW6      NG---SAAAPTAGLHFTEDLLAQISAKGVEIIFVTLHVGLGTFRPVDVEDTANHKMHSEF
QUEA_BACSK      IG---SAAAPTAGLHFSEQLLLEIEAKGVKIVYITLHVGLGTFRPVSASSVEDHQMHAEY
QUEA_STRT2      NG---SAAAPTAGLHFTPELLQKIEAKGVKLVYLTLHVGLGTFRPVSVDNVDEHEMHSEF
QUEA_STRTD      NG---SAAAPTAGLHFTPELLQKIEAKGVKLVYLTLHVGLGTFRPVSVDNVDEHEMHSEF
QUEA_STRT1      NG---SAAAPTAGLHFTPELLQKIEAKGVKLVYLTLHVGLGTFRPVSVDNIDEHEMHSEF
QUEA_STRA1      NG---SAAAPTAGLHFTKELLEKIETKGVKLVYLTLHVGLGTFRPVSVDNLDEHEMHSEF
QUEA_STRA5      NG---SAAAPTAGLHFTKELLEKIETKGVKLVYLTLHVGLGTFRPVSVDNLDEHEMHSEF
QUEA_STRA3      NG---SAAAPTAGLHFTKELLEKIETKGVKLVYLTLHVGLGTFRPVSVDNLDEHEMHSEF
QUEA_STRP8      NG---SAAAPTAGLHFTTDLLKKIEAKGVHLVYLTLHVGLGTFRPVSVDNLDEHDMHSEF
QUEA_STRPF      NG---SAAAPTAGLHFTTDLLKKIEAKGVHLVYLTLHVGLGTFRPVSVDNLDEHDMHSEF
QUEA_STRP6      NG---SAAAPTAGLHFTTDLLKKIEAKGVHLVYLTLHVGLGTFRPVSVDNLDEHDMHSEF
QUEA_STRPB      NG---SAAAPTAGLHFTTDLLKKIEAKGVHLVYLTLHVGLGTFRPVSVDNLDEHDMHSEF
QUEA_STRPM      NG---SAAAPTAGLHFTTDLLKKIEAKGVHLVYLTLHVGLGTFRPVSVDNLDEHDMHSEF
QUEA_STRPC      NG---SAAAPTAGLHFTTDLLKKIEAKGVHLVYLTLHVGLGTFRPVSVDNLDEHDMHSEF
QUEA_STRPG      NG---SAAAPTAGLHFTTDLLKKIEAKGVHLVYLTLHVGLGTFRPVSVDNLDEHDMHSEF
QUEA_STRP1      NG---SAAAPTAGLHFTTDLLKKIEAKGVHLVYLTLHVGLGTFRPVSVDNLDEHDMHSEF
QUEA_STRP3      NG---SAAAPTAGLHFTTDLLKKIEAKGVHLVYLTLHVGLGTFRPVSVDNLDEHDMHSEF
QUEA_STRPD      NG---SAAAPTAGLHFTTDLLKKIEAKGVHLVYLTLHVGLGTFRPVSVDNLDEHDMHSEF
QUEA_STRMU      NG---SAAAPTAGLHFTEELLSKIEAKGVKLVYLTLHVGLGTFRPVSVDNVEEHQMHSEF
QUEA_STRP2      SG---SAAAPTAGLHFTKELLAEIQAKGVHLVYLTLHVGLGTFRPVSVDNLDEHEMHSEF
QUEA_STRR6      SG---SAAAPTAGLHFTKELLAEIQAKGVHLVYLTLHVGLGTFRPVSVDNLDEHEMHSEF
QUEA_STRPN      SG---SAAAPTAGLHFTKELLAEIQAKGVHLVYLTLHVGLGTFRPVSVDNLDEHEMHSEF
QUEA_STRSV      NG---SAAAPTAGLHFTEELLEQIAAKGVKLVYLTLHVGLGTFRPVSVDSLDDHEMHSEF
QUEA_LACLM      NG---SAAAPTAGLHYTPELLEKIADKGVKIVELTLHVGLGTFRPVSVDNVDEHHMHSEF
QUEA_LACLA      NG---SAAAPTAGLHYTPELLEKIADKGVKIVELTLHVGLGTFRPVSVDNVDEHQMHSEF
QUEA_LACPL      NG---SAAAPTAGLHWTKELLQKVQDKGIKLVYLTLHVGLGTFRPVEEDNIDDHKMHSEF
QUEA_LACBA      NG---SAAAPTAGLHWTQELLDQVAAKGVKLVYITLHVGLGTFRPVEEANIEDHKMHSEF
QUEA_PEDPA      PG---SAAAPTAGLHWTKELLEKVEQKGIKLVYLTLHVGLGTFRPVDEDNIEDHKMHSEF
QUEA_LACSS      PG---SAAAPTAGFHWTEELLQKVQDKGIKLVYLTLHVGLGTFRPVSEDNVEDHKMHSEF
QUEA_ENTFA      NG---SAAAPTAGLHFTKELLEEIKAKGVHLVYLTLHVGLGTFRPVSVDNIEEHHMHSEF
QUEA_STAAM      SG---SAAAPTAGLHFTDELLTEIKNKGVNIAFVTLHVGLGTFRPVSVDDVNDHEMHSEY
QUEA_STAA9      SG---SAAAPTAGLHFTDELLTEIKNKGVNIAFVTLHVGLGTFRPVSVDDVNDHEMHSEY
QUEA_STAA2      SG---SAAAPTAGLHFTDELLTEIKNKGVNIAFVTLHVGLGTFRPVSVDDVNDHEMHSEY
QUEA_STAA1      SG---SAAAPTAGLHFTDELLTEIKNKGVNIAFVTLHVGLGTFRPVSVDDVNDHEMHSEY
QUEA_STAAB      SG---SAAAPTAGLHFTDELLTEIKNKGVNIAFVTLHVGLGTFRPVSVDDVNDHEMHSEY
QUEA_STAAW      SG---SAAAPTAGLHFTDELLTEIKNKGVNIAFVTLHVGLGTFRPVSVDDVNDHEMHSEY
QUEA_STAAN      SG---SAAAPTAGLHFTDELLTEIKNKGVNIAFVTLHVGLGTFRPVSVDDVNDHEMHSEY
QUEA_STAAR      SG---SAAAPTAGLHFTDELLTEIKNKGVNIAFVTLHVGLGTFRPVSVDDVNDHEMHSEY
QUEA_STAAS      SG---SAAAPTAGLHFTDELLTEIKNKGVNIAFVTLHVGLGTFRPVSVDDVNDHEMHSEY
QUEA_STAAE      SG---SAAAPTAGLHFTDELLIEIKNKGVNIAFVTLHVGLGTFRPVSVDDVNDHEMHSEY
QUEA_STAAC      SG---SAAAPTAGLHFTDELLIEIKNKGVNIAFVTLHVGLGTFRPVSVDDVNDHEMHSEY
QUEA_STAA8      SG---SAAAPTAGLHFTDELLIEIKNKGVNIAFVTLHVGLGTFRPVSVDDVNDHEMHSEY
QUEA_STAAT      SG---SAAAPTAGLHFTDELLIEIKNKGVNIAFVTLHVGLGTFRPVSVDDVNDHEMHSEY
QUEA_STAA3      SG---SAAAPTAGLHFTDELLIEIKNKGVNIAFVTLHVGLGTFRPVSVDDVNDHEMHSEY
QUEA_STAHJ      SG---SAAAPTAGLHFTDELLDEIRAKGINIAFITLHVGLGTFRPVSVEDINDHEMHSEY
QUEA_STAES      SG---SAAAPTAGLHFTDDLLNKIKQKGVHIAFITLHVGLGTFRPVSVENIDDHEMHSEY
QUEA_STAEQ      SG---SAAAPTAGLHFTDDLLNKIKQKGVHIAFITLHVGLGTFRPVSVENIDDHEMHSEY
QUEA_STAS1      SG---SAAAPTAGLHFTDELLERIKAQGVNIAFITLHVGLGTFRPVSVDNIDDHEMHSEY
QUEA_CLOBH      EG---SAAAPTAGLHFTEELLKKIEEKGVKLAFLTLHVGLGTFRPVKVEDIQEHVMHSEY
QUEA_CLOB1      EG---SAAAPTAGLHFTEELLKKIEEKGVKLAFLTLHVGLGTFRPVKVEDIQEHVMHSEY
QUEA_CLOBL      EG---SAAAPTAGLHFTEELLKKIEEKGVKLAFLTLHVGLGTFRPVKVEDIQEHVMHSEY
QUEA_CLOTE      SG---SAAAPTAGLHFTEELLNKIKEKGIKIVFLTLHVGLGTFRPVKEGEIENHIMHSEY
QUEA_CLOAB      NG---SAAAPTAGLHFTNELLDKIRAKGIKTVFLTLHVGLGTFRPVKVENIESHHMHSEY
QUEA_CLOK5      EG---SAAAPTAGLHFTEELLRELREKGVNLAFLTLHVGLGTFRPVKVENIEDHAMHSEF
QUEA_CLOPE      KG---SAAAPTAGLHFTEELLKEIKDKGVNIAYLTLHVGLGTFRPVKVDDVNNHVMHSEY
QUEA_CLOP1      KG---SAAAPTAGLHFTEELLKEIKDKGVNIAYLTLHVGLGTFRPVKVDDVNNHVMHSEY
QUEA_CLOPS      KG---SAAAPTAGLHFTEDLLKEIKDKGVNIAYLTLHVGLGTFRPVKVDDVNNHVMHSEY
QUEA_CLOB8      NG---SAAAPTAGLHFTKELLQEIKNKGINIVYLTLHVGLGTFRPVKVESLEEHEMHSEF
QUEA_HUNT2      KG---SAAAPTAGLHFTLELLEELAGRGVKIAYVTLHVGLGTFRPVKVENLEEHKMHSEF
QUEA_CLOD6      NG---SAAAPTAGLHFTEELLNKIKEKGVDIAFVTLHVGLGTFRPVKVEDVLNHKMHSEY
QUEA_LACP7      EG---SAAAPTAGLHFTNELLKQIEDMGVVIANVTLHVGLGTFRPVKEDDILDHHMHSEV
QUEA_ALKMQ      EG---SSAAPTAGLHFTPELLSEIKKKGINVVSITLHVGLGTFRPVKVDSLENHEMHAEY
QUEA_CALS4      EG---SAAAPTAGLHFTEELLDEIRNMGVKTVFITLHVGLGTFRPVKEEIIENHKMHEEF
QUEA_SYMTH      WG---SAAAPTAGLHFTAELLDRLAARGVEIHRITLHVGLGTFRPVEVEDPTQHKMHSEF
QUEA_MOOTA      EG---SAAAPTAGLHFTPRLLKELREQGIEIASILLHVGLGTFRPVKVENIQEHVMHAEY
QUEA_DESHY      SG---SAAAPTAGLHFTPELLERLQDKGVEIVEILLHVGLGTFRPVKVENVEEHTMHSEY
QUEA_DESRM      EG---SAAAPTAGLHFTRELLEEIRNRGVSIVTVLLHVGLGTFRPVQVEDVTSHRMHEEY
QUEA_PELTS      AG---SAAAPTAGLHFSPGLLSRIREMGVAVIPVLLHVGLGTFRPVRTEDIRRHRMHAEY
QUEA_CARHZ      PG---SAAAPTAGLHFTRELISELKDYGVEFAEVLLHVGLGTFKPVKTENILEHKMHEEY
QUEA_FUSNN      GE---SVAAPTAGLHFTEELLNKILDKGVEIVDIFLEVGLGTFRPVQTVNVLEHKMHEES
QUEA_THEMA      EG---SVAAPTAGLHFTPELIEKLKKKGVQFAEVVLHVGIGTFRPVKVEEVEKHKMHEEF
QUEA_THEP1      EG---SVAAPTAGLHFTPELIEKLKKKGVQFAEVVLHVGIGTFRPVKVEEVEKHKMHEEF
QUEA_THEM4      TG---SVAAPTAGLHFTEDLLKKLEEKGVEFADLVLHVGLGTFRPVKVENITEHKMHSES
QUEA_DEHMC      NG---SVAAPTAGLHFTPELLKRLTEMGVICTYVTLHIGLDTFRPVKEEDPKDHKIHREY
QUEA_DEHMB      NG---SVAAPTAGLHFTPELLKRLTEMGVICTYVTLHIGLDTFRPVKEEDPKDHKIHREY
QUEA_DEHM1      NG---SVAAPTAGLHFTPELLERLGDMGVICTYVTLHIGLDTFRPVKEEDPSDHIIHREY
QUEA_FLAJ1      EG---AVAAPTAGLHFSKHLLKKLEIKGVNFAEVTLHVGLGTFNPVEVEDLSKHKMDSEE
QUEA_FLAPJ      EG---AVAAPTAGLHFSKHLMKRLEIKGIQFAEVTLHVGLGTFNPVEVEDLSKHKMDSEE
QUEA_BACFN      EG---AVTAPTASLHFSRELMKRMEIKGIDFAYITLHAGLGNFRDIDVEDLTKHKMDSEQ
QUEA_BACFR      EG---AVTAPTASLHFSRELMKRMEIKGIDFAYITLHAGLGNFRDIDVEDLTKHKMDSEQ
QUEA_BACV8      EG---AVTAPTAGLHFSRELMKRMEIKGIDFAFVTMHAGLGNFREIDVEDLTKHKMDSEQ
QUEA_PARD8      EG---AVVAPAAGLHFSRELMKRLEIKDCQFAFLTLHSGLGNFREIDVEDLTKHKMDSEQ
QUEA_CYTH3      KG---AVAAPTAGLHFTKQVMKRMEIKGVNFAPLTLHVGLGSFRTVDVEDLTKHKMDSEN
QUEA_GEOMG      RG---AVAAPTAGLHFTPELLDELRERGVEIATLTLHVGLGTFMPIRVERVEEHRMHRER
QUEA_GEOSL      RG---AVAAPTAGLHMTAGLLDEIAGRGVRVAPVTLHVGLGTFMPIRVERLEDHRMHRER
QUEA_GEOUR      KG---AVAAPTAGLHFTDALLQKIRQQGVEIAPLTLHVGLGTFMPVRVDDLKDHRMHREY
QUEA_PELCD      AG---AVAAPTAGLHFTDEILDVLRAKGVEIQPLTLHVGLGTFLPMRTDDITEHRMHEEN
QUEA_PELPD      AG---AVAAPTAGLHFTPELLERLAERGVATACLTLHTGPGTFQPLRVERVQDHRIHSER
QUEA_PELLD      AG---SVAAPTASLNMTPELLLRLRDGGVETSSITLHVGLGTFLPIRVDSMEEHVMHREF
QUEA_CHLPM      PG---SVAAPTASLNMTPELLLKLEKGGVATAVMTLHVGLGTFLPIRTETMEEHVMHREF
QUEA_CHLPD      PG---SVAAPTASLNMTGELFDSLRQKGVSIASMTLHVGLGTFLPIRVDHFDEHVMHREF
QUEA_CHLTE      PG---SVAAPTASLNLTDELLDKINAKGVGIAHVTLHVGLGTFLPIRSERFEEHVMHREF
QUEA_CHLCH      SG---SVAAPTASLNMTPELLQRLKNNGVEIAHITLHVGLGTFLPIRTESLEEHVMHRES
QUEA_CAUVC      DG---SVAAPTAGLHFTPQLLERLKAKGVSLHFVTLHVGAGTFLPVKTDEVSEHRMHAEY
QUEA_CAUSK      DG---SVAAPTAGLHFTSDLLERLKAGGVSLHFVTLHVGAGTFLPVKTDVVADHKMHAEF
QUEA_BRUC2      EG---AVAAPTAGLHFTPDLLEKIKARGIEEHFVTLHVGAGTFLPVKADDTGDHKMHAEI
QUEA_BRUSU      EG---AVAAPTAGLHFTPDLLEKIKARGIEEHFVTLHVGAGTFLPVKADDTGDHKMHAEI
QUEA_BRUA2      EG---AVAAPTAGLHFTPDLLEKIKARGIEEHFVTLHVGAGTFLPVKADDTGDHKMHAEI
QUEA_BRUME      EG---AVAAPTAGLHFTPDLLEKIKARGIEEHFVTLHVGAGTFLPVKADDTGDHKMHAEI
QUEA_BRUO2      EG---AVAAPTAGLHFTPDLLEKIKARGIEEHFVTLHVGAGTFLPVKADDTGDHKMHAEI
QUEA_BRUSI      EG---AVAAPTAGLHFTPDLLEKIKARGIEEHFVTLHVGAGTFLPVKADDTGDHKMHAEI
QUEA_BRUAB      EG---AVAAPTAGLHFTPDLLEKIKARGIEEHFVTLHVGAGTFLPVKADDTGDHKMHAEI
QUEA_OCHA4      EG---AVAAPTAGLHFTPDLLEKIKAKGVEEHFVTLHVGAGTFLPVKADDTTDHKMHSEI
QUEA_RHILO      EG---AVAAPTAGLHFTPELFAALDAKGVERHFVTLHVGAGTFLPVKADDTADHKMHAEI
QUEA_CHESB      EG---AVAAPTAGLHFTPDLFSALDTIGVERHFVTLHVGAGTFLPVKAEDTEAHRMHAEW
QUEA_RHIEC      EG---AVAAPTAGLHFTPALFEALDKAGIERHFVTLHVGAGTFLPVKADDTDDHKMHLES
QUEA_RHIL3      EG---AVAAPTAGLHFTPGLFEALDRAGIERHFVTLHVGAGTFLPVKADDTADHKMHLES
QUEA_AGRFC      KG---AVAAPTAGLHFTPDLFEALDSAGIERHFVTLHVGAGTFLPVKSDDTDDHKMHFEI
QUEA_RHIME      EG---AVAAPTAGLHFTDRLFAKLDEGGIERYFVTLHVGAGTFLPVKADDTADHVMHEEI
QUEA_SINMW      EG---AVAAPTAGLHFTDRLFAMLDEAGIERHFVTLHVGAGTFLPVKADDTDDHVMHEEI
QUEA_RHOPS      EG---AVAAPTAGLHFTPELDAALKARGVTLHRLTLHVGAGTFLPVKVDDTAEHKMHAEW
QUEA_RHOPA      EG---AVAAPTAGLHFTAELETALAACGVGLHRITLHVGAGTFLPVKAEDTSEHRMHAEW
QUEA_RHOP5      EG---AVAAPTAGLHFTKALEQALAARGVTLHRVTLHVGAGTFLPVKTEDTAEHKMHAEW
QUEA_NITWN      EG---AVAAPTAGLHFTPEIETALRGRGVGLHRITLHVGAGTFLPVKVDDTAGHRMHSEW
QUEA_BRASO      EG---AVAAPTAGLHFTPALEQRLRARGVGLQRVTLHVGAGTFLPVKVEDTEGHRMHAEW
QUEA_BRASB      EG---AVAAPTAGLHFTPALEQRLRARGVGLQRVTLHVGAGTFLPVKVEDTEGHRMHAEW
QUEA_BRADU      EG---AVAAPTAGLHFTPALEQALRERGVGLNRVTLHVGAGTFLPVKVEDTAGHKMHAEW
QUEA_AZOC5      EG---SVAAPTASLHFTPDLLAKIAARGVSRYTVTLHVGAGTFLPVKAEDTTDHQMHAEW
QUEA_PARL1      PG---AVAAPTAGLHFTPALMAAIEARGVSTVRLTLHVGAGTFLPVTAEDTDTHKMHAER
QUEA_MARMM      EG---SVAAPTAGLHFTPELMAALEARGVEQTRVTLHVGAGTFLPVKSDDTDDHQMHSEW
QUEA_HYPNA      DA--ASVAAPTAGLHFTPRLLAEVEAAGLKRETVRLHVGLGTFKPLEDRHLSENRLHEEW
QUEA_RHORT      DG---AVAAPTAGLHFTPALLAALEARGVSRAMVTLHVGAGTFLPVKVEDTDDHRMHAET
QUEA_SPHWW      KG---AVAAPTAALHFTPRLMEALAAAGIASETLTLHVGAGTFLPVKADDTDDHRMHAEW
QUEA_NOVAD      DG---AVAAPTAALHFTPSLMEALAARGVATETLTLHVGAGTFLPVKADDTQDHQMHAEW
QUEA_SPHAL      DG---AVAAPTAALHFTPELLAALAAAGIATETLTLHVGAGTFLPVKADDTDDHVMHAEW
QUEA_ERYLH      DG---AVAAPTAALHFTSELIAALDERGVARQTLTLHVGAGTFLPVKADDTDDHRMHSEW
QUEA_ZYMMO      EG---AVAAPTASLHFTEELLQRLEEKGVKHTKVTLHVGAGTFLPMKVEDSDDHVMHSEW
QUEA_GLUDA      RG---AVAAPTAGLHFTPDLLAALDAAGVGRCTLTLHVGAGTFLPVRGDSIAAHRMHAER
QUEA_GLUOX      RG---AVAAPTAGLHFTPEVLAALDAKGIQRRTLTLHVGAGTFLPVR-STIAEHKMHAEW
QUEA_ACICJ      EG---AVAAPTAGLHFTETVLAALAARGVGLATVTLHVGAGTFLPVREDQLERHKLHAER
QUEA_RUEST      SG---AVAAPTASLHFDEPLLKALSEKGVTFTYVTLHVGAGTFLPVKVEDVTTHKMHAEW
QUEA_RUEPO      SG---AVAAPTASLHFDDTLLAALAAHGVTFTHVTLHVGAGTFLPVKVEDVTTHKMHAEW
QUEA_ROSDO      SG---AVAAPTASLHFDKALLSELAARGVLFSYVTLHVGAGTFLPVKVEDVTTHKMHAEW
QUEA_JANSC      AG---AVAAPTASLHFDEHLMDALTSRGVDVTFVTLHVGAGTFLPVTVDDVTTHKMHAEW
QUEA_RHOS4      AG---AVAAPTASLHFDRPLLEALAARGVGFTEVTLHVGAGTFLPVKVEDVTTHRMHAEW
QUEA_RHOS1      AG---AVAAPTASLHFDRPLLEALAARSVGFTEVTLHVGAGTFLPVKVEDVTTHRMHAEW
QUEA_RHOS5      AG---AVAAPTASLHFDRPLLEALAANGVAFTEVTLHVGAGTFLPVKVEDVTTHRMHAEW
QUEA_DINSH      KG---AVAAPTASLHFDEALLAALRARGVEFSFVTLHVGAGTFLPVKVDDVTTHKMHSEW
QUEA_THET2      PG---SVAAPTAGLHFTPELLERLREMGVELRFLTLHVGPGTFRPVKGD-PEKHEMHAEP
QUEA_THET8      PG---SVAAPTAGLHFTPELLERLREMGVELRFLTLHVGPGTFRPVKGD-PEKHEMHAEP
QUEA_DEIRA      PG---SVAAPTAGLHFTPELLARLDEMGVERASVTLHVGAGTFKPIQGP-VADHVMHAER
QUEA_RUBXD      PG---SAAAPTAGFHFTGRVLRGVEEAGARIARVVLHVGLGTFAPVREERLEDHRMHREY
QUEA_ANADF      PG---SAAAPTAGLHFTEAILARLAARGVERTAVTLHVGPGTFLPVRGDSVEGHRMHAEQ
QUEA_ANADE      PG---SAAAPTAGLHFTEPLLARLAARGVRRTAVTLHVGPGTFLPIRGDDLDAHRMHGER
QUEA_SORC5      PG---AVAAPTAGLHLSPGLVERLRANGVEIASVTLHVGLGTFQPVTVDDLDLHPMHAEV
QUEA_SYNAS      PG---SIAAPTAGFHFSEALFKTLRELEIVIAPVTLHVGFGTFTPIETEDVEDHVMEVES
QUEA_SOLUE      KG---SVAAPTAGLHFTPEVIERCQAAGADVATVTLHVGLGTFQPLHQEVVEEVKLHTEH
QUEA_DESVV      DRLG-SVAAPTAGLHFTPSLRETLTARGHQWAEVTLYVGYGTFSPVRCADIRDHAMHREY
QUEA_DESVH      DRLG-SVAAPTAGLHFTPSLRETLTARGHQWAEVTLYVGYGTFSPVRCADIRDHAMHREY
QUEA_DESAG      DRLG-SVAAPTAGLHFTPELTASLQEQGFGWAEVTLYVGYGTFSPVRAEDIRTHTMHREY
QUEA_SYNWW      S--G-SVAAPTAGLHFTPDLLKEITLQGINIVRIVLHVGMGTFRPVKNEDIRQHNMHLEY
QUEA_NOSS1      PG---AIAAPTAGLHFTPELLQKLRDRNINQAFITLHVGVGTFRPVEVEDVATHQMHEEW
QUEA_TRIV2      PG---AIAAPTAGLHFTPELLEKLRDRNINQAFITLHVGVGTFRPVEVEDVATHQMHEEW
QUEA_THEEB      PG---AVAAPTAGLHFTPELFSKLADRGIDHCFLTLHVGIGTFRPVEAKDIRHHHLHEEW
QUEA_SYNE7      LG---AVAAPTAGLHFTPELLTTLADMGIATAPVTLHVGIGTFRSVDVEDIRQHEMHSER
QUEA_SYNP6      LG---AVAAPTAGLHFTPELLTTLADMGIATAPVTLHVGIGTFRSVDVEDIRQHEMHSER
QUEA_ACAM1      PG---AVAAPTAGLHFTPELLARLQSEGINQAHLTLHVGIGTFRPVETDDILQHHMHSEW
QUEA_SYNY3      LG---AVAAPTAGLHFTEELFTKLAQQGVQTAKVTLHVGIGTFRPVEAENILDHVMHQEW
QUEA_GLOVI      PG---AVAAPTAGLHFSGELLARLAERGIERATVTLHVGLGTFRPVQSVSVHTHRMHREW
QUEA_SYNSC      PG---AVAAPTAGLHFSDELLAGLQQKGVDLARITLHVGLGTFRPVETEDLTALELHSEW
QUEA_SYNPX      PG---AVAAPTAGLHFSDELLAGLQLKGVELARITLHVGLGTFRPVETNDLTRLELHSEW
QUEA_SYNS9      PG---AVAAPTAGLHFSDELLAALQGKGVGLARITLHVGLGTFRPVETEDLTQLELHSEW
QUEA_SYNS3      PG---AVAAPTAGLHLSDALLAAIAERGVALAHVTLHVGLGTFRPVETEDLSDLTLHSEW
QUEA_SYNPW      PG---AVAAPTAGLHLSDDLLQAIRARGVQMSSVTLHVGLGTFRPVETEDLSELSLHSEW
QUEA_PROMM      PG---AVAAPTAGLHLSDELLEALKQRGVMLTSVTLHVGLGTFRPVETEDLSHLQLHSEW
QUEA_PROM3      PG---AVAAPTAGLHLSDELLEALKQRGVMLTSVTLHVGLGTFRPVETEDLRHLQLHSEW
QUEA_SYNR3      PG---AVAAPTAGLHLSEELLAALTQKGIERASVTLHVGLGTFRPVETEDLSQLELHSEW
QUEA_PROMA      PG---AVAAPTAGLHLSDQFLEALSQQGIKDAKVTLHVGLGTFRPLVEENLANLHLHSEW
QUEA_PROMT      PG---AIAAPTAGLHLSDELIENLKTRGIKIAQITLHVGLGTFRPLEKEDLSQLHLHSEW
QUEA_PROM1      PG---AIAAPTAGLHLSDELIENLKIRGIRIAQITLHVGLGTFRPLEKEDLSQLHLHSEW
QUEA_PROMP      PG---AVAAPTAGLHLSKSLISNLKKKGILVMPITLHVGYGTFKPIDQEDLSNLKLHKEW
QUEA_DESPS      PG---AVAAPTAGLHFTEELLQSLRENGIQFGEVTLHVGYGTFAPVRAENIVEHNIHEEF
QUEA_AQUAE      KG---AVASPTASLHFSEELLEKLKEKGINFAFITLHVSYGTFKPVKVERVEEHRVDPEY
QUEA_NITSB      AG---AVAAPTASLHFTEQMLNSMAKE-FPFHFVTLHVGAGTFKPVEANLITEHAMHSEY
QUEA_ARCB4      YG---AVAAPTASLHFTPELLKNLEEK-YGLNYLTLHVGAGTFKPVDVEDILSHPMHSEY
QUEA_CAMJE      LG---AVAAPTASLHFSETMLENLRKK-HEIYHLTLHVGAGTFKSVECENIQEHKMHSEF
QUEA_SULDN      EG---AVAAPTASLHFTKEQHERVCTK-FTHAYITLHVGSGTFKPVECEKILEHTMHSEY
QUEA_HELPJ      IG---AVAAPTASLHFSQNALEKLLKD-FKHAFLTLHVGAGTFLSVETKDIREHQIHTEV
QUEA_HELPH      IG---AVAAPTASLHFSQNTLEKLLKD-FKHAFLTLHVGAGTFLGVETKDIREHQIHTEI
QUEA_HELPY      MG---AVAAPTASLHFSQNTLEKLLKD-FKHAFLTLHVGAGTFLSVETKDIREHQIHTEV
QUEA_HELAH      IG---AVAAPTASLHFSQNTLENLLKD-FKHTFLTLHVGAGTFASVETKDIREHQIHTEV
QUEA_HELHP      LG---SIAAPTASLHFSKESIESIKAQ-FETCFLTLHIGAGTFMNVESADIRHHLIHKEF
QUEA_RICBR      QG---SVAAPTAGLHFTNDIINKLKAKGVQVAFVTLHVGAGTFMPVKTENINEHKMHTEY
QUEA_RICB8      QG---SVAAPTAGLHFTNDIINKLKAKGVQVAFVTLHVGAGTFMPVKTENINEHKMHTEY
QUEA_RICRS      EG---SVAAPTAGLHFTKDILDKLKAEGIQATFLTLHVGAGTFLPVKTENIHEHKMHTEY
QUEA_RICRO      EG---SVAAPTAGLHFTKDILDKLKAEGIQATFLTLHVGAGTFLPVKTENIHEHKMHTEY
QUEA_RICAH      EG---SVAAPTAGLHFTNDILDKLKTKGIHTAFLTLHVGAGTFLPVKTENIHEHKMHTEY
QUEA_RICFE      EG---SVAAPTAGLHFTKEILDKLKAKGVQIAFVTLHVGAGTFLPVKTENIHEHKIHTEY
QUEA_RICTY      EG---SVAAPTAGLHFTKDILDKLKTKGINTAFVTLHVGAGTFLPVKTENIHKHKMHTEY
QUEA_RICCK      EG---SVAAPTAGLHFTNDILNKLKAKNIQTTFLTLHVGAGTFLPVKTENIHEHKMHTEY
QUEA_BORBP      VG---SAASATAGLHFSRDLFSTFEKNNIEYDFITLHVGLGTFLPVRSKKVEEHNMHFET
QUEA_BORAP      VG---SAASATAGLHFSRDLFSAFEKNNIEYDFITLHVGLGTFLPVRSKKVEEHNMHFET
QUEA_BORBU      VG---STASATAGLHFSRDLFSAFENNNIEYDFITLHVGAGTFLPVRSKKVEEHNMHFET
QUEA_TREDE      YG---SIAAPTAGLHFTQEVLSKIRDKGIDIEYVTLHVGLGTFLPVRAEKIEDHKMHTEH
                     : .: :*.::                  : :  .  .:  :         :  * 

QUEA_SHISS      AEVPQDVVDAVLAAKARGNRVIAVGTTSVRSLESAAQAAKND---------LIEPFFDDT
QUEA_ECOHS      AEVPQDVVDAVLAAKARGNRVIAVGTTSVRSLESAAQAAKND---------LIEPFFDDT
QUEA_SHIFL      AEVPQDVVDAVLAAKARGNRVIAVGTTSVRSLESAAQAAKND---------LIEPFFDDT
QUEA_SHIDS      AEVPQDVVDAVLAAKARGNRVIAVGTTSVRSLESAAQAAKND---------LIEPFFDDT
QUEA_ECO57      AEVPQDVVDAVLAAKARGNRVIAVGTTSVRSLESAAQAAKND---------LIEPFFDDT
QUEA_ECO24      AEVPQDVVDAVLAAKARGNRVIAVGTTSVRSLESAAQAAKND---------LIEPFFDDT
QUEA_SHIF8      AEVPQDVVDAVLAAKARGNRVIAVGTTSVRSLESAAQAAKND---------LIEPFFDDT
QUEA_ECOLI      AEVPQDVVDAVLAAKARGNRVIAVGTTSVRSLESAAQAAKND---------LIEPFFDDT
QUEA_ECOLC      AEVPQDVVDAVLAAKARGNRVIAVGTTSVRSLESAAQAAKND---------LIEPFFDDT
QUEA_ECOL5      AEVPQDVVDAVLAAKARGNRVIAVGTTSVRSLESAAQAAKND---------LIEPFFDDT
QUEA_ECOL6      AEVPQDVVDAVLAAKARGNRVIAVGTTSVRSLESAAQAAKND---------LIEPLFDDT
QUEA_SHIBS      AEVPQDVVDAVLAAKARGNRVIAVGTTSVRSLESAAQAAKND---------LIEPFFDDT
QUEA_ECOK1      AEVPQDVVEAVLAAKARGNRVIAVGTTSVRSLESAAQAAKND---------LIEPFFDDT
QUEA_ECOUT      AEVPQDVVDAVLAAKARGNRVIAVGTTSVRSLESAAQAAKND---------LIEPFFDDT
QUEA_SALPB      AEVPQEVVDAVLAAKARGNRVIAVGTTSVRSLESAAQAAKSD---------LIEPFFGDT
QUEA_SALTY      AEVPQEVVDAVLAAKARGNRVIAVGTTSVRSLESAAQAAKSD---------LIEPFFGDT
QUEA_SALCH      AEVPQEVVDAVLAAKARGNRVIAVGTTSVRSLESAAQAAKSD---------LIEPFFGDT
QUEA_SALPA      AEVPQEVVDAVLAAKARGNRVIAVGTTSVRSLESAAQAAKSD---------LIEPFFGDT
QUEA_SALTI      AEVPQEVVDAVLAAKARGNRVIAVGTTSVRSLESAAQAAKSD---------LIEPFFGDT
QUEA_SALAR      AEVPQEVVDAVLAAKARGNRVIAVGTTSVRSLESAAQAAKSD---------LIEPFFGDT
QUEA_CITK8      AEVPQEVVDAVLAAKARGNRIIAVGTTSVRSLESAAQAAKND---------LIEPFFGDT
QUEA_ENT38      AEVPQDVVDAVLAAKARGNRVIAVGTTSVRSLESAAQAAKKD---------LIEPFFGDT
QUEA_KLEP7      AEVPQEVVDAVLAAKARGNRVIAVGTTSVRSLESAAQAAKDA---------LIAPFFDDT
QUEA_CROS8      AEVPQEVVDAVLAAKARGNKVVAVGTTSVRSLESAAQAAQDA---------LIAPFFGDT
QUEA_YERPE      AEVPQEVVDAVLACKARGKRVVAVGTTSVRSLESAAKAAENG---------LIAPFFGDT
QUEA_YERPS      AEVPQEVVDAVLACKARGKRVVAVGTTSVRSLESAAKAAENG---------LIAPFFGDT
QUEA_YERP3      AEVPQEVVDAVLACKARGKRVVAVGTTSVRSLESAAKAAENG---------LIAPFFGDT
QUEA_YERE8      AEVPQEVVDAVLACKARGNRVVAVGTTSVRSLESAAKSSDNG---------LIAPFFGDT
QUEA_SERP5      AEVPQEVVDAVLACKARGKRVVAVGTTSVRSLESAANASKEA---------LIAPFFDDT
QUEA_PECAS      AEVPQDVVDAVLACKARGNRVIAVGTTSVRSLESAAQASQDA---------PIAPFFGDT
QUEA_PHOLL      AEVPQDVVDAVLACKARGNKVVAVGTTSVRSLESAAKACQDE---------LIAPFFNDT
QUEA_SODGM      AEVPQEVVDAVLACKARGNRVVAVGTTAVRSLESAA-AAGEQ---------ALTPFFGDT
QUEA_BAUCH      TEVPHTVVDAVIACKSRGNRVVAVGTTSVRSLESAIVSVSNSK------HTMLAPFCGET
QUEA_VIBCH      VEVPQEVVDAITATKARGGRVVAVGTTSVRSLESAAQDAL--Q-----KGTELKPFFGDT
QUEA_VIBC3      VEVPQEVVDAIAATKARGGRVVAVGTTSVRSLESAAQDAL--Q-----KGTELKPFFGDT
QUEA_VIBPA      VEVPQEVVDAINATKARGGRIIAVGTTSVRSLESAAQDAL--K-----KGTELVPFFGDT
QUEA_VIBCB      VEVPQDVVDAINATKARGGRVVAVGTTSVRSLESAAQDAL--K-----KGTELVPFFGDT
QUEA_VIBVU      AEVPQEVVDAINATKARGGRVIAVGTTSVRSLESAAQESL--K-----NGTELMPFFGDT
QUEA_VIBVY      AEVPQEVVDAIKATKARGGRVIAVGTTSVRSLESAAQESL--K-----NGTELMPFFGDT
QUEA_ALIF1      AEVSQEVIDAINATKARGGRVVSVGTTSVRSLESAAQHAL--K-----QGTELAPFFDDT
QUEA_PHOPR      VEVPQDVVDAVNATKANGGRIIAVGTTSVRSLESAAQDAV--K-----KGTELVPFFGDT
QUEA_AERHH      AEVPQEVVDAIAATRARGGRVIAVGTTSVRSLESAAKVTL--A-----QGKPLAPFFSDT
QUEA_AERS4      AEVPQEVVDAIAATRARGGRVIAVGTTSVRSLESAAKASL--A-----LSKPLAPFFSDT
QUEA_COLP3      VEVSDEVVAQIAKTKAAGGRVVAVGTTSVRSLESAAKAAL--D-----KNKPLSAFYGDT
QUEA_PSEA6      AEVPQNVVDAIAKTKTAGKRVIAVGTTSVRSLESAAKAAL--E-----NGTALASFFSDT
QUEA_SHEPA      AEVPQTVVDLIGETKARGNRVIAVGTTSVRSLESAAKAS----------QGVLQSFSGDT
QUEA_SHEHH      AEVPQNVVDLIAETKTRGNRVIAVGTTSVRSLESAAKAS----------PEQLEAFSGDT
QUEA_SHELP      AEVPQDVVDSIKATKAAGNRVIAVGTTSVRSLESAAKAS----------EGELQAYSNDT
QUEA_SHESM      ANVPQDVVDLIAQTKAAGKRVVAVGTTSVRSLESAARAS----------EGELKAFSGDT
QUEA_SHESA      ANVPQDVVDLIAQTKAAGKRVVAVGTTSVRSLESAARAS----------EGELKAFSGDT
QUEA_SHESR      ANVPQDVVDLIVQTKAAGKRVVAVGTTSVRSLESAARAS----------EGELKAFSGDT
QUEA_SHEON      ANVPQDVVDLIARTKAAGNRVVAVGTTSVRSLESAARAS----------AGQLNAFSGDT
QUEA_SHESW      ANVPQDVVDLIAQTKAAGKRVVAVGTTSVRSLESAARAS----------LGELKAFSGDT
QUEA_SHEPC      ANVPQDVVDLIAQTKAAGKRVVAVGTTSVRSLESAARAS----------LGELKAFSGDT
QUEA_SHEB8      ANVPQDVVDLIAQTKAAGKRVVAVGTTSVRSLESAARAS----------QGELKAFSGDT
QUEA_SHEB9      ANVPQDVVDLIAQTKAAGKRVVAVGTTSVRSLESAARAS----------QGELKAFSGDT
QUEA_SHEB5      ANVPQDVVDLIAQTKAAGKRVVAVGTTSVRSLESAARAS----------QGELKAFSGDT
QUEA_SHEFN      ANVSQEVVDLIAQTKAAGNRVVAVGTTSVRSLESAARASG---------DSPLEAFSGDT
QUEA_SHEDO      ADVPQDVVDLIAQTKAAGNRVIAVGTTSVRSLESAAKACG---------DKPLATFSGDT
QUEA_SHEAM      AEVPADVVEKIRATKAAGKRVIAVGTTSVRSLESAAKAS----------EGELEPFCGDT
QUEA_PSEHT      IEVPDDVVAAVANTKANGGRVIAIGTTSVRSLESAAKVH----------GGKLDTYFGDT
QUEA_HAEIG      VEVSQEVCNAIIATKKAGKRVIAVGTTSVRSIESAALSAEEFG-----NPDLIEPYFSDT
QUEA_HAEIE      VEVSQEVCNAIIATKKAGKRVIAVGTTSVRSIESAALSAEEFG-----NPDLIEPYFSDT
QUEA_HAEI8      VEVSQEVCNAIIATKKAGKRVIAVGTTSVRSIESAALSAEEFG-----NPDLIEPYFSDT
QUEA_HAEIN      VEVSQEVCNAIIATKKAGKRVIAVGTTSVRSIESAALSAEEFG-----NPDLIEPYFSDT
QUEA_HAES1      VEVPQEVVDAVLATKAKGKRVIAVGTTSVRSIESAALFAEENN-----STHLLEPYFSDT
QUEA_HISS2      VEVPQEVVDAVLATKAKGKRVIAVGTTSVRSIESAALFAEENN-----STHLLEPYFSDT
QUEA_PASMU      VEVPQEVCDAIIATKQAGKRVIAVGTTSVRSVESAALATEEKG-----EHALITPYFSDT
QUEA_MANSM      VEVPQQVVDAIVATKAAGKRVIAVGTTSVRSVESAALAAQEKG-----FAQIIEPFFADT
QUEA_HAEDU      AEVTQAVVDQILATKAAGKRVIAVGTTSVRSIESAAQATQPTG-------KLIAPFFSDT
QUEA_ACTP2      AEVSQAVVDQILATKATGKRVIAVGTTSVRSIESAAQAAEKEG-------KLITPFFSDT
QUEA_MARMS      VEVEPSVVEQVKAAKARGGRVIAVGTTSVRSLESASQSG------------EIAPMQGDT
QUEA_PSEAB      LEVGQDVVDAVSACRARGGRVVAVGTTSVRSLESAARDGE------------LKPFSGDT
QUEA_PSEAE      LEVGQDVVDAVSVCRARGGRVVAVGTTSVRSLESAARDGE------------LKPFSGDT
QUEA_PSEA7      LEVGQDVVDAVAACRARGGRVVAVGTTSVRSLESAARDGE------------LKPFSGDT
QUEA_PSEMY      LEVSQEVVDAVAACRARGGRVVAVGTTSVRSLETAAQSSE------------LKPFSGDT
QUEA_PSEP1      LEVGQDVVDAIEACRARGGRVIAVGTTSVRSLESAARDGV------------LKAFSGDT
QUEA_PSEPK      LEVGQDVVDAIEACRARGGRVIAVGTTSVRSLESAARDGV------------LKAFSGDT
QUEA_PSEPG      LEVGQDVVDAIEACRARGGRVVAVGTTSVRSLESAARDGV------------LKAFSGDT
QUEA_PSEE4      LEVSQDVVDAVAACRARGGRVIAVGTTSVRSLESAARDGV------------LKAFSGDT
QUEA_PSEU2      LEVGQDVVDAVAACRARGGRVIAVGTTSVRSLESAARDGE------------LKSFSGDT
QUEA_PSE14      LEVGQDVVDAVAACRARGGRVIAVGTTSVRSLESAARDGE------------LKSFSGDT
QUEA_PSESM      LEVSQDVVDAVAACRARGGRVIAVGTTSVRSLESAARDGQ------------LKPFSGDT
QUEA_PSEF5      LEVGQDVVDAVAACRARGGRVVAVGTTSVRSLESAARDGV------------LKPFSGDT
QUEA_PSEPF      LEVGQDVVDAVAACRERGGRVIAVGTTSVRSLESAARDGV------------LKPFSGDT
QUEA_SACD2      MHVSQEVCDLIKATKAAGKRVIAVGTTSVRCLETAAQNGV------------VEPYQGDT
QUEA_MARHV      AHVPEETVKAVNEARARGGRVVAVGTTSVRSLESASRAGR------------LQEFRGDT
QUEA_IDILO      AKVSAETCNAIKQTKASGGRVIAVGTTSVRSLESAAQASTNE---------SIEPFFDDT
QUEA_CHRSD      LEVDETLCRQVEATRARGGRVIAVGTTSVRCLETASQGQE---------DGHIAPFRGDT
QUEA_ALKEH      LDVPPATCAAIERARGRGGRVVAVGTTVVRALETAAQ------------DGAVQPYQGET
QUEA_HAHCH      LEVSADVCERVRQVKAAGGRVVAVGTTAVRALETASR------------SGSIEPYAGDT
QUEA_ALCBS      YQIPGSLVEQVAQAHARGGRVVAVGTTALRALEAASQ------------SGGLHAGQGET
QUEA_HYDCU      IEVLPETVELIKQTRQKGGRVIAVGTTSVRCLESAASFSENG---------ELAPYQGET
QUEA_XYLFT      FKVGAELVEQVRSARARGGRVIAVGTTVVRSLESAMR------------HGELQPFVGET
QUEA_XYLFA      FKVGAELVEQVRSARARGGRVIAVGTTVVRSLESAMR------------HGELQPFVGET
QUEA_XANAC      LNVGAALVEQVRRTRARGGRVIAVGTTVVRSLESAWRKTEAAP------EGELQPFAGET
QUEA_XANC5      LNVGATLVEQVRRTRARGGRVIAVGTTVVRSLESAWRKTEAAP------EGELQPFAGET
QUEA_XANOR      LNVGAALVEQVRRTRARGGRVIAVGTTVVRSLESAWRTTDAAP------EGELQPFAGET
QUEA_XANCP      LNVGAALVEQVRRTRARGGRVIAVGTTVVRSLESAWRKTDDAP------HGELQSFAGET
QUEA_XANC8      LNVGAALVEQVRRTRARGGRVIAVGTTVVRSLESAWRKTDDAP------HGELQSFAGET
QUEA_METCA      CEVGPEVVKAVERARGRGGRVVAVGTTSMRSLETAAS------------GGSLRTFSGET
QUEA_NITOC      VEVSEQICAQIRDTQQAGGRVVAVGTTTVRALEAASA------------KGVIAPYQGET
QUEA_CUPMC      YAISPELADAVRETRARGGRVIAVGTTSLRALESAAA--------EDGT---LEAGSGDT
QUEA_CUPPJ      YAISPELADAVRETRKRGGRVIAVGTTSLRALESAAK--------PDGT---LEAGNGDT
QUEA_CUPNH      YAVSADLAQAVRDTRARGGRVIAVGTTSLRALESAAQ--------ADGT---LAAGSGDT
QUEA_RALSO      YAISPDLAEAIRATRAVGGRIVAVGTTSMRALESAAQ--------PDGT---LAAGSGET
QUEA_BURCA      YDLPQSLVDKIAATRARGGNVIAVGTTSMRALEAAARSAD----EAGRP---LAATQAET
QUEA_BURCH      YDLPQSLVDKIAATRARGGNVIAVGTTSMRALEAAARSAD----EAGRP---LAATQAET
QUEA_BURL3      YDLPQSLVDKIAATRARGGNVIAVGTTSMRALEAAARAAD----EAGRP---LAATQAET
QUEA_BURVG      YDLPQSLVDKIAATRARGGNVIAVGTTSMRALEAAARSAE----AAGRP---LAATQDET
QUEA_BURCM      YDLPQSLVDKIAATRARGGNVIAVGTTSMRALEAAARSAD----EAGRP---LAATQAET
QUEA_BURP0      YELTDALVEKIAATRARGGRVIAVGTTSMRALEAAARDAQ----AAGRP---LAATRAET
QUEA_BURP1      YELTDALVEKIAATRARGGRVIAVGTTSMRALEAAARDAQ----AAGRP---LAATRAET
QUEA_BURP6      YELTDALVEKIAATRARGGRVIAVGTTSMRALEAAARDAQ----AAGRP---LAATRAET
QUEA_BURPS      YELTDALVEKIAATRARGGRVIAVGTTSMRALEAAARDAQ----AAGRP---LAATRAET
QUEA_BURMS      YELTDALVEKIAATRARGGRVIAVGTTSMRALEAAARDAQ----AAGRP---LAATRAET
QUEA_BURM9      YELTDALVEKIAATRARGGRVIAVGTTSMRALEAAARDAQ----AAGRP---LAATRAET
QUEA_BURM7      YELTDALVEKIAATRARGGRVIAVGTTSMRALEAAARDAQ----AAGRP---LAATRAET
QUEA_BURMA      YELTDALVEKIAATRARGGRVIAVGTTSMRALEAAARDAQ----AAGRP---LAATRAET
QUEA_PARXL      YHLPQSLADKIAATRARGNRVIAVGTTSMRALEAAARDAE----AAGRP---LAAASTET
QUEA_JANMA      YTISQQTVDLVKATQVAGGNIVAVGTTSMRALESASQ---------SGS---LQAGSADT
QUEA_HERAR      YTISQETVGAVHAAQAAGHNIVAVGTTSMRALESASQ---------SGS---LQAGSADT
QUEA_AZOSB      YVIPQETVEAIARTRANGGRVVAVGTTSMRALEAAAQ---------AGP---LAAGSGET
QUEA_AROAE      YVIPQETVAAIAATRAAGRRVIAVGTTSLRALEGAAQ---------DGP---LEAGTGET
QUEA_DECAR      FEIPPATADAITTTRAAGGQVIAVGTTSLRALESAGN--------EDGT---VQVGGAET
QUEA_BORPA      YTVPEATVAAIARARAHGGRIVAVGTTSVRALESAAAQA------QDGP---LAAAQGDT
QUEA_BORBR      YTVPEATVAAIARARAHGGRIVAVGTTSVRALESAAAQA------QDGP---LAAAQGDT
QUEA_BORPE      YTVPEATVAAIARARAHGGRIVAVGTTSVRALESAAAQA------QDGP---LAAAQGDT
QUEA_THIDA      YTVPAATVAAIAETRARGGRVVAVGTTSLRALEAASA---------SGS---VEAGVGET
QUEA_NEIM0      FEVPSETAAAVEAAKARGNKVWAVGTTSMRALESAARA--------TGR---LKAGQGDT
QUEA_NEIMA      FEVPSETAAAVEAAKARGNKVWAVGTTSMRALESAARA--------TGR---LKAGQGDT
QUEA_NEIMB      FEVPSETAAAVEAAKARGNKVWAVGTTSMRALESAARA--------TGR---LKAGQGDT
QUEA_NEIG1      FEVPSETVAAVEAAKARGNKAWAVGTTSMRALESAARA--------TGY---LKDGQGDT
QUEA_CHRVO      YDIPQATVDAIAAARARGGRVVAVGTTSVRALESAAR---------HGE---LKAGRGET
QUEA_NITEU      YHIPTETVEAIQMCKSAGGSVLAVGTTSLRALESCMLTN-------DGT---LVAGAGET
QUEA_NITEC      YHIPTETIEIIRRCKAGGGSVLAVGTTSLRALEASALIG-------DGE---LVAGSNET
QUEA_NITMU      FYVSAETVECIRHAKAEGGRVLAVGTTSLRALEAAAAFAGERAEADNGDGVRIKCGAGET
QUEA_POLAQ      FSIPKETLQAIEKTKKNGGRIIAVGTTSLRALESQANSQQ---------------SSGET
QUEA_DICNV      FSLSQEVVDAVAACRAQNGRVIAIGTTALRALESAAIGSGK-----------VGVFQGDT
QUEA_PSYWF      ANLPQATADLINQTHQNGNKVIAIGTTVTRVLETAYQKTADE-------HGHISTWSGDT
QUEA_PSYA2      AHLPQATAELINQTHANGKQVIAIGTTVTRVLETAYQQTAVD-------GQSLSGWSGDT
QUEA_ACIAD      CDVPESTAELIRQTKARGNKVIAVGTTATRALESAAQAN----------GGKIDAWTGDT
QUEA_LEGPL      FTVSPDLCTAVKAAKSMGNRVIAVGTTALRSLESAAMGGE------------LIPCSRDT
QUEA_LEGPH      FTVSPDLCTAVKAAKSMGNRVIAVGTTALRSLESAAMGGE------------LIPCSRDT
QUEA_LEGPA      FTVSPDLCAAVKAAKSMGNRVIAVGTTALRSLESAAMGGE------------LIPCSRDT
QUEA_LEGPC      FTVSPDLCAAVKAAKSMGNRVIAVGTTALRSLESAAMGGE------------LIPCSRDT
QUEA_COXBU      MEVSKAVCDAIAKCRKNNGRVIAVGTTVMRCLETATKNGE------------CRPYAGET
QUEA_COXBN      MEVSKAVCDAIAKCRKNNGRVIAVGTTVMRCLETATKNGE------------CRPYAGET
QUEA_COXBR      MEVSKAVCDAIAKCRKNNGRVIAVGTTVMRCLETATKNSE------------CRPYAGET
QUEA_BUCAI      VEVSSSVIQKIKSCKKKGGRIIAVGTSTLRALESA-YHSSEW--------SDSQDFISDT
QUEA_BUCAP      VEVSSNLIQKIKLCKKKGGRIIAVGTTTLRALESA-YHSNSW--------NNKKNYVKDT
QUEA_BLOFL      IEVSQSTIESILRCKERKNRVIAVGTTVVKALETAAMNTKSL--------SIIESFSGYS
QUEA_VESOH      FEISQVTVDRINLTKANGGRIIAVGTTTVRVLESSLKNGKLI--------AQN----GET
QUEA_FRATH      ISVPVEVCQKIRQTKENGGRVITIGTTSVRSLETAGQNGQ------------IEPYQGET
QUEA_FRATO      ISVPVEVCQKIRQTKENGGRVITIGTTSVRSLETAGQNGQ------------IEPYQGET
QUEA_FRATF      ISVPVEVCQKIRQTKENGGRVITIGTTSVRSLETAGQNGQ------------IEPYQGET
QUEA_FRATW      ISVPVEVCQKIRQTKENGGRVIAIGTTSVRSLETAGQNGQ------------IEPYQGET
QUEA_FRATT      ISVPVEVCQKIRQTKENGGRVIAIGTTSVRSLETAGQNGQ------------IEPYQGET
QUEA_FRAT1      ISVPVEVCQKIRQTKENGGRVIAIGTTSVRSLETAGQNGQ------------IEPYQGET
QUEA_FRATN      ISVPVEVCQKIRQTKENGGRVIAIGTTSVRSLETAGQNGQ------------IEPYQGET
QUEA_FRAP2      ISVSEDVCEKIRQTKANGGRVIAIGTTSVRSLETAGQSGE------------IQPYQGET
QUEA_GEOKA      YQMSEETAETLNRVREQGGRIIAVGTTSTRTLETIAG--KHNG--------RFVAESGWT
QUEA_GEOTN      YQMSEETAAILNRVRANGGRIIAVGTTSTRTLETIAN--RHDG--------RFAAESGWT
QUEA_BACSU      YQMSEETAAALNKVRENGGRIISVGTTSTRTLETIAG--EHDG--------QFKASSGWT
QUEA_BACVZ      YEMTEETAASLNEVRKAGGRIVSVGTTSTRTLETIAG--EHDG--------EFTASSGWT
QUEA_BACP2      YEMNEETAAELNRVRKEGGRIISVGTTSTRTLETIAS--AHDG--------EFKASSGWT
QUEA_BACLD      YEMSEETAALLNRVRQEGGRIISVGTTSTRTLETIAS--EHDG--------RFREASGWT
QUEA_BACHD      YQMSAGTARLLNEVKRQGGRIIAVGTTSARTLETIRQ--EHD---------EFVETSGWT
QUEA_BACHK      YHMSEETAALLNRVKENGGRIITVGTTSTRTLETIAT--DHDG--------KLCAASGWT
QUEA_BACC1      YHMSEETAALLNRVKENGGRIITVGTTSTRTLETIAT--DHDG--------KLCAASGWT
QUEA_BACAN      YHMSEETAALLNRVKENGGRIITVGTTSTRTLETIAT--DHDG--------KLCAASGWT
QUEA_BACCZ      YHMSEETAALLNRVKENGGRIITVGTTSTRTLETIAT--DHDG--------KLCAASGWT
QUEA_BACCR      YHMSEETAALLNRVKQNGGRIITVGTTSTRTLETIAT--DHDG--------KLCAASGWT
QUEA_BACCN      YHMSQETADLLNDVKVNGGRIITVGTTSTRTLETIAT--EHDG--------KLCGASGWT
QUEA_OCEIH      YSMSESAAKTLNEAKAAGRRIISVGTTSTRTLETIVR--DHDG--------KFVATRGWT
QUEA_LISMO      YRLTEESAERINKIKAQGGKVVAVGTTSIRTLETIAS--RHDG--------KLVAESGWT
QUEA_LISMF      YRLTEESAERINKIKAQGGKVVAVGTTSIRTLETIAS--RHDG--------KLVAESGWT
QUEA_LISIN      YRLTEESADRINKIKSAGGKVVAVGTTSIRTLETIAS--RHDG--------KLIAESGWT
QUEA_LISW6      YRLTEDAANRINKIKATGGKVVAVGTTSIRTLETIAS--HNEG--------KLVAESGWT
QUEA_BACSK      YQVTEEAAHTLASARENGGNIIAVGTTSARTLETIYS--DHG---------AFVAASGWT
QUEA_STRT2      YTLSQEAADTLNSVKAAGGRIVAVGTTSIRTLETIGN--KYDG--------QLQADSGWT
QUEA_STRTD      YTLSQEAADTLNSVKAAGGRIVAVGTTSIRTLETIGN--KYDG--------QLQADSGWT
QUEA_STRT1      YTLSQEAADTLNSVKTAGGRIVAVGTTSIRTLETIGN--KYDG--------QLQADSGWT
QUEA_STRA1      YQLSKEAADTLNAVKESGGRIVAVGTTSIRTLETIGS--KFNG--------ELKADSGWT
QUEA_STRA5      YQLSKEAADTLNAVKESGGRIVAVGTTSIRTLETIGS--KFNG--------ELKADSGWT
QUEA_STRA3      YQLSKEAADTLNAVKESGGRIVAVGTTSIRTLETIGS--KFNG--------ELKADSGWT
QUEA_STRP8      YSLSEEAAQTLRDVKQAGGRVVAVGTTSIRTLETIGS--KFQG--------DIQADSGWT
QUEA_STRPF      YSLSEEAAQTLRDVKQAGGRVVAVGTTSIRTLETIGS--KFQG--------DIQADSGWT
QUEA_STRP6      YSLSEEAAQTLRDVKQAGGRVVAVGTTSIRTLETIGS--KFQG--------DIQADSGWT
QUEA_STRPB      YSLSEEAAQTLRDVKQAGGRVVAVGTTSIRTLETIGG--KFQG--------DIQADSGWT
QUEA_STRPM      YSLSEEAAQTLRDVKQAGGRVVAVGTTSIRTLETIGG--KFQG--------DIQADSGWT
QUEA_STRPC      YSLSEEAAQTLRDVKQAGGRVVAVGTTSIRTLETIGG--KFQG--------DIQADSGWT
QUEA_STRPG      YSLSEEAAQTLRDVKQAGGRVVAVGTTSIRTLETIGG--KFQG--------DIQADSGWT
QUEA_STRP1      YSLSEEAAQTLRDVKQAGGRVVAVGTTSIRTLETIGG--KFQG--------DIQADSGWT
QUEA_STRP3      YSLSEEAAQTLRDVKQAGGRVVAVGTTSIRTLETIGS--KFQG--------DIQADSGWT
QUEA_STRPD      YSLSEEAAQTLRDVKQAGGRVVAVGTTSIRTLETIGS--KFQG--------DIQADSGWT
QUEA_STRMU      YSLSPEAAQTLKDVKANGGRIVAVGTTSIRTLETIGN--KFAG--------QIEADSGWT
QUEA_STRP2      YQLSEEAAATLRSVKENGGRVIAVGTTSIRTLETIGS--KFDG--------QIQADSGWT
QUEA_STRR6      YQLSEEAAATLRSVKENGGRVIAVGTTSIRTLETIGS--KFDG--------QIQADSGWT
QUEA_STRPN      YQLSEEAAATLRSVKKNGGRVIAVGTTSIRTLETIGS--KFDG--------QIQADSGWT
QUEA_STRSV      YSLSEEAAQTLRQVKANGGRVIAVGTTSIRTLETIGS--KFQG--------QIQADSGWT
QUEA_LACLM      YRLTEEAAAQLRAVKASGHKIFASGTTSIRTLETIGS--KFDG--------DIQADSGWT
QUEA_LACLA      YRLTEEAAAQLRAVKASGHKIVASGTTSIRTLETIGS--KFDG--------DIQADSGWT
QUEA_LACPL      YRLDEDAAKTLNEVRQNGGRIIATGTTSIRTLETIGS--KFDG--------EIKPDSGWT
QUEA_LACBA      YRLDEAAAATLNEVRANGGRIIATGTTSIRTLETIGT--KFKG--------EIKPDSGWT
QUEA_PEDPA      YQLSEESAAALNEVKKQGGRIVATGTTSIRTLETIGS--KFNG--------EIKADSGWT
QUEA_LACSS      YRLTEEAAATLNEVKQNGGRIVATGTTSIRTLETIAT--KFDG--------EIKADSGWT
QUEA_ENTFA      YRLTEEAAKQLNEVRQAGGRIVAVGTTSIRTLETIGT--KFNG--------EIQADSGWT
QUEA_STAAM      YQMTQETADLLNDTKSKGHRIISVGTTSTRTLETIRR--DHD---------KFVETSGWT
QUEA_STAA9      YQMTQETADLLNDTKSKGHRIISVGTTSTRTLETIRR--DHD---------KFVETSGWT
QUEA_STAA2      YQMTQETADLLNDTKSKGHRIISVGTTSTRTLETIRR--DHD---------KFVETSGWT
QUEA_STAA1      YQMTQETADLLNDTKSKGHRIISVGTTSTRTLETIRR--DHD---------KFVETSGWT
QUEA_STAAB      YQMTQETADLLNDTKSKGHRIISVGTTSTRTLETIRR--DHD---------KFVETSGWT
QUEA_STAAW      YQMTQETADLLNDTKSKGHRIISVGTTSTRTLETIRR--DHD---------KFVETSGWT
QUEA_STAAN      YQMTQETADLLNDTKSKGHRIISVGTTSTRTLETIRR--DHD---------KFVETSGWT
QUEA_STAAR      YQMTQETADLLNDTKSKGHRIISVGTTSTRTLETIRR--DHD---------KFVETSGWT
QUEA_STAAS      YQMTQETADLLNDTKSKGHRIISVGTTSTRTLETIRR--DHD---------KFVETSGWT
QUEA_STAAE      YQMTQETADLLNDTKSKGHRIISVGTTSTRTLETIRR--DHD---------KFVETSGWT
QUEA_STAAC      YQMTQETADLLNDTKSKGHRIISVGTTSTRTLETIRR--DHD---------KFVETSGWT
QUEA_STAA8      YQMTQETADLLNDTKSKGHRIISVGTTSTRTLETIRR--DHD---------KFVETSGWT
QUEA_STAAT      YQMTQETADLLNDTKSKGHRIISVGTTSTRTLETIRR--DHD---------KFVETSGWT
QUEA_STAA3      YQMTQETADLLNDTKSKGHRIISVGTTSTRTLETIRR--DHD---------KFVETSGWT
QUEA_STAHJ      YQMTQETANLLNQTKKEGHRIISVGTTSTRTLETIRR--DYN---------EFVAVSGWT
QUEA_STAES      YQMTQETADLLNKTKESGKRVISVGTTSTRTLETIRR--DHP---------QFVATSGWT
QUEA_STAEQ      YQMTQETADLLNKTKESGKRVISVGTTSTRTLETIRR--DHP---------QFVATSGWT
QUEA_STAS1      YQMDEATANLLNSTRDNGNRIISVGTTSTRTLETIMQ--SSD---------RFVAKSGWT
QUEA_CLOBH      YKMDKKTAEIINDTKENGGRVIAVGTTSCRTLETIG---AIEG--------KVGEQSGWT
QUEA_CLOB1      YKMDKKTAEIINDTKENGGRVIAVGTTSCRTLETIG---AIEG--------KVGEQSGWT
QUEA_CLOBL      YKMDKKTAEIINDTKENGGRVIAVGTTSCRTLETIG---DIEG--------KVGEQSGWT
QUEA_CLOTE      YCISKETADIINTTKEAGGRVIAVGTTSCRTLETLG---SKHG--------KIIEDSGWT
QUEA_CLOAB      YMLSKESADTINETRKNGGRIISVGTTSTRTLETIA---DEKG--------NVREQSGWT
QUEA_CLOK5      YSMSKETADMINAAKESGHSVISVGTTSCRTLETIG---DENG--------RVKEQSGWT
QUEA_CLOPE      YHLDKENAELINKTKEAGKRVIAVGTTSSRTLETIG---DENG--------RVREQSGWT
QUEA_CLOP1      YHLDKENAELINKTKEAGKRVIAVGTTSSRTLETIG---DENG--------RVREQSGWT
QUEA_CLOPS      YHLDKENAELINKTKEAGKRVIAVGTTSSRTLETIG---DENG--------RVREQSGWT
QUEA_CLOB8      YMLSKESADIINETKKRGNAVISVGTTSTRTLETIG---DENG--------FVKEQSGWT
QUEA_HUNT2      YRIKEEDCDKINSTKQNGGKIIAVGTTSCRVLETVG---DENG--------IVRPQSGWT
QUEA_CLOD6      YMVSQEAADKINRAKENGKNVICVGTTSCRTIESAC---NEDG--------KMKETSGWT
QUEA_LACP7      YQVEESEAKKINDAKRAGGRIICVGTTSCRTIESAA---NEDG--------FVQAKSGAT
QUEA_ALKMQ      YEITEEAAQVINDTKKAGNRVFAVGTTSCRTLESAS---TEKG--------KIEANKGWT
QUEA_CALS4      YIVTEEAAKAINEARKNGGRIIAVGTTSTRTLETVA---DESG--------YIHPKSGWT
QUEA_SYMTH      YHVSPEAAAGINAVRKGGGRLVAVGTTSVRTLETVA---DEDG--------TVRPGEGWT
QUEA_MOOTA      YAVTPAAAATINAARARGHRVVAVGTTVVRTLETVA---TADG--------VIHAGSGWT
QUEA_DESHY      YRVTPDAAERINRAKSQGRRVIAVGTTASRTLESVA---GENG--------RIEGKEGWT
QUEA_DESRM      YEITPQAAEEINQAKLRGGRVIAVGTTSVRCLETSS---NEAG--------QVLPGSGFT
QUEA_PELTS      YEITEEASRAIAETRARGGRVIAVGTTTTRCLESAA---EEGG--------RVRPGSGWT
QUEA_CARHZ      YEIENEAAEKVNKAKREGRRVIAVGTTVVRVLESVA----DKG--------QVAPAKGYT
QUEA_FUSNN      FEISEKVAKIINEAKAEGRRIISVGTTATRALESSV---DENG--------KLIAQKKDT
QUEA_THEMA      YQVPKETVRKLRETRERGNRIVAVGTTTVRTLETIAR--LPE----------QEEYVGKT
QUEA_THEP1      YQVTKETIKKLRETRERGNRIVAVGTTTVRTLETIAR--LPE----------QEEYVGKT
QUEA_THEM4      YYVPNETVKKIFETKKNGGRIVAVGTTSVRTLETIVR--LER----------KESYHGKT
QUEA_DEHMC      GILSKETASAICCAKETGKRVFCVGTSATRLVEQASHL-SQTS--------LITSYSGWA
QUEA_DEHMB      GILSKETASAICCAKETGKRVFCVGTSATRLVEQASHL-SQTS--------LITSYSGWA
QUEA_DEHM1      GILSAETAAAICQAKANGKRVFCVGTSATRLVEQASSL-SQNG--------IIELYSGWA
QUEA_FLAJ1      LIITQEACDIVNEGKAKKKRICAVGTTSMRAIESSVS---SAN--------TLNPYEGWT
QUEA_FLAPJ      LKITQEACDIVNAAKERKSRICAVGTTSMRAIESSVS---SAR--------TLNPYDGWT
QUEA_BACFN      MFVTEEAVKIVNRAKDLGKNVCAVGTTVMRAIESTVS---TDG--------HLKEYEGWT
QUEA_BACFR      MFVTEEAVKIVNRAKDLGKNVCAVGTTVMRAIESTVS---TDG--------HLKEYEGWT
QUEA_BACV8      MYVNADACRIVNNAKDEGKNICAVGTTVMRTIETAVG---TDG--------HLKEFDGWT
QUEA_PARD8      MVVNADVVDIVNKGKDEGHKVCAVGTSVMRAIETAVS---TDG--------HLKEFEGWT
QUEA_CYTH3      FIIESTTADVVNKALDNKKRVCAIGTTSMRALESSVS---ANN--------RLKQNAGWT
QUEA_GEOMG      YIIPSATADAVNARKGGKGRVIALGTTTCRTLEHAAR---DDG--------RVAAGAGET
QUEA_GEOSL      YHIPPATADAINGCRREGGRVIALGTTVCRTLEQAAA---ADG--------TIAAGEGEA
QUEA_GEOUR      YFIPEATARAVNARKNDGGRVVALGTTTTRALEHAAA---GNG--------SVQPGEGEA
QUEA_PELCD      YFVPEGTAAAVNRAKDDGRRVIALGTTSTRTLEYAVD---EQG--------RLQAGAGTC
QUEA_PELPD      YHISAETCQAIAETKQRGGRVVAVGTTSARTLEYAAD---EKG--------GLCPGSGDA
QUEA_PELLD      YSIPAATIEKIRATKASGGRIIALGTTVTRALEHAALSLSGHS--------GPGPLEGEA
QUEA_CHLPM      YSIPARTIEQIHETRRSGGRVVALGTTVTRALEHAATRISAFS--------GSDPLVGEA
QUEA_CHLPD      YVIPDETIALIRTTKNNGGRVIAVGTTVTRALEHAADVVFNSN--------GNGSVSGEA
QUEA_CHLTE      YNIPQTAARKIGETKASGGRVVAAGTTVTRALEHAAPKLIESG--------FTQEVSSEA
QUEA_CHLCH      YLLPAESVAALQRVKADGGRVVAVGTTVTRALEHSAPRILQSS--------AHAEIEGEA
QUEA_CAUVC      GQVTQEIADALNAARAAGGRIVCVGTTSLRLLESATGE---DG--------IVRPFADET
QUEA_CAUSK      GEVPAAVADALNAARAAGGRIVCVGTTSLRLLESATGE---DR--------IIKPFADET
QUEA_BRUC2      GHVSQRTASALNAVHERGGRIICVGTTSLRLIESATGE---DG--------VVRPWSGAT
QUEA_BRUSU      GHVSQRTASALNAVHERGGRIICVGTTSLRLIESATGE---DG--------VVRPWSGAT
QUEA_BRUA2      GHVSQRTASALNAVHERGGRIICVGTTSLRLIESATGE---DG--------VVRPWSGAT
QUEA_BRUME      GHVSQRTASALNAVHERGGRIICVGTTSLRLIESATGE---DG--------VVRPWSGAT
QUEA_BRUO2      GHVSQRTASALNAVHERGGRIICVGTTSLRLIESATGE---DG--------VVRPWSGAT
QUEA_BRUSI      GHVSQRTASALNAVHERGGRIICVGTTSLRLIESATGE---DG--------VVRPWSGAT
QUEA_BRUAB      GHVSQRTASALNAVHERGGRIICVGTTSLRLIESATGE---DG--------VVRPWSGAT
QUEA_OCHA4      GYVSQRTADALNAVHERGGKIICVGTTSLRLIESAAGE---DG--------IIRPWAGAT
QUEA_RHILO      GSVSRETADALNAAKARGGRIIAVGTTSLRLLESAARE---DG--------TVPAWSGPT
QUEA_CHESB      GEVDGMTADALNAVRARGGCIIAVGTTSLRLLESAAEP---SG--------LLKAWSGET
QUEA_RHIEC      GYVSGEIAAGLNAVKARGGRIVCVGTTSLRLIESAAGE---SG--------EIKPWAGAT
QUEA_RHIL3      GYVSAEIAARLNAVRERGGRIVCVGTTSLRLIESAAEE---SG--------EIMPWAGAT
QUEA_AGRFC      GYVSQETADRLNAVKARGGRIVCVGTTSLRLIESAATE---DG--------TIHPWSDAT
QUEA_RHIME      GHVDPVTAAKLNAVRERGGRIVCVGTTSLRLIESAAAE---DG--------NIRPWSGAT
QUEA_SINMW      GHVDAVTAAKLNAVRERGGRVVCVGTTSLRLVESAAAE---DG--------TIHAWSGAT
QUEA_RHOPS      GTISEATADALNAARAQGGRIVAVGTTSLRLLESAARE---DG--------TIAPFADET
QUEA_RHOPA      GTISSGTAEALNAARAAGGRIVAVGTTSLRLLESAARD---DG--------RIAPFADET
QUEA_RHOP5      GCLSRETADALNAARAADGRIVAVGTTSLRLLESAAGD---DG--------RLAPFADDT
QUEA_NITWN      GAISTETADALNAARSRGGRIVAVGTTSLRLLESAADD---DG--------RIKPFTGET
QUEA_BRASO      GSLTPETAAALNQAKAEGGRIVAVGTTSMRLLESAALP---DG--------TIAPFEAET
QUEA_BRASB      GSLSAETAAALNEARAKGGRIVAVGTTSMRLLESAALP---DG--------TIAPFEAET
QUEA_BRADU      GTISAETAERLNIARHNGGRIIAVGTTSLRLLESAASE---DG--------TIQPFAAET
QUEA_AZOC5      GEVSPETAAELNAVKARGGRIITVGSTATRLIETAATP---EG--------SIRPYLGET
QUEA_PARL1      GEITEAEAAAINEARAKGGRIVAVGTTSLRLLESAVDE---AG--------TVHPFRGET
QUEA_MARMM      CTVSAEAADAINAAKAEGRRVIPVGTTALRTIESLASG---PG--------IVRAGSRDT
QUEA_HYPNA      RRITPEVADRLNAARAAGARLVPVGTTAMRTLESCAGE---DG--------QIHAATGPT
QUEA_RHORT      GTLTAQTAEAINAARAAGGKVVAVGTTAMRLLESATGA---DK--------VIRPFHGDT
QUEA_SPHWW      GRIDAATADHLNAIRAAGGRVIAVGTTSLRLLESATGE---DG--------VIRPFDGDT
QUEA_NOVAD      GTIDAATADRLNAARAAGKRVIAVGTTSLRLLESATGE---DR--------VIRPFEGDT
QUEA_SPHAL      GRIEADTAARLNAVRASGGRVIAVGTTSLRLLESAARD---DG--------TITPFAGDT
QUEA_ERYLH      GRIEHDTADRLNAAKSRGGRIIAVGTTSLRLLESATGE---DG--------VIRTFAGDT
QUEA_ZYMMO      GQISAETANAINETKKQGGRVIATGTTSLRLIESAADE---TG--------LVHPFSDET
QUEA_GLUDA      GVITAETADAINAARRAGGRIVAVGTTSLRLLESAADP---DG--------TIRPFDGDT
QUEA_GLUOX      GEIDAETAAAINETRARGGRIVAVGTTSLRLLESAARE---DG--------TVAPWRGET
QUEA_ACICJ      GLIGPETAALVNATRARGGRIVAVGTTSLRVLETAAGD---DG--------TLAPWHGET
QUEA_RUEST      GQVTPEAAAEIAATKAAGNRVIPVGTTALRLIESAARE---SG--------AITPWEGET
QUEA_RUEPO      GRVSAEAAAEIAATKAAGGRVIPVGTTALRLIESAAR----GG--------QIAPWEGDT
QUEA_ROSDO      GQVSAAAAAEINATKQAGKRVIPVGTTALRLIETAGR----EG--------QIKAWEGDT
QUEA_JANSC      GEVRATAAAEINATKAAGGRIIPVGTTALRLIESAAQ----DG--------TIHPFEGTT
QUEA_RHOS4      GEVTETAAAEIAATKAAGGRVIPVGTTALRLIESAAA----SG--------AIRPWRGET
QUEA_RHOS1      GEVTEAAAAEIAATKAAGGRVIPVGTTALRLIESAAA----SG--------AIRPWRGET
QUEA_RHOS5      GEVTEAAAAEIAATKAAGGRVIPVGTTALRLIESASA----AG--------TIRPWRGET
QUEA_DINSH      GEISDQAAAEILATRADGRRVIPVGTTALRLIETAAAQ---PG--------GFGPWEGDT
QUEA_THET2      YAIPEEVAEAVNRAKAEGRRVVAVGTTVVRALESAYR---EGV--------GVVAGEGET
QUEA_THET8      YAIPEEVAEAVNRAKAEGRRVVAVGTTVVRALESAYR---EGV--------GVVAGEGET
QUEA_DEIRA      YEVSETNAAAITRAKAEGRRVVAVGTTTVRTLESAW----DGA--------AVRAGAGET
QUEA_RUBXD      YAVPEETA----RAVEEAERVVAVGTTVVRTLESWAR---SGV--------R----EGES
QUEA_ANADF      YEVRPEAAAAIAACRARGSRVVAVGTTSVRTLESAW----RGG--------AVAAGAGRT
QUEA_ANADE      YEVSPAAAAELAAARARGGRIVAVGTTSVRTLESAW----RDG--------EVAPGPGRT
QUEA_SORC5      YSIPDATAGAIAGARARGAPVIAIGTTVVRALESAADPA-RAG--------LVQAQSGET
QUEA_SYNAS      FSISPESSDKINSAE----RVIAVGTTSTRVLESAADE---QG--------RVHPMSGQS
QUEA_SOLUE      YRITADNAGKIGAAT----RVVAVGTTSVRTLETAA---------------RDGVLEGET
QUEA_DESVV      VEVTAETVEAIRRAKADGRPVVAVGTTSCRVLEGVATA---KG--------TLEPYAGWT
QUEA_DESVH      VEVTAETVEVIRRAKADGRPVVAVGTTSCRVLEGVATA---KG--------TLEPYAGWT
QUEA_DESAG      MEITEQAAQAINDAKRQGRPVVTVGTTSTRVLEGAWAA---CG--------EIRPFTGWT
QUEA_SYNWW      YEVAEDAAALLNLTRESGGQIVAVGTTVVRTLESVYNK---DC--------GFLAGKGET
QUEA_NOSS1      IEVPAATVAQIKATKAAGGRIIAVGTTVVRALEGAAASG------------NLQEFCGKT
QUEA_TRIV2      IEIPAATVAQIKATKAAGGRIIAVGTTVVRALEGAAASG------------DLQEFCGKT
QUEA_THEEB      LEVSAATVERIQAAKAAGGRIIAVGTTVIRALETAAHSG------------TLQPFCGKS
QUEA_SYNE7      MMVPAATVEKIQATKAAGGRVIAVGTTSVRAIEGAAASG------------ELKPGSDRV
QUEA_SYNP6      MMVPAATVEKIQATKAAGGRVIAVGTTSVRAIEGAAASG------------ELKPGSDRV
QUEA_ACAM1      VDLPAATVDAIRTTKASGGRVIAVGTTVTRALEGACQNG------------PLVPWQGRT
QUEA_SYNY3      IDVPPTTVEVIEKTRASGGRIFAVGTTVVRCLEGMAQESDFPRQ-------PLQPFRGQT
QUEA_GLOVI      YEIPEATAIAIERTRSRGGRVLAVGTTSARALESAAQPNG-----------LPATGPGRS
QUEA_SYNSC      VDVSPAVVEAVQACR---GRVIAVGTTSVRALEGAAQAHGGV----------LKPYTGPV
QUEA_SYNPX      VEVSAAVVEAIQRCR---GRVIAVGTTSVRALEGAAQQNGGV----------LQPFTGPV
QUEA_SYNS9      IEVNASVVEAIQQCR---GRVIAVGTTSVRALEGAAQLQGGV----------LKPFTGPV
QUEA_SYNS3      VEVRAEVVEAVLACRARGGRVIAVGTTSVRALEAAAAGGGG-----------LQPLKGPV
QUEA_SYNPW      VEVSTQLVEAVQACRQRGGRVIAVGTTSVRALEGAAAAGGGD----------LQPLKGPV
QUEA_PROMM      VEVRDDVVEAVMACRARAGRVIAVGTTSVRALEGAALAGGGF----------LQSFCGPV
QUEA_PROM3      VEVRDEVVAAVMACRARAGRVIAVGTTSVRALEGAALAGGGF----------LQSFCGPV
QUEA_SYNR3      VEVSEALVQAVAACRKRGGRVIAVGTTSVRSLEGVAALHGGV----------LQPFRGPV
QUEA_PROMA      VEVKEEVVSAIKECRDRGGRVIAIGTTTVRSLEASFLAGDGC----------LKPFKGEV
QUEA_PROMT      IEVTEETIKAITNCKEDGGKVFAVGTTSVRALEAAYLSGRGA----------LKPYEGKV
QUEA_PROM1      IEVTEETIKAITTCKEEGGKVFAVGTTSVRALEAAYLSGRGA----------LKPYEGKV
QUEA_PROMP      VRVSSEVVEEIKRVKKTDRRVIAIGTTSVRALESCYSYEMGD----------LIPIDKYV
QUEA_DESPS      VSVGQETVDKIIATRKAGGKIWAVGTTTVRSLEFAAAQHGGQ----------IAATEGWC
QUEA_AQUAE      VKIPKETVEKIKETKEKGKRVVAVGTTVVRALETKP----------------FEPFEGWT
QUEA_NITSB      YEIPKDTIEVIESDE----KVLAVGTTVTRTIEYYVRT-----K-------KSF---GEC
QUEA_ARCB4      FEIGIDAKKNLDKAN----KVLAVGTTVTRTIEYYART-----N-------KIQ---GEC
QUEA_CAMJE      FNIPQQACEIIDSKQ----AILGVGTTVTRTIEYYTRT-----K-------TKN---GFC
QUEA_SULDN      YDISDRAKELLDSKV----SILSVGTTSTRTIEFYARN-----K-------EHQR--GEA
QUEA_HELPJ      LHIPKKSQEILQESQ----EVLCIGTTALRSVEYFKRL-----K-------NPNQESFEC
QUEA_HELPH      LHIPKKSQEILRESQ----EVLCIGTTALRSVEYFKRL-----K-------NSNQESFEC
QUEA_HELPY      LRIPKKSQEILQKSQ----EILCVGTTALRSVEYFKRL-----E-------NPNQEAFEC
QUEA_HELAH      LHIPKKSQEILQKSQ----EILCIGTTALRSVEYFKRL-----K-------TPKQEAFEC
QUEA_HELHP      FSLSPQSAAAIQNAH----KVLCIGTTSARCVEYYARY-----K-------ILQG---EC
QUEA_RICBR      CSITPETAAIINKAKKEKRRIIAVGTTSLRTLESSGIN------------GNVNSGDFET
QUEA_RICB8      CSITPETAAIINKAKKEKRRIIAVGTTSLRTLESSGIN------------GNVNSGDFET
QUEA_RICRS      CSITPDTAEIINKAKQEGKRIIAVGTTTLRTLESSCNN------------GIVKAGSFKT
QUEA_RICRO      CSITPDTAEIINKAKQEGKRIIAVGTTTLRTLESSCNN------------GIVKAGSFKT
QUEA_RICAH      CSITPETAEIINKAKQERRRIIAVGTTTLRTVESFCNN------------GIIKAGSFET
QUEA_RICFE      CSITPETAEIINKAKQERRRIIAVGTTTLRTLESSCNN------------GVVKAGSFET
QUEA_RICTY      CSITAETAEIINKTKQKGRDIIAVGTTTLRTLESSCNN------------GIVKAGNFET
QUEA_RICCK      CSITPDTARLINKAKQEKQRIIAVGTTTLRTLESSCNN------------GTVKACDFET
QUEA_BORBP      FLIEDCVATRLENAKFLGKKILSIGTTTLRALESSYDNKLKK----------FKTGQQST
QUEA_BORAP      FLIKDCVANRLENAKFLGKKVLSIGTTTLRALESSYDNKLKK----------FKTGQQST
QUEA_BORBU      FLIKDFVAVRLQNAKLLGKRILSIVTTTLRALESSYDNNLKK----------FKTGQQST
QUEA_TREDE      FFISEKTAQAVEKAKKEGRPIIAVGTTTVRTLESAWDEKRKE----------LKWGNQST
                  :                      ::  : :*                           

QUEA_SHISS      QIFIYPG--FQYKVVDALVTNFHLPESTLIMLVSAFAGYQHTMNAYKAAVEEKYRFFSYG
QUEA_ECOHS      QIFIYPG--FQYKVVDALVTNFHLPESTLIMLVSAFAGYQHTMNAYKAAVEEKYRFFSYG
QUEA_SHIFL      QIFIYPG--FQYKVVDALVTNFHLPESTLIMLVSAFAGYQHTMNAYKAAVEEKYRFFSYG
QUEA_SHIDS      QIFIYPG--FQYKVVDALVTNFHLPESTLIMLVSAFAGYQHTMNAYKAAVEEKYRFFSYG
QUEA_ECO57      QIFIYPG--FQYKVVDALVTNFHLPESTLIMLVSAFAGYQHTMNAYKAAVEEKYRFFSYG
QUEA_ECO24      QIFIYPG--FQYKVVDALVTNFHLPESTLIMLVSAFAGYQHTMNAYKAAVEEKYRFFSYG
QUEA_SHIF8      QIFIYPG--FQYKVVDALVTNFHLPESTLIMLVSAFAGYQHTMNAYKAAVEEKYRFFSYG
QUEA_ECOLI      QIFIYPG--FQYKVVDALVTNFHLPESTLIMLVSAFAGYQHTMNAYKAAVEEKYRFFSYG
QUEA_ECOLC      QIFIYPG--FQYKVVDALVTNFHLPESTLIMLVSAFAGYQHTMNAYKAAVEEKYRFFSYG
QUEA_ECOL5      QIFIYPG--FQYKVVDALVTNFHLPESTLIMLVSAFAGYQHTMNAYKAAVEEKYRFFSYG
QUEA_ECOL6      QIFIYPG--FQYKVVDALVTNFHLPESTLIMLVSAFAGYQHTMNAYKAAVEEKYRFFSYG
QUEA_SHIBS      QIFIYPG--FQYKVVDALVTNFHLPESTLIMLVSAFAGYQHTMNAYKAAVEEKYRFFSYG
QUEA_ECOK1      QIFIYPG--FQYKVVDALVTNFHLPESTLIMLVSAFAGYQHTMNAYKAAVEEKYRFFSYG
QUEA_ECOUT      QIFIYPG--FQYKVVDALVTNFHLPESTLIMLVSAFAGYQHTMNAYKAAVEEKYRFFSYG
QUEA_SALPB      QIFIYPG--YQYKVIDALITNFHLPESTLIMLVSAFAGYQHTMNAYKTAVEQKYRFFSYG
QUEA_SALTY      QIFIYPG--YQYKVIDALITNFHLPESTLIMLVSAFAGYQHTMNAYKTAVEQKYRFFSYG
QUEA_SALCH      QIFIYPG--YQYKVIDALITNFHLPESTLIMLVSAFAGYQHTMNAYKTAVEQKYRFFSYG
QUEA_SALPA      QIFIYPG--YQYKVIDALITNFHLPESTLIMLVSAFAGYQHTMNAYKTAVEQKYRFFSYG
QUEA_SALTI      QIFIYPG--YQYKVIDALITNFHLPESTLIMLVSAFAGYQHTMNAYKTAVEQKYRFFSYG
QUEA_SALAR      QIFIYPG--YQYKVIDALVTNFHLPESTLIMLVSAFAGYEHTMNAYKAAVEQKYRFFSYG
QUEA_CITK8      QIFIYPG--YQYKVIDALVTNFHLPESTLIMLVSAFAGYQHTMNAYKAAVEQNYRFFSYG
QUEA_ENT38      KIFIYPG--YQYTVIDALVTNFHLPESTLIMLVSAFAGYQNTMNAYKAAVEQNYRFFSYG
QUEA_KLEP7      QIFIYPG--YQYQVIDALVTNFHLPESTLIMLVSAFAGYQHTMNAYKVAVEQKYRFFSYG
QUEA_CROS8      QIFIYPG--YQYKVIDALVTNFHLPESTLIMLVSAFAGYKHTMNAYREAVKAEYRFFSYG
QUEA_YERPE      RIFIYPG--YHYQVVDALVTNFHLPESTLIMLVSAFAGYKNTMNAYQQAVAEQYRFFSYG
QUEA_YERPS      RIFIYPG--YHYQVVDALVTNFHLPESTLIMLVSAFAGYKNTMNAYQQAVAEQYRFFSYG
QUEA_YERP3      RIFIYPG--YHYQVVDALVTNFHLPESTLIMLVSAFAGYKNTMNAYQQAVAEQYRFFSYG
QUEA_YERE8      KIFIYPG--YHYQVVDALITNFHLPESTLIMLVSAFAGYKNTMNAYQQAVAEQYRFFSYG
QUEA_SERP5      SIFIFPG--YHYQVVDALVTNFHLPESTLIMLVSAFAGYKNTMHAYQQAVAEQYRFFSYG
QUEA_PECAS      KIFIYPG--YHYRIIDALVTNFHLPESTLIMLVSAFAGYQNTMSAYREAVAEQYRFFSYG
QUEA_PHOLL      QIFIYPG--FEYQVVDALITNFHLPESTLIMLVSAFAGYKNTMNAYQEAVAEKYRFFSYG
QUEA_SODGM      SIFIYTG--YQFRVVDVLITNFHLPESTLIMLVSAFAGYRHTLAAYREAVAQAYRFFSYG
QUEA_BAUCH      SIFIYPG--YRFRVIDALITNFHLPQSTPIMLVSAFAGYQHTFNAYREAVNLAYRFLSYG
QUEA_VIBCH      EIFIFPG--YQYQLVDCLITNFHLPESTLIMLVSAFAGYEHTMAAYEHAVKEQYRFFSYG
QUEA_VIBC3      EIFIFPG--YQYQLVDCLITNFHLPESTLIMLVSAFAGYEHTMAAYEHAVKEQYRFFSYG
QUEA_VIBPA      EIFIYPG--YEYQLVDCLITNFHLPESTLIMLVSAFAGYENTMNAYKHAVENKYRFFSYG
QUEA_VIBCB      EIFIYPG--YEYQLVDCLITNFHLPESTLIMLVSAFAGYENTMNAYKHAVENKYRFFSYG
QUEA_VIBVU      EIFIFPG--YQYQLVDCLITNFHLPESTLIMLVSAFAGYDHTMNAYQHAVSNQYRFFSYG
QUEA_VIBVY      EIFIFPG--YQYQLVDCLITNFHLPESTLIMLVSAFAGYDHTMNAYQHAVANQYRFFSYG
QUEA_ALIF1      EIFIYPG--YEFQVVDALVTNFHLPESTLIMLVSAFAGYENTMKAYEQAVNNKYRFFSYG
QUEA_PHOPR      EIFIFPG--YEFQLVDVLVTNFHLPESTLIMLVSAFAGYEHTMNAYLQAVDNKYRFFSYG
QUEA_AERHH      DIFIFPG--YQFQVVDAMVTNFHLPESTLIMLVSAFAGYDNVMSAYQAAVAEQYRFFSYG
QUEA_AERS4      DIFIFPG--YQFQVVDAMVTNFHLPESTLIMLVSAFAGYDHVMAAYQAAVAEQYRFFSYG
QUEA_COLP3      DIFITPG--CQFQIIDALVTNFHLSESTLLMLVSAFSGYDHIMSAYQHAISQEYRFFSYG
QUEA_PSEA6      DIFIYPG--YKFQVIDAMLTNFHLSESTLIMLVSAFAGKENVMNAYQEAIAQQYRFFSYG
QUEA_SHEPA      DIFIYPG--YQFQVVDAMVTNFHLPESTLIMLLSAFAGFDEVKNAYQHAIAQKYRFFSYG
QUEA_SHEHH      DIFIYPG--YQFQVVDAMVTNFHLPESTLIMLLSAFAGFDEVKNAYQHAIAQKYRFFSYG
QUEA_SHELP      DIFIYPG--YEFQVVDAMVTNFHLPESTLIMLISAFAGFDEVKNAYQHAIAQKYRFFSYG
QUEA_SHESM      DIFIYPG--YQFQIVDAMITNFHLPESTLIMLVSAFAGFDHVMAAYQHAITQKYRFFSYG
QUEA_SHESA      DIFIYPG--YQFQIVDAMITNFHLPESTLIMLVSAFAGFDHVMAAYQHAITQKYRFFSYG
QUEA_SHESR      DIFIYPG--YQFQIVDAMITNFHLPESTLIMLVSAFAGFDHVMAAYQHAITQKYRFFSYG
QUEA_SHEON      DIFIYPG--YQFQVVDAMVTNFHLPESTLIMLVSAFAGYEHVMAAYQHAIKQKYRFFSYG
QUEA_SHESW      DIFIYPG--YQFQVVDAMVTNFHLPESTLIMLVSAFAGFDHVMAAYQHAITQKYRFFSYG
QUEA_SHEPC      DIFIYPG--YQFQVVDAMVTNFHLPESTLIMLVSAFAGFDHVMAAYQHAITQKYRFFSYG
QUEA_SHEB8      DIFIYPG--YQFQVVDAMVTNFHLPESTLIMLVSAFAGFDHVMAAYQHAIAQKYRFFSYG
QUEA_SHEB9      DIFIYPG--YQFQVVDAMVTNFHLPESTLIMLVSAFAGFDHVMAAYQHAIAQKYRFFSYG
QUEA_SHEB5      DIFIYPG--YQFQVVDAMVTNFHLPESTLIMLVSAFAGFDHVMAAYQHAIAQKYRFFSYG
QUEA_SHEFN      DIFIYPG--FQFKVVDAMVTNFHLPESTLIMLLSAFAGYEAVMKAYQHAITQKYRFFSYG
QUEA_SHEDO      DIFIYPG--YEFKVVDAMVTNFHLPESTLIMLISAFTGVDEVRYAYQHAIAQKYRFFSYG
QUEA_SHEAM      DIFIFPG--FEFKVVDAMVTNFHLPESTLIMLVSAFAGFDEVIGAYRHAVEQKYRFFSYG
QUEA_PSEHT      DIFIYPG--YQFNVVDAMITNFHLPESTLIMLVSAFAGQNNIMGAYNTAIEQQYRFFSYG
QUEA_HAEIG      SIFIYPG--KKFRVVDCLITNFHLPESTLIMLVSAFAGYKNTMNAYKHAVQEKYRFFSYG
QUEA_HAEIE      SIFIYPG--KKFRVVDCLITNFHLPESTLIMLVSAFAGYKNTMNAYKQAVQEKYRFFSYG
QUEA_HAEI8      SIFIYPG--KKFRVVDCLITNFHLPESTLIMLVSAFAGYKNTMNAYKHAVQEKYRFFSYG
QUEA_HAEIN      SIFIYPG--KKFRVVDCLITNFHLPESTLIMLVSAFAGYKNTMNAYKHAVKEKYRFFSYG
QUEA_HAES1      SIFIYPG--KKFRVIDCLITNFHLPESTLIMLVSAFAGYQHTMNAYKSAVENRYRFFSYG
QUEA_HISS2      SIFIYPG--KKFRVIDCLITNFHLPESTLIMLVSAFAGYQHTMNAYKSAVENRYRFFSYG
QUEA_PASMU      SIFIYPG--KTFRVVDCLITNFHLPESTLIMLVSAFAGYRHTMQAYQSAVENRYRFFSYG
QUEA_MANSM      SIFIYPG--KQFRVVDCLITNFHLPESTLIMLVSAFAGYKNTMNAYKSAVENRYRFFSYG
QUEA_HAEDU      NIFLYPG--KTFKIVDVLITNFHLPESTLIMLVSAFAGYRHTMNAYQHAVQQKYRFFSYG
QUEA_ACTP2      SIFLYPG--KTFRIVDALVTNFHLPESTLIMLVSAFAGYRNTMKAYQHAVEAKYRFFSYG
QUEA_MARMS      SIFIYPG--YEFKTVDALVTNFHLPESTLIMLISAFAGYDHVMAAYKKAVEQKYRFFSYG
QUEA_PSEAB      DIFIYPG--RPFHVVDALVTNFHLPESTLLMLVSAFAGYPETMAAYAAAVAQGYRFFSYG
QUEA_PSEAE      DIFIYPG--RPFHVVDALVTNFHLPESTLLMLVSAFAGYPETMAAYAAAVAQGYRFFSYG
QUEA_PSEA7      DIFIYPG--RPFHVVDALVTNFHLPESTLLMLVSAFAGYPETMAAYAAAVEQGYRFFSYG
QUEA_PSEMY      DIFIYPG--RPFHVVDALVTNFHLPESTLLMLVSAFAGYAETMAAYRAAVEQGYRFFSYG
QUEA_PSEP1      DIFIYPG--RPFHVVDALVTNFHLPESTLLMLVSAFAGYPETMAAYAAAVEHGYRFFSYG
QUEA_PSEPK      DIFIYPG--RPFHVVDCLVTNFHLPESTLLMLVSAFAGYPETMAAYAAAVEHGYRFFSYG
QUEA_PSEPG      DIFIYPG--RPFHVVDALVTNFHLPESTLLMLVSAFAGYPETMAAYAAAVEHGYRFFSYG
QUEA_PSEE4      DIFIFPG--RPFHVVDCLVTNFHLPESTLLMLVSAFAGYPETMAAYAAAVEQGYRFFSYG
QUEA_PSEU2      DIFIYPG--RPFHVVDALVTNFHLPESTLLMLVSAFAGYPETMAAYAAAIEHGYRFFSYG
QUEA_PSE14      DIFIYPG--RPFHVVDALVTNFHLPESTLLMLVSAFAGYPETMAAYAGAIEHGYRFFSYG
QUEA_PSESM      DIFIYPG--RPFHVVDALVTNFHLPESTLLMLVSAFAGYPETMAAYAAAIEHGYRFFSYG
QUEA_PSEF5      DIFIYPG--RPFHVVDALVTNFHLPESTLLMLVSAFAGYPETMAAYRAAVENGYRFFSYG
QUEA_PSEPF      DIFIYPG--RPFHVVDALVTNFHLPESTLLMLVSAFAGYPETMAAYKAAVDNGYRFFSYG
QUEA_SACD2      DIFIYPG--YQYKVVDALVTNFHLPESTLLMLVSAFAGYKHTMNAYQQAVAQCYRFFSYG
QUEA_MARHV      DIFIYPG--YRFQTVDAMITNFHLPESTLIMLVSAFAGYNNIMSAYREAVEQKYRFFSYG
QUEA_IDILO      NIFIYPG--YEFKVVDSMITNFHLPESTLIMLVSAFVGRDLIMKAYNEAIKERYRFFSYG
QUEA_CHRSD      DIFIYPG--YQWRCVDALITNFHLPESTLLMLVSAFAGYPQVMRAYRAAVAERYAFFSYG
QUEA_ALKEH      DIFIYPG--HRFHAVDALVTNFHLPGSTLLMLVSAFAGRERVLAAYRHAVAQRYRFFSYG
QUEA_HAHCH      SIFIYPG--YEFVTVDALVTNFHLPKSTLLMLVSAFAGREHILAAYQEAIEQRYRFFSYG
QUEA_ALCBS      DIFIFPG--YRFRLVDALVTNFHLPKSTLLMLISAFAGRDRIMGAYRAAIEAQYRFFSYG
QUEA_HYDCU      DIFITPG--YDFKVVDVLLTNFHLPESTLIMLVSALAGYDRTMQAYAHAVEQKYRFFSYG
QUEA_XYLFT      QIFIFPG--YCIRSVDAMVTNFHLPESTLLMLVAAFAGRTRILDAYYHAVQQRYRFFSYG
QUEA_XYLFA      QIFIFPG--YCIRSVDAMVTNFHLPESTLLMLVAAFAGRTRILDAYYHAVQQRYRFFSYG
QUEA_XANAC      QIFILPG--YRIRSVDAMVTNFHLPESTLMMMVSAFAGRERIFAAYHHAIAQRYRFFSYG
QUEA_XANC5      QIFILPG--YRIRSVDAMVTNFHLPESTLMMMVCAFAGRERIFAAYHHAIAQRYRFFSYG
QUEA_XANOR      QIFILPG--YRIRSVDAMVTNFHLPESTLMMMVSAFAGRERIFEAYHHAIAQRYRFFSYG
QUEA_XANCP      QIFILPG--YRIRSVDAMVTNFHLPESTLLMMVSAFAGCDRIFAAYAHAIAQRYRFFSYG
QUEA_XANC8      QIFILPG--YRIRSVDAMVTNFHLPESTLLMMVSAFAGCDRIFAAYAHAIAQRYRFFSYG
QUEA_METCA      RLFIKPG--FRFNCVDALVTNFHLPESTLLVLVCAFAGHRETLAAYRHAIAQAYRFFSYG
QUEA_NITOC      EIFIFPG--HRFHTVNALITNFHLPETTLLMLVCAFAGSEHVLAAYRHAIKKGYRFFSYG
QUEA_CUPMC      DIFITPG--YAFRIVDALITNFHLPKSTLLMLVSALAGVEAIRDAYRHAVDARYRFFSYG
QUEA_CUPPJ      DIFITPG--YQFRLVDALITNFHLPKSTLLMLVSALAGVEAIRAAYRHAVEARYRFFSYG
QUEA_CUPNH      DIFITPG--YRFRLVDALITNFHLPKSTLLMLVSALAGVEAIRAAYRHAVEQRYRFFSYG
QUEA_RALSO      DIFITPG--YRFRLVDALVTNFHLPKSTLLMLVSAFAGLETIRAAYRHAIAQRYRFFSYG
QUEA_BURCA      DIFITPG--YRFRVVDRLVTNFHLPKSTLLMLVSAFAGVETIRAAYRHAIEERYRFFSYG
QUEA_BURCH      DIFITPG--YRFRVVDRLVTNFHLPKSTLLMLVSAFAGVETIRAAYRHAIEERYRFFSYG
QUEA_BURL3      DIFITPG--YRFRVVDRLVTNFHLPKSTLLMLVSAFAGVETIRAAYRHAIEQRYRFFSYG
QUEA_BURVG      DIFITPG--YRFRVVDRLVTNFHLPKSTLLMLVSAFAGVETIRAAYRHAIDERYRFFSYG
QUEA_BURCM      DIFITPG--YRFRVVDRLVTNFHLPKSTLLMLVSAFAGVETIRAAYRHAIDERYRFFSYG
QUEA_BURP0      DIFITPG--YRFRVVDRLVTNFHLPKSTLLMLVSAFAGIETIRAAYRHAIDARYRFFSYG
QUEA_BURP1      DIFITPG--YRFRVVDRLVTNFHLPKSTLLMLVSAFAGIETIRAAYRHAIDARYRFFSYG
QUEA_BURP6      DIFITPG--YRFRVVDRLVTNFHLPKSTLLMLVSAFAGIETIRAAYRHAIDARYRFFSYG
QUEA_BURPS      DIFITPG--YRFRVVDRLVTNFHLPKSTLLMLVSAFAGIETIRAAYRHAIDARYRFFSYG
QUEA_BURMS      DIFITPG--YRFRVVDRLVTNFHLPKSTLLMLVSAFAGIETIRAAYRHAIDARYRFFSYG
QUEA_BURM9      DIFITPG--YRFRVVDRLVTNFHLPKSTLLMLVSAFAGIETIRAAYRHAIDARYRFFSYG
QUEA_BURM7      DIFITPG--YRFRVVDRLVTNFHLPKSTLLMLVSAFAGIETIRAAYRHAIDARYRFFSYG
QUEA_BURMA      DIFITPG--YRFRVVDRLVTNFHLPKSTLLMLVSAFAGIETIRAAYRHAIDARYRFFSYG
QUEA_PARXL      DIFITPG--YRFRVVDRLVTNFHLPKSTLLMLVSAFAGVETIREAYRHAIEARYRFFSYG
QUEA_JANMA      RLFITPG--YTFKTVTRLITNFHLPKSTLLMLVSAFAGYDTIRAAYQHAISQRYRFFSYG
QUEA_HERAR      RLFITPG--YTFKTVTRLITNFHLPKSTLLMLVSAFAGYDAIRAAYQHAISQRYRFFSYG
QUEA_AZOSB      DIFILPG--FRFRVADMLVTNFHLPKSTLLMLVSAFSGTDVIRRAYAHAVASRYRFFSYG
QUEA_AROAE      ELFILPG--YRFQVVDALITNFHLPKSTLLMLVSAFAGLEPMRRAYTHAVGHSYRFFSYG
QUEA_DECAR      SIFITPG--YRFQVVDRLITNFHLPKSTLLMLVSAFAGYDHIRAAYAHAVAERYRFFSYG
QUEA_BORPA      RLFITPG--YRYRIVDALLTNFHLPQSTLLMLVSALAGVAPIRRAYAHAVAERYRFFSYG
QUEA_BORBR      RLFITPG--YRYRIVDALLTNFHLPQSTLLMLVSALAGVAPIRRAYAHAVAERYRFFSYG
QUEA_BORPE      RLFITPG--YRYRAVDALLTNFHLPQSTLLMLVSALAGVEPIRRAYAHAVAERYRFFSYG
QUEA_THIDA      AIFITPG--YRFRTVDALVTNFHLPRSTLLMLVSAFSGIETIRRAYAHAIAERYRFFSYG
QUEA_NEIM0      DIFITPG--YRFNVVDRLVTNFHLPKSTLLMLVSAFSGMGHIRAAYRHAVEREYRFFSYG
QUEA_NEIMA      DIFITPG--YRFNVADRLVTNFHLPKSTLLMLVSAFSGMGHIRAAYRYAVEREYRFFSYG
QUEA_NEIMB      DIFITPG--YRFNVVDRLVTNFHLPKSTLLMLVSAFSGMGHIRAAYRHAVEREYRFFSYG
QUEA_NEIG1      DIFITPG--YRFNVVDRLVTNFHLPKSTLLMLVGAFSGMGHIRAVYRHAIEREYRFFSYG
QUEA_CHRVO      DIFITPG--YRFRVVDRLLTNFHLPKSTLLMLVSAFAGYDEIFQAYRHAVEKEYRFFSYG
QUEA_NITEU      NLFITPG--FRFRIVDRLLTNFHLPRSTLLMLVSAFAGMETIRHAYRHAIDNHYRFFSYG
QUEA_NITEC      NLFITPG--FQFRVVDRLLTNFHLPRSTLLMLVSAFAGIETIRHAYQHAVNNHYRFFSYG
QUEA_NITMU      DIFITPG--YQFRVVDCLLTNFHLPRSTLLMLVSAFGGVENIRCAYRHAIKERYRFFSFG
QUEA_POLAQ      NLFITPG--YQFKVVDCLLTNFHLPKSTLLMLVSAFAGVDNIRSAYQHAINQQYRFFSYG
QUEA_DICNV      DLFITPG--YEFQVVDALFTNFHLPESTLLMLVSAFAGVNNIRRIYQHAITEQYRFFSYG
QUEA_PSYWF      DIFIYPG--FKFGVIDKLLTNFHLPKSTLLMLVSAFAGKANIEQAYEHAVAQKYRFFSYG
QUEA_PSYA2      DIFIYPG--FKFGVVDKLLTNFHLPKSTLLMLVSAFATKKSIEQAYQHAIKSQYRFFSYG
QUEA_ACIAD      QIFIYPG--YQFCVVDRLITNFHLPESTLLMLVSALSNRNNILSAYEHAVQSKYRFFSYG
QUEA_LEGPL      DIFIYPG--YQFKVCDGLITNFHLPESTLVMLVSAFIGHQECMALYQEAIDKRYRFFSYG
QUEA_LEGPH      DIFIYPG--YQFKVCDGLITNFHLPESTLVMLVSAFIGHQECMALYQEAIDKRYRFFSYG
QUEA_LEGPA      DIFIYPG--YQFKVCDGLITNFHLPESTLVMLVSAFIGHQECMALYQEAIDKRYRFFSYG
QUEA_LEGPC      DIFIYPG--YQFKVCDGLITNFHLPESTLVMLVSAFIGHQECMALYQEAIDKRYRFFSYG
QUEA_COXBU      DLFIYPG--FQFNCVDALLTNFHLPKSTLLMLVCAFGGYELVMEAYQKAVENRYRFFSYG
QUEA_COXBN      DLFIYPG--FQFNCVDALLTNFHLPKSTLLMLVCAFGGYELVMEAYQKAVENRYRFFSYG
QUEA_COXBR      DLFIYPG--FQFNCVDALLTNFHLPKSTLLMLVCAFGGYELVMEAYQKAVENRYRFFSYG
QUEA_BUCAI      NIFIYPG--YKHNIVDALITNFHFPESTLIMLVCSFLGYKNTMNAYNTAIVNKYSFFSYG
QUEA_BUCAP      NIFIYPG--YKHNVVDALITNFHFPESTLIMLVCSFLGYKNTMNAYHEAIKNNYRFFSYG
QUEA_BLOFL      RIFIFPG--YRFKIVDSLITNFHLPESTLIMLVAAFAGYRNILRVYNAAIDLNYKFLSYG
QUEA_VESOH      DIFIYPS--YQFRIVDSLITNFHLPKSSLLMLVSAFIGRDKMLELYKHAIEQKYKFLSYG
QUEA_FRATH      DIFLYPG--KKFNVVDAMITNFHLPKSTLIMLVSAFADKEKIIKAYEHAIAERYRFFSYG
QUEA_FRATO      DIFLYPG--KKFNVVDAMITNFHLPKSTLIMLVSAFADKEKIIKAYEHAIAERYRFFSYG
QUEA_FRATF      DIFLYPG--KKFNVVDAMITNFHLPKSTLIMLVSAFADKEKIIKAYEHAIAERYRFFSYG
QUEA_FRATW      DIFLYPG--KKFNVVDAMITNFHLPKSTLIMLVSAFADKEKIIKAYEHAIAERYRFFSYG
QUEA_FRATT      DIFLYPG--KKFNVVDAMITNFHLPKSTLIMLVSAFADKEKIIKAYEHAIAERYRFFSYG
QUEA_FRAT1      DIFLYPG--KKFNVVDAMITNFHLPKSTLIMLVSAFADKEKIIKAYEHAIAERYRFFSYG
QUEA_FRATN      DIFLYPG--KKFNVVDAMITNFHLPKSTLIMLVSAFADKEKIIKAYEHAIAERYRFFSYG
QUEA_FRAP2      DIFLYPG--KKFNIVDAMITNFHLPKSTLIMLVSAFADKEKIMKAYEHAIAEKYRFFSYG
QUEA_GEOKA      DIFIYPG--YEFKGIDGLVTNFHLPKSTLIMLVSALAGRENILHAYQVAVKERYRFFSFG
QUEA_GEOTN      DIFIYPG--YEFKAIDGLVTNFHLPKSTLIMLVSAFAGREHILHAYEVAVKEQYRFFSFG
QUEA_BACSU      SIFIYPG--YEFKAIDGMITNFHLPKSSLIMLVSALAGRENILRAYNHAVEEEYRFFSFG
QUEA_BACVZ      SIFIYPG--YEFKAIDGMITNFHLPKSSLIMLVSALAGREHVLSAYRHAVEEEYRFFSFG
QUEA_BACP2      SIFIYPG--YTFKAIDGMITNFHLPKSSLIMLVSALAGREHVLKAYNEAVKEEYRFFSFG
QUEA_BACLD      SIFIYPG--YTFRAIDGMITNFHLPKSSLIMLVSALAGREHVLSAYRTAVEHEYRFFSFG
QUEA_BACHD      SIFIYPG--YEFKGIDGLITNFHLPKSTLVMLVSALAGRENLLNAYAHAVKQSYRFFSFG
QUEA_BACHK      DIFMYPG--YEFKAIDGLITNFHLPKSTLIMLVSAFANRDNVLHAYNEAVKEKYRFFSFG
QUEA_BACC1      DIFMYPG--YEFKAIDGLITNFHLPKSTLIMLVSAFANRDNVLHAYNEAVKEKYRFFSFG
QUEA_BACAN      DIFMYPG--YEFKAIDGLITNFHLPKSTLIMLVSAFANRDNVLHAYNEAVKEKYRFFSFG
QUEA_BACCZ      DIFMYPG--YEFKAIDGLITNFHLPKSTLIMLVSAFANRDNVLHAYNEAVKEKYRFFSFG
QUEA_BACCR      DIFMYPG--YEFKAIDGLITNFHLPKSTLIMLVSAFANRDNVLHAYNEAVKEKYRFFSFG
QUEA_BACCN      DIFMYPG--YEFKAIDGLITNFHLPKSTLIMLVSAFAGRENVLHAYNEAVKEKYRFFSFG
QUEA_OCEIH      DIFIYPP--YKFRAIDGLITNFHLPKSTLIMMISALAGKEAILHAYNEAVKEEYRFFSFG
QUEA_LISMO      EIFISPG--YTFQAVDALITNFHLPKSTLIMLVSALSDRTKILAAYNHAVEEQYRFFSFG
QUEA_LISMF      EIFISPG--YTFQAVDALITNFHLPKSTLIMLVSALSDRTKILAAYNHAVEEQYRFFSFG
QUEA_LISIN      DIFISPG--YEFQAVDALITNFHLPKSTLIMLVSALSDRTKILAAYNHAVEQQYRFFSFG
QUEA_LISW6      DIFISPG--YTFQAVDALITNLHLPKSTLIMLVSALSNRTNILAAYNHAVEQQYRFFSFG
QUEA_BACSK      SIFIYPG--YKYQAIDGLLTNFHLPKSTLVMLVSALIGKEALMDAYAHAIKERYRFFSFG
QUEA_STRT2      NIFIKPG--YQFTVVDAFSTNFHLPKSTLVMLVSAFAGREFVLEAYKHAIQERYRFFSFG
QUEA_STRTD      NIFIKPG--YQFTVVDAFSTNFHLPKSTLVMLVSAFAGREFVLEAYKHAVQERYRFFSFG
QUEA_STRT1      NIFIKPG--YQFTVVDAFSTNFHLPKSTLVMLVSAFAGREFVLEAYKHAVQERYRFFSFG
QUEA_STRA1      NIFIKPG--YQFKVVDAFSTNFHLPKSTLVMLVSAFAGRDFVLEAYNHAVEERYRFFSFG
QUEA_STRA5      NIFIKPG--YQFKVVDAFSTNFHLPKSTLVMLVSAFAGRDFVLEAYNHAVEERYRFFSFG
QUEA_STRA3      NIFIKPG--YQFKVVDAFSTNFHLPKSTLVMLVSAFAGRDFVLEAYNHAVEERYRFFSFG
QUEA_STRP8      NIFIKPG--YQFKVVDAFSTNFHLPKSTLVMLVSAFAGRDFVLEAYRHAVDEKYRFFSFG
QUEA_STRPF      NIFIKPG--YQFKVVDAFSTNFHLPKSTLVMLVSAFAGRDFVLEAYRHAVDEKYRFFSFG
QUEA_STRP6      NIFIKPG--YQFKVVDAFSTNFHLPKSTLVMLVSAFAGRDFVLEAYRHAIDEKYRFFSFG
QUEA_STRPB      NIFIKPG--YQFKVVDAFSTNFHLPKSTLVMLVSAFAGRDFVLEAYRHAVDEKYRFFSFG
QUEA_STRPM      NIFIKPG--YQFKVVDAFSTNFHLPKSTLVMLVSAFAGRDFVLEAYRHAVDEKYRFFSFG
QUEA_STRPC      NIFIKPG--YQFKVVDAFSTNFHLPKSTLVMLVSAFAGRDFVLEAYRHAVDEKYRFFSFG
QUEA_STRPG      NIFIKPG--YQFKVVDAFSTNFHLPKSTLVMLVSAFAGRDFVLEAYRHAVDEKYRFFSFG
QUEA_STRP1      NIFIKPG--YQFKVVDAFSTNFHLPKSTLVMLVSAFAGRDFVLEAYRHAVDEKYRFFSFG
QUEA_STRP3      NIFIKPG--YQFKVVDAFSTNFHLPKSTLVMLVSAFAGRDFVLEAYRHAVDEKYRFFSFG
QUEA_STRPD      NIFIKPG--YQFKVVDAFSTNFHLPKSTLVMLVSAFAGRDFVLEAYRHAVDEKYRFFSFG
QUEA_STRMU      NIFIKPG--YQFKIVDAFSTNFHLPKSTLVMLVSAFAGRDFILDAYKHAVDKHYRFFSFG
QUEA_STRP2      NIFIKPG--YEWKVVDAFSTNFHLPKSTLVMLVSAFAGRELVLDAYHHSIQEHYRFFSFG
QUEA_STRR6      NIFIKPG--YEWKVVDAFSTNFHLPKSTLVMLVSAFAGRELVLDAYHHSIQEHYRFFSFG
QUEA_STRPN      NIFIKPG--YEWKVVDAFSTNFHLPKSTLVMLVSAFAGRELVLDAYHHSIQEHYRFFSFG
QUEA_STRSV      NIFIKPG--YNWKVVDAFSTNFHLPKSTLVMLVSAFAGRSLTLEAYEHAIAERYRFFSFG
QUEA_LACLM      DIFIKPG--YEWKVVDAFNTNFHLPKSTLVMLVAAFAGRDFVLEAYQHAIDEKYRFFSFG
QUEA_LACLA      DIFIKPG--YEWKVVDAFNTNFHLPKSTLVMLVAAFAGRDFVLDAYQHAIDEKYRFFSFG
QUEA_LACPL      DIFIKPG--YQWKVVDAFITNFHLPKSTLVMLVAAFTGRDMILKAYQHAIDEKYRFFSFG
QUEA_LACBA      DIFIKPG--YQWQVVNAFITNFHLPKSTLVMLVAAFTGRDQILNAYHHAIEEKYRFFSFG
QUEA_PEDPA      DIFIKPG--YEWKVVDAFITNFHLPKSTLVMLVAAFTGRENILNAYQHAIEEKYRFFSFG
QUEA_LACSS      EIFIKPG--YQWKAVDAFITNFHLPKSTLVMLVASFTGRENILNAYQHAVDERYRFFSFG
QUEA_ENTFA      DIFITPG--YQFKVVEAFSTNFHLPKSTLVMLVSAFAGKDLTLAAYQHAIEEKYRFFSFG
QUEA_STAAM      NIFIYPG--FDFKAIDGQITNFHLPKSTLVMLVSAFSTRENVLNAYKTAVNLEYRFFSFG
QUEA_STAA9      NIFIYPG--FDFKAIDGQITNFHLPKSTLVMLVSAFSTRENVLNAYKTAVNLEYRFFSFG
QUEA_STAA2      NIFIYPG--FDFKAIDGQITNFHLPKSTLVMLVSAFSTRENVLNAYKTAVNLEYRFFSFG
QUEA_STAA1      NIFIYPG--FDFKAIDGQITNFHLPKSTLVMLVSAFSTRENVLNAYKTAVNLEYRFFSFG
QUEA_STAAB      NIFIYPG--FDFKAIDGQITNFHLPKSTLVMLVSAFSTRENVLNAYKTAVNLEYRFFSFG
QUEA_STAAW      NIFIYPG--FDFKAIDGQITNFHLPKSTLVMLVSAFSTRENVLNAYKTAVNLEYRFFSFG
QUEA_STAAN      NIFIYPG--FDFKAIDGQITNFHLPKSTLVMLVSAFSTRENVLNAYKTAVNLEYRFFSFG
QUEA_STAAR      NIFIYPG--FDFKAIDGQITNFHLPKSTLVMLVSAFSTRENVLNAYKTAVNLEYRFFSFG
QUEA_STAAS      NIFIYPG--FDFKAIDGQITNFHLPKSTLVMLVSAFSTRENVLNAYKTAVNLEYRFFSFG
QUEA_STAAE      NIFIYPG--FDFKAIDGQITNFHLPKSTLVMLVSAFSSRENVLNAYKTAVNLEYRFFSFG
QUEA_STAAC      NIFIYPG--FDFKAIDGQITNFHLPKSTLVMLVSAFSSRENVLNAYKTAVNLEYRFFSFG
QUEA_STAA8      NIFIYPG--FDFKAIDGQITNFHLPKSTLVMLVSAFSSRENVLNAYKTAVNLEYRFFSFG
QUEA_STAAT      NIFIYPG--FDFKAIDGQITNFHLPKSTLVMLVSAFSSRENVLNAYKTAVNLEYRFFSFG
QUEA_STAA3      NIFIYPG--FDFKAIDGQITNFHLPKSTLVMLVSAFSSRENVLNAYKTAVNLEYRFFSFG
QUEA_STAHJ      DIFIYPG--FTYKAIDGLITNFHLPKSTLVMLVSAFSSRENILNAYKEAVKLEYRFFSFG
QUEA_STAES      DIFIYPG--FEFKAIDGLITNFHLPKSTLVMLVSAFSNKKYILNAYHKAVEMEYRFFSFG
QUEA_STAEQ      DIFIYPG--FEFKAIDGLITNFHLPKSTLVMLVSAFSNKKYILNAYHKAVEMEYRFFSFG
QUEA_STAS1      DIFIFPG--FNFKAIDGLITNFHLPKSTLVMLVSAFSSRDYIINAYNQAVASEYRFFSFG
QUEA_CLOBH      DIFIYPG--YKYKVVDALITNFHLPQSTLLMLVSALAGRDNIMNAYNVAVEKEYRFFSFG
QUEA_CLOB1      DIFIYPG--YKYKVVDALITNFHLPQSTLLMLVSALAGRDNIMNAYNVAVEKEYRFFSFG
QUEA_CLOBL      DIFIYPG--YKYKVVDALITNFHLPQSTLLMLVSALAGRDNIMNAYNVAVEKEYRFFSFG
QUEA_CLOTE      NIFMYPG--YEFKVTDALITNFHLPQSTLIMLVSALSERERVLNAYEIAVREKYRFFSFG
QUEA_CLOAB      DIYIYPG--YKYKIVDGLITNFHLPKSTLVMLVSALSSRDNILNAYKIAVENRYRFFSFG
QUEA_CLOK5      DIFIYPG--YKYKVVDKLITNFHLPKSTLIMLVSAFYGRENTLHAYNVAVKEKYRFFSFG
QUEA_CLOPE      DIFIYPG--YKFKIVDNLITNFHLPESTLIMLVSALAGQDNIMNAYNTAVKEKYRFFSFG
QUEA_CLOP1      DIFIYPG--YKFKIVDNLITNFHLPESTLIMLVSALAGQDNIMNAYNTAVKEKYRFFSFG
QUEA_CLOPS      DIFIYPG--YKFKIVDNLITNFHLPESTLIMLVSALAGQDNIMNAYNTAVKEKYRFFSFG
QUEA_CLOB8      NIFIYPG--YKFKVVDKLITNFHLPESTLIMLVSTLAGRENVMNAYEEAVNEKYRFFSFG
QUEA_HUNT2      DIFIYPG--YKFKVVDSLITNFHLPESTLIMLVSALAGREKILEAYNIAVKERYRFFSFG
QUEA_CLOD6      EIFIYPG--YKFKVLDKLITNFHLPESTLIMLVSAICGKDNVLNAYNEAVKERYRFFSFG
QUEA_LACP7      EIFIYPG--YKFKVLNCLITNFHLPESTLLMLVSALASREHIIAAYEEAVKERYRFFSFG
QUEA_ALKMQ      NIFIFPG--YQFKILDGLITNFHLPESTLIMLVSALLGKEKTLQAYKVAVDEQYRFFSFG
QUEA_CALS4      DIFIYPG--YKFKAIDGMITNFHLPESTLIMMVSAFAGKENIMRAYKVAIENKYRFFSFG
QUEA_SYMTH      DIFIYPG--YRFKAVDALVTNFHLPKSTLLMLVSALAGHDLIMRAYREAVAQRYRFFSFG
QUEA_MOOTA      DIFIYPG--YRFKAIDSLITNFHLPRSTLLMLVSAFAGREKILDAYRVAVREGYRFYSFG
QUEA_DESHY      DIYIYPG--YTFKILDGLITNFHFPKSTLVMLVSALAGRDQILKAYQIAIAEGYRFYSFG
QUEA_DESRM      DIFIYPG--YQFKVIEGLVTNFHLPKSSLLMLISALAGREKILKAYQQAVTEQYRFFSFG
QUEA_PELTS      EIFIYPG--YRFKVIDGLVTNFHLPKSTLIMMVAALAGRERILAAYREAVGLRYRFFSFG
QUEA_CARHZ      DLFIYPG--FNFQIIDGLITNFHLPKSTLLMLVSAFAGREKVLNAYEIAVRLRYRFFSFG
QUEA_FUSNN      GIFIYPG--YKFKIVDALITNFHLPKSTLLMLVSAFYDREKMLEIYNLAVKEKYHFFSFG
QUEA_THEMA      DLFIYPP--FEFKLVDALVTNFHLPRSTLLMLVAAFAGKDFVMEAYREAVKRRYRFFSFG
QUEA_THEP1      DLFIYPP--FEFKLVDALITNFHLPRSTLLMLVAAFAGKDFVMEAYREAVKRRYRFFSFG
QUEA_THEM4      DIFIYPP--FEFKLVDALITNFHLPKSTLLMLVSAFAGREFIMEAYNIAVKMKYRFFSFG
QUEA_DEHMC      DLFILPG--YKFRVADCFITNFHLPRSTPLMLTSAFAGWPFLRKAYEKAISEHYRFYSFG
QUEA_DEHMB      DLFILPG--YKFRVADCFITNFHLPRSTPLMLTSAFAGWPFLRKAYEKAISEHYRFYSFG
QUEA_DEHM1      DLFILPG--YKFKVADCFITNFHLPRSTPLMLTAAFAGWPLLQKAYEKAINEHYRFYSFG
QUEA_FLAJ1      NKFIFPP--HDFSIANCMITNFHTPKSTLLMMISAFCGHDLMKKAYEEAIKEGYKFYSYG
QUEA_FLAPJ      NKFIFPP--HDFSLATCMITNFHTPKSTLMMMISAFCGHDLMKEAYAEAIKEKYKFYSYG
QUEA_BACFN      NKFIFPP--YDFTVANAMVSNFHMPLSTLLMIVAAFGGYDQVMDAYHIALKEGYRFGTYG
QUEA_BACFR      NKFIFPP--YDFTVANAMVSNFHMPLSTLLMIVAAFGGYDQVMDAYHIALKEGYRFGTYG
QUEA_BACV8      NKFIFPP--YDFSVANSMVTNFHLPLSTLLMLVAAYGGYDLVMEAYHTALKEDYRFGTYG
QUEA_PARD8      NKFIFPP--YDFSVATSMVTNFHMPLSTLLMMTASFGGYELIMDAYDIALKEKYRFGAYG
QUEA_CYTH3      DRFIFPP--YDFKIANCMLTNFHMPESTLYMMACAFGGYELMTKAYKTAIKEKYNFLSYG
QUEA_GEOMG      GIFIYPG--YHFKTVDALITNFHLPKSTLLMLVSAFAGKELLFRAYHEAVTRRFRFFSYG
QUEA_GEOSL      DIFIYPG--YRFKAVDALITNFHLPKSTLLMLVSAFAGRDLLFRAYGEAVARRFRFFSYG
QUEA_GEOUR      DIFICPG--YTFKVVDALITNFHLPKSTLLMLVSALAGKDRLFNAYNEAVNRNFRFFSYG
QUEA_PELCD      DLFIRPG--FKFRIVDGLVTNFHLPCSTLLVLVAALAGREFILEAYQRAVAEKFRFFSYG
QUEA_PELPD      DIFIYPG--YRFRVVDALVTNFHLPESTLIMLVSAFAGKEYVFHAYHEAARLGYRFYSYG
QUEA_PELLD      DIFIYPG--CSFRLIDALLTNFHAPRSTVLMLTAAFAGPDLLRRAYREALDKEYRFLSYG
QUEA_CHLPM      DIFIHPG--YSFQTIDALLTNFHAPRSTVLMLTAAFAGADHLRAAYREAVEKRYDFLSYG
QUEA_CHLPD      DIFIYPG--YRFRVIDALLTNFHAPRSTVLMLTAAFAGAEKLFHAYAEALRWEYDFLSYG
QUEA_CHLTE      DIFIYPG--YEFRIIDALITNFHAPRSTVLMLTAAFAEKELLMRAYHEALDNGYRFLSYG
QUEA_CHLCH      DIFIYPG--YRFQMVDLLLTNFHAPRSTVLMLTAACAGTDNLRAAYSEAVLQGYNFLSYG
QUEA_CAUVC      AIFITPG--YRFRTADVLMTNFHLPKSTLFMLVSAFAGTEAMRAAYEHAIATGYRFYSYG
QUEA_CAUSK      AIFITPG--YRFRAADVLMTNFHLPKSTLFMLVSAFAGQATMKAAYEHAIAAGYRFYSYG
QUEA_BRUC2      DIFITPG--YRFRAVDLLMTNFHLPRSTLFMLVSAFSGLDTMHAAYNYAIADGYRFYSYG
QUEA_BRUSU      DIFITPG--YRFRAVDLLMTNFHLPRSTLFMLVSAFSGLDTMHAAYNYAIADGYRFYSYG
QUEA_BRUA2      DIFITPG--YRFRAVDLLMTNFHLPRSTLFMLVSAFSGLDTMHAAYNYAIADGYRFYSYG
QUEA_BRUME      DIFITPG--YRFRAVDLLMTNFHLPRSTLFMLVSAFSGLDTMHAAYNYAIADGYRFYSYG
QUEA_BRUO2      DIFITPG--YRFRAVDLLMTNFHLPRSTLFMLVSAFSGLDTMHAAYNYAIADGYRFYSYG
QUEA_BRUSI      DIFITPG--YRFRAVDLLMTNFHLPRSTLFMLVSAFSGLDTMHAAYNYAIADGYRFYSYG
QUEA_BRUAB      DIFITPG--YRFRAVDLLMTNFHLPRSTLFMLVSAFSGLDTMHAAYNYAIADGYRFYSYG
QUEA_OCHA4      DIFITPG--YKFRAVDLLMTNFHLPRSTLFMLVSAFSGFETMHAAYEHAISNGYRFYSYG
QUEA_RHILO      DIFITPG--YRFRTADMLMTNFHLPRSTLFMLVSAFSGLDTMGAAYAHAIANRYRFYSYG
QUEA_CHESB      DIFITPG--YRFRAIDILMTNFHLPRSTLFMLVSAFSGLETMKSAYSHAIDQGYRFYSYG
QUEA_RHIEC      GIFITPG--YRFKAVDMLMTNFHLPRSTLFMLVSAFSGFETMHAAYKHAISTGYRFYSYG
QUEA_RHIL3      GIFITPG--YRFKAVDMLMTNFHLPRSTLFMLVSAFAGFETMHAAYKHAISTGYRFYSYG
QUEA_AGRFC      GIFITPG--YRFRAVDMLMTNFHLPKSTLFMLVSAFCGLETMRDAYRHAIETGYRFYSYG
QUEA_RHIME      GIFITPG--YRFRAVDMLMTNFHLPKSTLFMLVSAFAGLETMHAAYAHAIATGYRFYSYG
QUEA_SINMW      GIFITPG--YRFRAAHMLMTNFHLPKSTLFMLVSAFAGLETMRDAYAHAIATGYRFYSYG
QUEA_RHOPS      AIFITPG--YRFRAVDALMTNFHLPRSTLFMLVSAFCGLETMQAAYRHAIDSGYRFYSYG
QUEA_RHOPA      SIFITPG--YRFRAVDVLMTNFHLPRSTLFMLVSAFCGLDTMQAAYAHAIRTGYRFYSYG
QUEA_RHOP5      AIFITPG--YRFKAVDVLMTNFHLPRSTLFMLVSAFAGLDTMQRAYAHAIKSGYRFYSYG
QUEA_NITWN      AIFITPG--HRFRAVDILMTNFHLPRSTLFMLVSAFSGLETMKQAYAHAISAGYRFYSYG
QUEA_BRASO      SIFITPG--YRFRAVDILMTNFHLPRSTLFMLVSAFAGLETMQAAYAHAIESGYRFYSYG
QUEA_BRASB      SIFITPG--YRFRAVDILMTNFHLPRSTLFMLVSAFAGLETMQAAYAHAIRSGYRFYSYG
QUEA_BRADU      SIFITPG--YRFRAVDILLTNFHLPKSTLFMLVSAFSGLETMRRAYAHAIAQGYRFYSYG
QUEA_AZOC5      DIFITPG--YAFRASDVMLTNFHLPRSTLVMLVAAFVGHETQKRAYAHAIASGYRFYSYG
QUEA_PARL1      DIFITPG--YRFRAVDVLMTNFHLPRSTLFMLVSALRSTEEMKRAYAHAVAEKYRFYSYG
QUEA_MARMM      DIFLTPG--SDFAITDMLMTNFHLPKSTLFMLVSALSGLDVMQRAYAHAIAAEYRFYSYG
QUEA_HYPNA      DIFLKPG--DPVRATDALMTNFHLPGSSLFMLVSALMGTSLMRAAYAHAIEEKYRFYSYG
QUEA_RHORT      SIFITPG--YRFNAVDRLMTNFHLPRSTLFMLVSAFAGASRMRNAYAHAISQGYRFYSYG
QUEA_SPHWW      AIFITPG--YRFRAIDGLMTNFHLPKSTLFMLVSALMGRDRMQAAYAHAIAEGYRFYSYG
QUEA_NOVAD      SIFITPG--YTFRAIDGLMTNFHLPKSTLFMLVSALMGLDRMQAAYAHAIAGGYRFYSYG
QUEA_SPHAL      SIFITPG--YRFKAIDGLMTNFHLPRSTLFMLVSALMGLETMQAAYAHAIAREYRFYSYG
QUEA_ERYLH      DIFITPG--YRFRAVDGLMTNFHLPKSTLMMLVSALMGRERMMDIYAHAIAQRYRFYSYG
QUEA_ZYMMO      DIFITPG--YRFRVIDGLMTNFHLPKSTLFMLVSALMGREKMLAAYQHAIDTGYRFYSYG
QUEA_GLUDA      AIFIRPG--YRFRAVDVLMTNFHLPRSTLFMLVCAFAGYDRMRDAYAHAVADGYRFYSYG
QUEA_GLUOX      SIFIKPG--YRFKAVDVLMTNFHLPRSTLFMLVCAFSGTETMREAYAYAIANGLRFYSYG
QUEA_ACICJ      ELFITPG--YRFKLVDRLMTNFHLPKSTLLMLVAAFAGVERMRAAYAHAIARGYRFYSYG
QUEA_RUEST      DIFIYPG--FEFRVADALMTNFHLPKSTLMMLVSALMGQDRIRAIYAHAVKERYRFFSYG
QUEA_RUEPO      DIFIYPG--FDFRVADGLMTNFHLPKSTLLMLVSALMGQESIRKIYAHAVENRYRFFSYG
QUEA_ROSDO      DIFIYPG--FRFNVADALMTNFHLPKSTLMMLVSALMGYDEVRAIYDHAVAEKYRFFSYG
QUEA_JANSC      DIFIYPG--YRWQITDALMTNFHLPKSTLLMLVSALMGKDRMDAVYAHAIANQYRFFSYG
QUEA_RHOS4      DIFIYPG--YRFRVTDALMTNFHLPKSTLLMLVSALMGQERIRAIYDHAVRHDYRFFSYG
QUEA_RHOS1      DIFIYPG--YRFRVTDALMTNFHLPKSTLLMLVSALMGQERIRAIYDHAVRHDYRFFSYG
QUEA_RHOS5      DIFIYPG--YRFRVTDALMTNFHLPKSTLLMLVSALMGEARIRAIYDHAVRHDYRFFSYG
QUEA_DINSH      DIFIYPG--FEFRITDGLMTNFHLPKSTLMMLVSALMGAERIREIYAHAIAQEYRFFSYG
QUEA_THET2      RLFIRPP--YTFKVVDALFTNFHLPRSTLLMLVAAFLGRERTLEAYRLAVAEGYRFYSLG
QUEA_THET8      RLFIRPP--YTFKVVDALFTNFHLPRSTLLMLVAAFLGRERTLEAYRLAVAEGYRFYSLG
QUEA_DEIRA      RIFITPG--TRVEVPDLLITNLHLPGSTLLLLVAAFAGEDRIRAAYDAALSQDYRFYSLG
QUEA_RUBXD      ELFIYPG--YEWRAVDALITNFHLPRSTLLALVMSFAGRELVREAYEVAVRERYRFYSFG
QUEA_ANADF      ALFVRPG--HAFRAVDALVTNFHLPRSTLLMLVCAFGGTHRVLAAYRDAVARRYRFFSYG
QUEA_ANADE      ELFIRPG--HPFRAVDAMVTNFHLPRSTLLVLVCAFGGQGRVLAAYREAVARGYRFFSYG
QUEA_SORC5      RLLIQPG--YRFRVVDALLTNFHLPRSTLLALVFAFAGRERTLLAYRAAIDAGYRFYSYG
QUEA_SYNAS      RLFIYPG--YRFKRVQALLTNFHLPKSSLFLLACAFAGKDRIQQAYATAIQEEYRFYSYG
QUEA_SOLUE      DIFLYPG--VPFRRTGAMLTNFHLPRTSLLVLVSAFAGKDLMLAAYRHAVEARYRFYSYG
QUEA_DESVV      DIFMYPG--YTFKVVDHLITNFHLPESSLLMLVSAFAGRERVLATYREAIEEGYRFFSYG
QUEA_DESVH      DIFMYPG--YTFKVVDHLITNFHLPESSLLMLVSAFAGRERVLATYREAIEEGYRFFSYG
QUEA_DESAG      DIFIYPG--YRFNVADHIITNFHLPESSLLMMISAFAGREKTLQAYSQAVAAGYRFFSYG
QUEA_SYNWW      NKYIFPG--YQFRAIDKLLTNFHLPGSSLLMLVAGFAGTESTLAAYRHAVENRYRFFSYG
QUEA_NOSS1      NLFIYPG--YKWQVVEGLITNFHLPRSSLLMLVSALIGRERLLNIYQEAIASQYRFYSFG
QUEA_TRIV2      NLFIYPG--YKWQVVEGLITNFHLPRSSLLMLVSALIGRERLLNIYQEAIASQYRFYSFG
QUEA_THEEB      DLYIYPG--YQPKIVEGFITNFHLPRSSLMMLVSAFIGRERLLQLYQQAIDRQYRFYSFG
QUEA_SYNE7      NLFIYPG--YRWQIIDGLITNFHLPRSSLMMLVSALIGRDRLLSAYATAIAEQYRFYSFG
QUEA_SYNP6      NLFIYPG--YRWQIIDGLITNFHLPRSSLMMLVSALIGRDRLLSAYATAIAEQYRFYSFG
QUEA_ACAM1      NLFIYPS--YQWRVVDGLITNFHLPKSSLLMLVSALVGRERLLALYEDAIAQQYRFYSFG
QUEA_SYNY3      DLFIYPG--YQWRLVDGLITNFHLPKSSLLMLVSALISRPRLMAIYETAIAKGYRFYSFG
QUEA_GLOVI      ELFVYPG--YRWRVVEGLITNFHLPRSSLLMLVSSLVGRERLLALYREAVDKGYRFYSFG
QUEA_SYNSC      DLVIQPG--YRFAVVQGLLTNFHLPKSSLLLLVSALIGREKLLELYHEAIERDYRFFSYG
QUEA_SYNPX      NLVIQPG--YRFAVVQGLMTNFHLPKSSLLLLVSALIGREKLLAIYTEAIERNYRFFSYG
QUEA_SYNS9      NLVIQPG--YRFAVVQGLLTNFHLPKSSLLLLVSALIGREKLLALYAEAIDHEYRFFSYG
QUEA_SYNS3      DLVIQPG--YRFQVVQGLLTNFHLPKSSLLLLVSALIGRDQLLQIYNAAIEEMYRFYSYG
QUEA_SYNPW      DLVIQPG--YQFRVVDGLLTNFHLPKSSLLLLVSALIGRERLLDLYALAIANDYRFYSYG
QUEA_PROMM      DLVIQPG--YRFAVVDGLLTNFHLPKSSLLLLVSAMVGRERLLALYAEAIEHQYRFFSYG
QUEA_PROM3      DLVIQPG--YRFAVVDGLLTNFHLPKSSLLLLVSAMVGRERLLALYAEAIEHHYRFFSYG
QUEA_SYNR3      NLVIQPG--FRFAVVQGLLTNFHLPKSSLLLLVSALIGRERLLQLYQHAITAGYRFYSYG
QUEA_PROMA      DLVIKPG--YKFGIVDGLLTNFHLPKSSLLLLVSALIGRENLLELYKEAIDQKYRFFSYG
QUEA_PROMT      DLVIKPG--FKFSVIDGLLTNFHLPKSSLLLLVSALIGRKRMLKLYKQAISNKYRFFSYG
QUEA_PROM1      NLVIKPG--FKFSVIDGLLTNFHLPKSSLLLLVSALIGRNRMLKLYKHAISNKYRFFSYG
QUEA_PROMP      DLVIKPG--YKFKVVDGLLTNFHLPKSSLLLLVSAMIGRERLLNLYKKAIREKFRFFSYG
QUEA_DESPS      ALYIYPG--FKFQVIDNLITNFHLPDSSLMFLVSALCRREKLLECYQMAIKEDYRFFSYG
QUEA_AQUAE      DLYIYPG--FKFKVVDAMITNFHLPRSSLLILVSAFAGREFILKAYREAVEKRYRFYSYG
QUEA_NITSB      DLFLNPL--NPPKRVDHLLTNFHLPKSTLIMLVASFIGLETTKRVYQEAIEKEYRFYSYG
QUEA_ARCB4      DLFLNPA--NKPIKVDYLLTNFHLPKSTLIMLVASFIGLEKTLEIYETAIKENYRFYSYG
QUEA_CAMJE      DLFLHPQ--NPPIRQNHLLTNFHLPKSTLIMLVSAFIGREQCLKLYELAIKEKYRFYSYG
QUEA_SULDN      NLFLHPK--NKPLRVDHILTNFHLPKSTLLMLVASFVGVDKAQELYKIAIEKEYRFYSYG
QUEA_HELPJ      DIFLHLA--NPIQHVNHLLTNFHLPKSSLLMLVSAMIGLEKTKEIYKIAIEKKYRFYSYG
QUEA_HELPH      DIFLHLA--NPIQHVNYLLTNFHLPKSSLLMLVSAMIGLEKTKEIYKIAIEKKYRFYSYG
QUEA_HELPY      DIFLHFA--NPILHVNYLLTNFHLPKSSLLMLVSTMIGLEKTKEIYKTAIEKKYRFYSYG
QUEA_HELAH      DIFLHLA--NPIQHANYLLTNFHLPKSSLLMLVSAMIGLEKTKEIYQIAIEKKYRFYSYG
QUEA_HELHP      DIFLYPS--KSFKRVDYLLTNFHLPKSTLMMLVSAMVGREKCLELYKLALEKGYRFYSYG
QUEA_RICBR      DIFITPG--FKFQIVDMLLTNFHFPKSTLFMLVCAFAGFKKMHELYKYAIEEQMRFFSYG
QUEA_RICB8      DIFITPG--FKFQIVDMLLTNFHFPKSTLFMLVCAFAGFKEMHELYKYAIEEQMRFFSYG
QUEA_RICRS      DIFITPG--FKFQTADMLLTNFHFPKSTLFMLICAFAGFKEMHELYKYAIKEAMRFFSYG
QUEA_RICRO      DIFITPG--FKFQTADMLLTNFHFPKSTLFMLICAFAGFKEMHELYKYAIKEAMRFFSYG
QUEA_RICAH      DIFITPG--FKFQTADMLLTNFHFPKSTLFMLICAFAGFKEMHELYKYAIKEKMRFFSYG
QUEA_RICFE      DIFITPG--FKFQTTDMLLTNFHFPKSTLFMLICAFAGFKEMHELYKYAIKEKMRFFSYG
QUEA_RICTY      DIFITPG--FNFQIVDMLLTNFHFPKSTLFILICAFAGFKEMHALYKYAIKEKMRFFSYG
QUEA_RICCK      DIFITPG--FKFQTADILLTNFHFPKSTLFMLICAFAGFKEMHKLYKYAIKEKMRFFSYG
QUEA_BORBP      NLFIYPGKNYCFKFVDMLFTNFHTPQSTLLMLVSSFAGKDFVFSSYEEAINKGYKFFSYG
QUEA_BORAP      NLFIYPGKNYCFKFVDMLFTNFHTPQSTLLMLVSAFAGKDFVFSSYEEGINKGYKFFSYG
QUEA_BORBU      NLFIYPGKNYCFKFVDMLFTNFHTPQSTLLMLVSSFAGKDFVFSFYEEAINKGYKFFSYG
QUEA_TREDE      DIFIYP--SYKFKLIDKLFTNFHTPESSLVMLVSALAGKENIFKAYRHAVEEKYKFFSYG
                   :               :*:* . ::   :             *  .      * : *

QUEA_SHISS      DAMFITYNPQAINERVGE---------------
QUEA_ECOHS      DAMFITYNPQAINERVGE---------------
QUEA_SHIFL      DAMFITYNPQAINERVGE---------------
QUEA_SHIDS      DAMFITYNPQAINERVGE---------------
QUEA_ECO57      DAMFITYNPQAINERVGE---------------
QUEA_ECO24      DAMFITYNPQAINERVGE---------------
QUEA_SHIF8      DAMFITYNPQAINERVGE---------------
QUEA_ECOLI      DAMFITYNPQAINERVGE---------------
QUEA_ECOLC      DAMFITYNPQAINERVGE---------------
QUEA_ECOL5      DAMFITYNPQAINERVGE---------------
QUEA_ECOL6      DAMFITYNPQAINERVGE---------------
QUEA_SHIBS      DAMFITYNPQAINERVGE---------------
QUEA_ECOK1      DAMFITYNPQAINERVGE---------------
QUEA_ECOUT      DAMFITYNPQAINERVGE---------------
QUEA_SALPB      DAMFITYNPQAISERP-----------------
QUEA_SALTY      DAMFITYNPQAISERP-----------------
QUEA_SALCH      DAMFITYNPQAISERP-----------------
QUEA_SALPA      DAMFITYNPRAISERP-----------------
QUEA_SALTI      DAMFITCNPQAISERP-----------------
QUEA_SALAR      DAMFITYNPQAIFERVGE---------------
QUEA_CITK8      DAMFITYNPQALNERVGK---------------
QUEA_ENT38      DAMFITYNPQALNERVGE---------------
QUEA_KLEP7      DAMFITYNPQAISERP-----------------
QUEA_CROS8      DAMYITYNPQAINERPGE---------------
QUEA_YERPE      DAMFISRNPRAPQEKVSP---------------
QUEA_YERPS      DAMFISRNPRAPQEKVSP---------------
QUEA_YERP3      DAMFISRNPRAPQEKVSP---------------
QUEA_YERE8      DAMFISRNPQASTEMISLNSTDNQ---------
QUEA_SERP5      DAMFISRNPQAEQESVGA---------------
QUEA_PECAS      DAMFITHSPMAEQEKVG----------------
QUEA_PHOLL      DAMFIRRNPFACKEKIS----------------
QUEA_SODGM      DAMFITRNPAAAAERG-----------------
QUEA_BAUCH      DAMFITNNNSVF---------------------
QUEA_VIBCH      DAMFIRKQMTKA---------------------
QUEA_VIBC3      DAMFIRKQTTKA---------------------
QUEA_VIBPA      DSMFIKKKTI-----------------------
QUEA_VIBCB      DSMFIKKKTA-----------------------
QUEA_VIBVU      DAMFIEKKTQ-----------------------
QUEA_VIBVY      DAMFIEKKTQ-----------------------
QUEA_ALIF1      DAMFITKKTA-----------------------
QUEA_PHOPR      DSMFITRRNNV----------------------
QUEA_AERHH      DAMFVTRRRAQA---------------------
QUEA_AERS4      DAMFVTRRRAVA---------------------
QUEA_COLP3      DAMFLTKQELIKQDTP-----------------
QUEA_PSEA6      DAMFIEKNQD-----------------------
QUEA_SHEPA      DAMFVTKKAN-----------------------
QUEA_SHEHH      DAMFVTKKAN-----------------------
QUEA_SHELP      DAMFVTKKAI-----------------------
QUEA_SHESM      DAMFVTKKAH-----------------------
QUEA_SHESA      DAMFVTKKAH-----------------------
QUEA_SHESR      DAMFVTKKAH-----------------------
QUEA_SHEON      DAMFVTKKAH-----------------------
QUEA_SHESW      DAMFVTKKAH-----------------------
QUEA_SHEPC      DAMFVTKKAH-----------------------
QUEA_SHEB8      DAMFVTKKAH-----------------------
QUEA_SHEB9      DAMFVTKKAH-----------------------
QUEA_SHEB5      DAMFVTKKAH-----------------------
QUEA_SHEFN      DAMFVTKKAP-----------------------
QUEA_SHEDO      DAMFLTKKAQ-----------------------
QUEA_SHEAM      DAMFVTKKAP-----------------------
QUEA_PSEHT      DAMFLTRK-------------------------
QUEA_HAEIG      DAMFINKN-SNVRGLE-----------------
QUEA_HAEIE      DAMFINKN-SNVRELE-----------------
QUEA_HAEI8      DAMFINKN-SNVRELE-----------------
QUEA_HAEIN      DAMFINKN-SNVRGLE-----------------
QUEA_HAES1      DAMFITKA-------------------------
QUEA_HISS2      DAMFITKA-------------------------
QUEA_PASMU      DAMFISKN-PHVNGLD-----------------
QUEA_MANSM      DAMFITKN-NHVKGLD-----------------
QUEA_HAEDU      DAMLINKNPNALNDLP-----------------
QUEA_ACTP2      DAMFINKNPNALNDLP-----------------
QUEA_MARMS      DAMFVTRNPQAKGPQGEE---------------
QUEA_PSEAB      DAMFITRNPAPR-----GPED------------
QUEA_PSEAE      DAMFITRNPAPR-----GPED------------
QUEA_PSEA7      DAMFITRNPAPR-----GPED------------
QUEA_PSEMY      DAMFITRNPAAR-----GPEV------------
QUEA_PSEP1      DAMFITRNPAPR-----GPEDQA----------
QUEA_PSEPK      DAMFITRNPAPR-----GPEDQA----------
QUEA_PSEPG      DAMFITRNPAPR-----GPEDQA----------
QUEA_PSEE4      DAMFITRNPAPR-----GPEDQA----------
QUEA_PSEU2      DAMFITRNPAPTAPQESAPEDHA----------
QUEA_PSE14      DAMFITRNPAPTAPQESAPEDHA----------
QUEA_PSESM      DAMFITRNPAPTAPQESAPEDHA----------
QUEA_PSEF5      DAMFITRNPAPTAPKDLAPEETV----------
QUEA_PSEPF      DAMFITRNPAPR-----GPEETV----------
QUEA_SACD2      DAMFITHNAEAC------KEEIK----------
QUEA_MARHV      DAMFLTAQEPSRGMMLGTDSAEPHQTESRGESQ
QUEA_IDILO      DAMLLQR--------------------------
QUEA_CHRSD      DAMFLNRS--ASSHPFPENSHA-----------
QUEA_ALKEH      DAMFIAAG--AADE-------------------
QUEA_HAHCH      DAMFLHR-----RQSGLEDAGAN----------
QUEA_ALCBS      DAMFIEGTQPASRNTQHVKSGADE---------
QUEA_HYDCU      DAMLVHPPTSDS---------------------
QUEA_XYLFT      DAMLLFPRNAGEQ--------------------
QUEA_XYLFA      DAMLLFPRNAGEQ--------------------
QUEA_XANAC      DAMLLWGRESGLGNGES----------------
QUEA_XANC5      DAMLLWGGESGVGNGES----------------
QUEA_XANOR      DAMLLWSRAWGLGSGDS----------------
QUEA_XANCP      DAMLLWSREWGIGNGES----------------
QUEA_XANC8      DAMLLWSREWGIGNGES----------------
QUEA_METCA      DAMFVTPNEPAANR-------------------
QUEA_NITOC      DAMFITEAKTG----------------------
QUEA_CUPMC      DAMLLTRRDRRA---------------------
QUEA_CUPPJ      DAMLLTRQ-------------------------
QUEA_CUPNH      DAMLLTRQPGA----------------------
QUEA_RALSO      DAMFLTRAEPDTQSASPDPSC------------
QUEA_BURCA      DAMLLTRRDTPEAPGA-----------------
QUEA_BURCH      DAMLLTRRDTPEAPGA-----------------
QUEA_BURL3      DAMLLTRRDTPEAPLA-----------------
QUEA_BURVG      DAMLLTRRDTPEHA-------------------
QUEA_BURCM      DAMLLTRRDTPEAPQA-----------------
QUEA_BURP0      DAMLLTRRDDAAEATHGGA--------------
QUEA_BURP1      DAMLLTRRDDAAEATHGGA--------------
QUEA_BURP6      DAMLLTRRDDAAEATHGGA--------------
QUEA_BURPS      DAMLLTRRDDAAEATHGGA--------------
QUEA_BURMS      DAMLLTRRDDAAEATHGGA--------------
QUEA_BURM9      DAMLLTRRDDAAEATHGGA--------------
QUEA_BURM7      DAMLLTRRDDAAEATHGGA--------------
QUEA_BURMA      DAMLLTRRDDAAEATHGGA--------------
QUEA_PARXL      DAMLLTRRDA-----------------------
QUEA_JANMA      DAMFLTRMPPC----------------------
QUEA_HERAR      DAMFLTRMPPC----------------------
QUEA_AZOSB      DAMLLTRNDHAI---------------------
QUEA_AROAE      DAMFITHRNDAI---------------------
QUEA_DECAR      DAMLLERTGQPSDAI------------------
QUEA_BORPA      DAMFIETPAP-----------------------
QUEA_BORBR      DAMFIETPAP-----------------------
QUEA_BORPE      DAMFIETPAP-----------------------
QUEA_THIDA      DAMFLEKASLETPA-------------------
QUEA_NEIM0      DAMVLGRNEGVVR--------------------
QUEA_NEIMA      DAMVLGRNEGVVR--------------------
QUEA_NEIMB      DAMVLGRNEGVVR--------------------
QUEA_NEIG1      DAMVLGRNEGGGL--------------------
QUEA_CHRVO      DAMLLEKKV------------------------
QUEA_NITEU      DAMLIDSQP------------------------
QUEA_NITEC      DAMLIEGDSRS----------------------
QUEA_NITMU      DAMLIGRAEGI----------------------
QUEA_POLAQ      DAMFL-CRLENIKP-------------------
QUEA_DICNV      DAMFLPHRLPALETLL-----------------
QUEA_PSYWF      DAMLLERNL------------------------
QUEA_PSYA2      DAMLLDKQVD-----------------------
QUEA_ACIAD      DAMLIDQAV------------------------
QUEA_LEGPL      DASLLL---------------------------
QUEA_LEGPH      DASLLL---------------------------
QUEA_LEGPA      DASLLL---------------------------
QUEA_LEGPC      DASLLL---------------------------
QUEA_COXBU      DAMLIS---------------------------
QUEA_COXBN      DAMLIS---------------------------
QUEA_COXBR      DAMLIS---------------------------
QUEA_BUCAI      DAMYITHNKLAPYENFII---------------
QUEA_BUCAP      DAMYITYNTHAPYEKILT---------------
QUEA_BLOFL      DSMFITCRSE-----------------------
QUEA_VESOH      DAMFLEKNNDL----------------------
QUEA_FRATH      DAMFIF---------------------------
QUEA_FRATO      DAMFIF---------------------------
QUEA_FRATF      DAMFIF---------------------------
QUEA_FRATW      DAMFIF---------------------------
QUEA_FRATT      DAMFIF---------------------------
QUEA_FRAT1      DAMFIF---------------------------
QUEA_FRATN      DAMFIY---------------------------
QUEA_FRAP2      DAMFIF---------------------------
QUEA_GEOKA      DAMLII---------------------------
QUEA_GEOTN      DAMLII---------------------------
QUEA_BACSU      DAMLII---------------------------
QUEA_BACVZ      DAMLII---------------------------
QUEA_BACP2      DAMLIQ---------------------------
QUEA_BACLD      DAMLIK---------------------------
QUEA_BACHD      DAMFIYDKKTNS---------------------
QUEA_BACHK      DAMFVASHAKMGNK-------------------
QUEA_BACC1      DAMFVASHAKMGNK-------------------
QUEA_BACAN      DAMFVASHAKMGNK-------------------
QUEA_BACCZ      DAMFVASHAKMGNK-------------------
QUEA_BACCR      DAMFVASHAKMRNK-------------------
QUEA_BACCN      DAMFLASHAKERMK-------------------
QUEA_OCEIH      DAMLIL---------------------------
QUEA_LISMO      DAMFIH---------------------------
QUEA_LISMF      DAMFIH---------------------------
QUEA_LISIN      DAMFIH---------------------------
QUEA_LISW6      DAMFIH---------------------------
QUEA_BACSK      DAMFIRP--------------------------
QUEA_STRT2      DAMFVTRPSEK----------------------
QUEA_STRTD      DAMFVTRPSEK----------------------
QUEA_STRT1      DAMFVTRPSEK----------------------
QUEA_STRA1      DAMFVK---------------------------
QUEA_STRA5      DAMFVK---------------------------
QUEA_STRA3      DAMFVK---------------------------
QUEA_STRP8      DAMFVN---------------------------
QUEA_STRPF      DAMFVN---------------------------
QUEA_STRP6      DAMFVN---------------------------
QUEA_STRPB      DAMFVN---------------------------
QUEA_STRPM      DAMFVN---------------------------
QUEA_STRPC      DAMFVN---------------------------
QUEA_STRPG      DAMFVN---------------------------
QUEA_STRP1      DAMFVN---------------------------
QUEA_STRP3      DAMFVN---------------------------
QUEA_STRPD      DAMFVN---------------------------
QUEA_STRMU      DAMFVK---------------------------
QUEA_STRP2      DAMFIY---------------------------
QUEA_STRR6      DAMFIY---------------------------
QUEA_STRPN      DAMFIY---------------------------
QUEA_STRSV      DAMFIK---------------------------
QUEA_LACLM      DAMFVRSKNK-----------------------
QUEA_LACLA      DAMFVRPKK------------------------
QUEA_LACPL      DAMFIH---------------------------
QUEA_LACBA      DAMFIK---------------------------
QUEA_PEDPA      DAMFIK---------------------------
QUEA_LACSS      DAMFVK---------------------------
QUEA_ENTFA      DAMFIK---------------------------
QUEA_STAAM      DAMLII---------------------------
QUEA_STAA9      DAMLII---------------------------
QUEA_STAA2      DAMLII---------------------------
QUEA_STAA1      DAMLII---------------------------
QUEA_STAAB      DAMLII---------------------------
QUEA_STAAW      DAMLII---------------------------
QUEA_STAAN      DAMLII---------------------------
QUEA_STAAR      DAMLII---------------------------
QUEA_STAAS      DAMLII---------------------------
QUEA_STAAE      DAMLII---------------------------
QUEA_STAAC      DAMLII---------------------------
QUEA_STAA8      DAMLII---------------------------
QUEA_STAAT      DAMLII---------------------------
QUEA_STAA3      DAMLII---------------------------
QUEA_STAHJ      DAMLII---------------------------
QUEA_STAES      DAMLII---------------------------
QUEA_STAEQ      DAMLII---------------------------
QUEA_STAS1      DAMLII---------------------------
QUEA_CLOBH      DAMFIK---------------------------
QUEA_CLOB1      DAMFIK---------------------------
QUEA_CLOBL      DAMFIK---------------------------
QUEA_CLOTE      DAMFVK---------------------------
QUEA_CLOAB      DAMFIK---------------------------
QUEA_CLOK5      DAMFIK---------------------------
QUEA_CLOPE      DSMFIK---------------------------
QUEA_CLOP1      DSMFIK---------------------------
QUEA_CLOPS      DSMFIK---------------------------
QUEA_CLOB8      DAMFIK---------------------------
QUEA_HUNT2      DAMFIK---------------------------
QUEA_CLOD6      DAMIIK---------------------------
QUEA_LACP7      DAMFITDNIIETKDTF-----------------
QUEA_ALKMQ      DAMLIV---------------------------
QUEA_CALS4      DAMLII---------------------------
QUEA_SYMTH      DAMLIL---------------------------
QUEA_MOOTA      DAMLIL---------------------------
QUEA_DESHY      DAMMIL---------------------------
QUEA_DESRM      DAMLII---------------------------
QUEA_PELTS      DAMLII---------------------------
QUEA_CARHZ      DAMLII---------------------------
QUEA_FUSNN      DSMFIY---------------------------
QUEA_THEMA      DAMLIL---------------------------
QUEA_THEP1      DAMLIL---------------------------
QUEA_THEM4      NACFIY---------------------------
QUEA_DEHMC      DAMLIL---------------------------
QUEA_DEHMB      DAMLIL---------------------------
QUEA_DEHM1      DAMLVL---------------------------
QUEA_FLAJ1      DAMLIL---------------------------
QUEA_FLAPJ      DAMLII---------------------------
QUEA_BACFN      DAMLILDK-------------------------
QUEA_BACFR      DAMLILDK-------------------------
QUEA_BACV8      DAMLILDK-------------------------
QUEA_PARD8      DAMLIL---------------------------
QUEA_CYTH3      DVMLII---------------------------
QUEA_GEOMG      DAMFVH---------------------------
QUEA_GEOSL      DAMFIF---------------------------
QUEA_GEOUR      DAMFIY---------------------------
QUEA_PELCD      DCMLIL---------------------------
QUEA_PELPD      DAMFIE---------------------------
QUEA_PELLD      DSTLIL---------------------------
QUEA_CHLPM      DSMLIS---------------------------
QUEA_CHLPD      DSMLIL---------------------------
QUEA_CHLTE      DSMFIS---------------------------
QUEA_CHLCH      DSMLIC---------------------------
QUEA_CAUVC      DSSLLFKDETC----------------------
QUEA_CAUSK      DGSLLFRAATDENGSEQS---------------
QUEA_BRUC2      DASLLERIDHDRHSA------------------
QUEA_BRUSU      DASLLERIDHDRHSA------------------
QUEA_BRUA2      DASLLERIDHDRHSA------------------
QUEA_BRUME      DASLLERIDHDRHSA------------------
QUEA_BRUO2      DASLLERIDHDRHSA------------------
QUEA_BRUSI      DASLLERIDHDRHSA------------------
QUEA_BRUAB      DASLLERIDHDRHSA------------------
QUEA_OCHA4      DASLLERADKAKDTA------------------
QUEA_RHILO      DASLLYRAEMSDG--------------------
QUEA_CHESB      DSSLLFREDT-----------------------
QUEA_RHIEC      DASLLFRKDK-----------------------
QUEA_RHIL3      DASLLFRKDR-----------------------
QUEA_AGRFC      DSSLLFRKN------------------------
QUEA_RHIME      DSSLLFRKD------------------------
QUEA_SINMW      DSSLLFRKD------------------------
QUEA_RHOPS      DASLLFREPASR---------------------
QUEA_RHOPA      DASLLFRNDITP---------------------
QUEA_RHOP5      DACLLFRNPS-----------------------
QUEA_NITWN      DACLLFPERAGA---------------------
QUEA_BRASO      DACLLFRQPDERVVEP-----------------
QUEA_BRASB      DACLLFRQPDERIVEP-----------------
QUEA_BRADU      DACLLFRAGGTEVHDPSPP--------------
QUEA_AZOC5      DACLLER--------------------------
QUEA_PARL1      DACLIYGAS------------------------
QUEA_MARMM      DACLLERRT------------------------
QUEA_HYPNA      DACLLLP--------------------------
QUEA_RHORT      DSSLLSHAEDPR---------------------
QUEA_SPHWW      DSSLLLPG-------------------------
QUEA_NOVAD      DSSLLLP--------------------------
QUEA_SPHAL      DASLLLPRQSGRSRTLS----------------
QUEA_ERYLH      DSSLLIPEGNTK---------------------
QUEA_ZYMMO      DSSLLLPK-------------------------
QUEA_GLUDA      DACLLHRAPVAGEQGL-----------------
QUEA_GLUOX      DACLLERAP------------------------
QUEA_ACICJ      DASLLERA-------------------------
QUEA_RUEST      DASLLIP--------------------------
QUEA_RUEPO      DASLLLPG-------------------------
QUEA_ROSDO      DASLLIPQRD-----------------------
QUEA_JANSC      DASLLFPSQKGQTSR------------------
QUEA_RHOS4      DASLLIPGG------------------------
QUEA_RHOS1      DASLLIPGG------------------------
QUEA_RHOS5      DASLLIPGG------------------------
QUEA_DINSH      DSSLLLPDRGA----------------------
QUEA_THET2      DAMLIL---------------------------
QUEA_THET8      DAMLIL---------------------------
QUEA_DEIRA      DAMLLERLTSA----------------------
QUEA_RUBXD      DAMLLLGGGRSLR--------------------
QUEA_ANADF      DAMLLARAD------------------------
QUEA_ANADE      DAMLLLRR-------------------------
QUEA_SORC5      DAMLIRGVDAP----------------------
QUEA_SYNAS      DCMLII---------------------------
QUEA_SOLUE      DCMLIV---------------------------
QUEA_DESVV      DAMLLR---------------------------
QUEA_DESVH      DAMLLR---------------------------
QUEA_DESAG      DAMLIL---------------------------
QUEA_SYNWW      DAMLVI---------------------------
QUEA_NOSS1      DAMLILPEARGVEQ-------------------
QUEA_TRIV2      DAMLILPEARGVNSH------------------
QUEA_THEEB      DAMLILPSACHNTL-------------------
QUEA_SYNE7      DAMLILPDAKLP---------------------
QUEA_SYNP6      DAMLILPDAKLP---------------------
QUEA_ACAM1      DAMLVLPEAVIAERSPDPVF-------------
QUEA_SYNY3      DAMVILPEACRGQEKIR----------------
QUEA_GLOVI      DAMLILPGAGA----------------------
QUEA_SYNSC      DAMWIAPEVVLPEVQPRP---------------
QUEA_SYNPX      DAMWIAPEAVLSQAEPVGH--------------
QUEA_SYNS9      DAMWISPDAVLPGVTPN----------------
QUEA_SYNS3      DAMWIAPEAVLFDARPE----------------
QUEA_SYNPW      DAMWIAPGAVLMDARPR----------------
QUEA_PROMM      DAMWIDPEAVLPAARPC----------------
QUEA_PROM3      DAMWIDPGAVLPAARPC----------------
QUEA_SYNR3      DAMWIPPECSRQP--------------------
QUEA_PROMA      DAMFISPEGVLPSARL-----------------
QUEA_PROMT      DAMLITPESVI----------------------
QUEA_PROM1      DAMLITPESVI----------------------
QUEA_PROMP      DAMYISPDSFLVKK-------------------
QUEA_DESPS      DAMAVISGE------------------------
QUEA_AQUAE      DGMLIL---------------------------
QUEA_NITSB      DAMLIL---------------------------
QUEA_ARCB4      DGMLII---------------------------
QUEA_CAMJE      DAMLIL---------------------------
QUEA_SULDN      DAMLIL---------------------------
QUEA_HELPJ      DGMLIL---------------------------
QUEA_HELPH      DGMLIL---------------------------
QUEA_HELPY      DGMLIL---------------------------
QUEA_HELAH      DGMLIL---------------------------
QUEA_HELHP      DGMLIL---------------------------
QUEA_RICBR      DATLLYRKV------------------------
QUEA_RICB8      DATLLYKKV------------------------
QUEA_RICRS      DATLLCRK-------------------------
QUEA_RICRO      DATLLCRK-------------------------
QUEA_RICAH      DATLLYRK-------------------------
QUEA_RICFE      DATVLYRKV------------------------
QUEA_RICTY      DATLLYRKV------------------------
QUEA_RICCK      DATLLYRKI------------------------
QUEA_BORBP      DAMLVLNHI------------------------
QUEA_BORAP      DAMLVLNHI------------------------
QUEA_BORBU      DAMLILNNI------------------------
QUEA_TREDE      DAMLIL---------------------------
                :   :