CLUSTAL format seed alignment for MF_00114

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

DEOC_NOSS1       ---------------------MAAGYPNIDIAPFIDHALLTPTATPEQVDQWCEQADRYN
DEOC_AQUAE       ---------------------------MIDVRKYIDNAALKPHLSEKEIEEFVLKSEELG
DEOC_CORGL       -----------------------MTISRSTMAQILDYTLLGPEVTNSELAAFIDSAIELG
DEOC_MYCLE       ---------------------MQGQPTRKQLAALVDHTLLKSEATHADVAALVAEAVELG
DEOC_MYCTU       ---------------------MLGQPTRAQLAALVDHTLLKPETTRADVAALVAEAAELG
DEOC_DEIRA       ----------------------------MSLASYIDHTLLKATATLADIRTLCEEAREHS
DEOC_MYCGE       --------------------------MKLEYNRIIDSTLVKADTLPHEIDTLCADAHKYQ
DEOC_MYCPN       --------------------------MKLEYNRIIDSTLLKADTLPHEIDALCADAHKYQ
DEOC_MYCPI       ----------------------------MNYNSLFDHTLLRADASVEEIKQLCDEAVKFN
DEOC_MYCHO       ---------------------------MTELNKYIDHTNLSPSATSKDIDKLIQEAIKYD
DEOC_MYCPU       ----------------------------MELNKYIDHTLLKPEAKSKDIDKLIDEAKKYN
DEOC_BACHD       --------------------------MSRSIAQMIDHTLLKPNTTEDQIVKLCEEAKEYS
DEOC_LISIN       ----------------------------MTIAKMIDHTALKPDTTKEQILTLTKEAREYG
DEOC_LISMO       ----------------------------MTIAKMIDHTALKPDTTKEQILTLTKEAREYG
DEOC_BACSU       ----------------------------MSLANIIDHTALKPHTQKADILKLIEEAKTYK
DEOC_CLOAB       ----------------------------MNIAKIIDHTALKPDTTKEQILKLIEEAKQNN
DEOC_CLOPE       -------------------------MDKQQLAKMIDHTILKPEADKASIEKLCKEALEYN
DEOC_LACLA       ----------------------------MQINKYIDHTILKADAPKSKVQQIIDEAKKYD
DEOC_HAEIN       -------------------------MTSNQLAQYIDHTALTAEKNEQDISTLCNEAIEHG
DEOC_PASMU       -------------------------MDAKQIAQFIDHTALTAEKTEQDIIQLCDEAITHQ
DEOC_RHIME       ------------MNNISNRRQPPASLAPRDLAALIDISAVQAFHTEADVRELAGIAVAEG
DEOC1_STAAM      ----------------------------MKFEKYIDHTLLKPESTRTQIDQIIDEAKAYN
DEOC2_STAAW      ----------------------------MHSAKLIDHTLLKPESTRTQIDQIIDEAKAYH
DEOC1_STAAW      ----------------------------MKFEKYIDHTLLKPESTRTQIDQIIDEAKAYN
DEOC2_STAAM      ----------------------------MNSAKLIDHTLLKPESTRTQIDQIIDEAKAYH
DEOC_STRPN       ----------------------------MKLNKYIDHTLLKQDAKKKQIDSLLSEAREYD
DEOC_CALS4       --------------------MLKKEESLMNIAKMIDHTLLKPNATKEEIKKVCEEAREYG
DEOC1_YERPE      --------------------------MTTNYAHYIDHTLLAMDATEAQIIKLCEEAKQHH
DEOC_METTH       -------------------MVKMNVETREELASLIDHTNVRADATENDIERLCREAVSYG
DEOC_THEMA       MIEYRIEEAVAKYREFYEFKPVRESAGIEDVKSAIEHTNLKPFATPDDIKKLCLEARENR
DEOC_STRP1       -------------------------MEVKDILKTVDHTLLATTATWPEIQTILDDAMAYE
DEOC_STRP3       -------------------------MEVKDILKTVDHTLLATTATWPEIQTILDDAMAYE
DEOC_UREPA       ---------------------------MNKYNIYVDHTLLKADASLEEIHKLCEEAEENE
DEOC_SYNY3       ----------------------MEKSRQFDLAPYIDHAALDPATTREAIATCCAQALHHK
DEOC_TREPA       ----------------------------MELNAYIDHTLLRPSASEAEVLRLCQEAQHYR
DEOC_HALSA       -------------------------MDRETLAARIDHTVLGPTTTRADVLSVVDDAEAHG
DEOC_AERPE       ----------MPSARDILQQGLDRLGSPEDLASRIDSTLLSPRATEEDVRNLVREASDYG
DEOC_PYRAE       ------------------------------MIHLVDYALLKPYLTVDEAVAGARKAEELG
DEOC_THEAC       -----------------------MKYSIEQVMRLVDHSGLKPYLTEKDIARLIEEAKDMG
DEOC_THEVO       -----------------------MKYSLKTVMSLVDHSGLKPYLREDEIARLIGEASEMG
                                                   .: : :               :    

DEOC_NOSS1       FASVCLYPTYVKQAAEFLHGK--KPKVCTVIGFPTGATTRSVKLYEALEAVENGATELDV
DEOC_AQUAE       IYAVCVNPYHVKLASSIAK----KVKVCCVIGFPLGLNKTSVKVKEAVEAVRDGAQELDI
DEOC_CORGL       VGTICVPNSMVNLTAKA-QEA--GIRVATVAGFPHGKTPALVKAAEARLAVQSGASEVDV
DEOC_MYCLE       VYAVCVSPSMVPAAVEAGA-G--GLRVATVVGFPSGEHVSIVKAQEAVQAVASGATEIDM
DEOC_MYCTU       VYAVCVSPSMVPVAVQ---AG--GVRVAAVTGFPSGKHVSSVKAHEAAAALASGASEIDM
DEOC_DEIRA       FYAVCINPVFIPHARAWLEGS--DVKVATVCGFPLGAISSEQKALEARLSAETGADEIDM
DEOC_MYCGE       FFAVCVNPSYVSYAKNILKNT--AVQLCCVVGFPLGQTTQKQKVYEAKIAIKEGADEIDM
DEOC_MYCPN       FYAVCVNPSYVRYAKNILKGT--GVKLCTVVGFPLGQTTQRQKVYETKIAIKEGADEIDM
DEOC_MYCPI       FFSVCVNPSYVPYVKEQLHNS--SVKICTVVGFPLGQTSTKQKVYETKIAIKEGADEIDM
DEOC_MYCHO       FKSVCIAPSYVKYAKEALKNS--DVLVCTVIGFPLGYNATSVKVYETKIAVEHGADEIDM
DEOC_MYCPU       FKAICINSSWVKYAKEKLKDS--DIKIASVIDFPFGAAITQAKVQEAKLAISHGASEIDM
DEOC_BACHD       FASVCVNPTWVALAAQLLKDA-PDVKVCTVIGFPLGATTPEVKAFETTNAIENGATEVDM
DEOC_LISIN       FASVCVNPTWVKLSAEQLSGA--ESVVCTVIGFPLGANTPEVKAFEVKNAIENGAKEVDM
DEOC_LISMO       FASVCVNPTWVKLSAEQLAGA--ESVVCTVIGFPLGANTPEVKAFEVKDAIQNGAKEVDM
DEOC_BACSU       FASVCVNPTWVELAAKELKGT--GVDVCTVIGFPLGANTTETKAFETKDAISKGATEVDM
DEOC_CLOAB       FASVCVNPKWVKEASCALKDS--SVKVCTVIGFPLGANTTATKVFETQDAIKNGAEEVDM
DEOC_CLOPE       FASVCINPTNVELAAKLLKGS--EVKVCTVIGFPLGANTMEVKAFETKDAIAKGADEVDM
DEOC_LACLA       FMSVCINPTWVSYASQELKDS--DVKVCTVIGFPLGANTSELKAFEAKNAIENGADEIDM
DEOC_HAEIN       FYSVCINSAYIPLAKEKLAGS--NVKICTVVGFPLGANLTSVKAFETQESIKAGANEIDM
DEOC_PASMU       FWSVCINSAYIPLAKQKLAGT--PVKICTVVGFPLGANLSTVKAFETTEAIKAGADEIDM
DEOC_RHIME       FIAAHALPNFVPLLRSLVPSG-GLTLVGGPVGFPSGGHSTRTKTAEAVELAENGAQELDM
DEOC1_STAAM      FKSVCVNPTHVKYAAERLADS--EVLVCTVIGFPLGASTTATKAFETEDAIQNGADEIDM
DEOC2_STAAW      FKSVCVNPTHVKYAAERLADS--EVLVCTVIGFPLGASTTATKAFETEDAIQNGADEIDM
DEOC1_STAAW      FKSVCVNPTHVKYAAERLADS--EVLVCTVIGFPLGASTTATKAFETEDAIQNGADEIDM
DEOC2_STAAM      FKSVCVNPTHVKYAAERLADS--EVLVCTVIGFPLGASTTATKAFETEDAIQNGADEIDM
DEOC_STRPN       FASVCVNPTWVEHAKKGLEGT--DVKVCTVVGFPLGATTSAVKAFETKEAIQNGADEIDM
DEOC_CALS4       FASVCINPCFVDLAYEMLKDT--DVKVCTVVGFPLGANTIETKVVEAVEAVKKGATEIDM
DEOC1_YERPE      FYAVCVNSGYVPVAAQQLAGS--SVKVCSVIGFPLGAGLTAAKAFEAQAAINAGAQEIDM
DEOC_METTH       FRCAVVTPTNVRLAAELLEGT--DVTVCSVVGFPAGVSTPRVKALEASEAVENGAGEVDM
DEOC_THEMA       FHGVCVNPCYVKLAREELEGT--DVKVVTVVGFPLGANETRTKAHEAIFAVESGADEIDM
DEOC_STRP1       TASACIPASYVKKAAEYVSG---KLAICTVIGFPNGYSTTAAKVFECQDAIQNGADEIDM
DEOC_STRP3       TASACIPASYVKKAAEYVSG---KLAICTVIGFPNGYSTTAAKVFECQDAIQNGADEIDM
DEOC_UREPA       FYSVCINPCFVKVAKHYLLET--SVKICTVIGFPLGANTIETKVFETKNAIDLGADEIDM
DEOC_SYNY3       FVAVCVYPSALSQAVELLRGK--KVEICAVIGFPSGASTSGSKLYEAQEAAELGATELDV
DEOC_TREPA       FASVCVNPCHVALAAGAVRGT--AVRVCSVIGFPFGTHVTEVKCAEAQRALDDGAQELDM
DEOC_HALSA       M-NVCIPPCYVADARDH-ASA--DRTIATVIGFPHGTQATSVKVAAAEHAHADGADELDL
DEOC_AERPE       FRCAVLTPVYTVKISGLAEKL--GVKLCSVIGFPLGQAPLEVKLVEAQTVLEAGATELDV
DEOC_PYRAE       VAAYCVNPIYAPVVRPLLR----KVKLCVVADFPFGALPTASRIA-LVSRLAEVADEIDV
DEOC_THEAC       NYAVCIEPIYGKFAKEYLDEKRYKVKLDVTIDFPFGSLATSSRKKIIEDS--DYADEVDI
DEOC_THEVO       NYSVCIEPIYGNFAVEYIKEKGYSLKVDVTLDFPFGSLPTSARKKIIEDSVY--ADEIDM
                                           :    .** *      :           * *:*:

DEOC_NOSS1       VINLGCLKSGNTEAVHREIAEICEETG----QVVKVILETNLLTDA----EKKIAADIAM
DEOC_AQUAE       VWNLSAFKSEKYDFVVEELKEIFRETPS---AVHKVIVETPYLNEE----EIKKAVEICI
DEOC_CORGL       VLDIAVVKEGDANRLLQEIVAIREAVPS--PVVLKFILETAVVSDE----AIVTAVNALI
DEOC_MYCLE       VIAVGAALAGDLDAVRSDIEMVRSAIAG---VVLKVIVESAVLLGQANERTLAEVCHVAE
DEOC_MYCTU       VIDIGAALCGDIDAVRSDIEAVRAAAAG---AVLKVIVESAVLLGQSNAHTLVDACRAAE
DEOC_DEIRA       VIHIGSALAGDWDAVEADVRAVRRAVPE---QVLKVIIETCYLTDE----QKRLATEVAV
DEOC_MYCGE       VMNIAEFKK-RCACVITEIRAVKKVCGK---RKLKVIIETALLTND----EIKDAVNVCI
DEOC_MYCPN       VMNIAEFKK-RCACVISEIRAVKKVCGK---RTLKVIIETALLNQD----EIRDAVNVCI
DEOC_MYCPI       VLNISEFKE-NCACVVNEIRKYKKVCKK---KILKVIVETALLSEN----EIEKATLVVI
DEOC_MYCHO       VINVGRFKDGQYEYVLNEIKAIKEACNG---KTLKVIVETALLTKA----ELIKITELVM
DEOC_MYCPU       VMNIGKFKDGDYEYVLNDIKSVKKVMGS---NILKVIIETALLNEK----EIIKACQIVL
DEOC_BACHD       VINIGALKDKQYELVGRDIQAVVKAAEG--KALTKVIIETSLLTEE----EKKAACELAV
DEOC_LISIN       VINIGALKDKDDELVERDIRAVVDAAKG--KALVKVIIETCLLTDE----EKVRACEIAV
DEOC_LISMO       VINIGALKDKDDELVERDIRAVVDVAKG--KALVKVIIETCLLTDE----EKVRACEIAV
DEOC_BACSU       VINIAALKDKEDDVVEADIRGVVEAVAG--KALVKVIIETCLLTDE----EKERACRLAV
DEOC_CLOAB       VVSIGELKDKNDDYVEKDIEEVVKAASG--KALVKVIIETCLLTEE----EKIRACKLAK
DEOC_CLOPE       VINIGRLKDKDYEYVEKDIKAVVDAADK--KALTKVIIETCLLTEE----EKVKACELAK
DEOC_LACLA       VINIGAAKSKDWNLVESDIAAVNAVKGD---KLLKVIIETSLLTDD----EKIKACQIAK
DEOC_HAEIN       VINVGWIKSQKWDEVKQDIQAVFNACNG--T-PLKVILETCLLTKD----EIVKACEICK
DEOC_PASMU       VINVGWIKSNKWDAVEKDIATVLAACAG--K-PLKVILETCLLSKD----EIVKACEICK
DEOC_RHIME       MINVGRIKSGDFGYVRSEIRAIVEAIAP---VPLKVILELAHLTDE----EIRAASAIVA
DEOC1_STAAM      VINIGALKDGRFDDVQQDIEAVVKAAKG--H-TVKVIIETVLLDHD----EIVKASELTK
DEOC2_STAAW      VINIGALKDGRFDDVQQDIEAVVKAAKG--H-TVKVIIETVLLDHD----EIVKASELTK
DEOC1_STAAW      VINIGALKDGRFDDVQQDIEAVVKVAKG--H-TVKVIIETVLLDHD----EIVKASELTK
DEOC2_STAAM      VINIGALKDGRFDDVQQDIEAVVKAAKG--H-TVKVIIETVLLDHD----EIVKASELTK
DEOC_STRPN       VINVGALKSGNLALVESDIRAVVEASGD---KLVKVIIEACLLTDQ----EKVVVCQLAQ
DEOC_CALS4       VLNISMLKSGEYDYVKKEIGEVVKAVKSHGDIVVKVILETCYLSDE----EKIKACEISK
DEOC1_YERPE      VINVGWLKSGKIADVKADIKAVRDNCAA---TPLKVILETCLLSDE----QIVQVCEMCR
DEOC_METTH       VMNIGAMKSGNRELVYRDISGVVDAA-G---VPVKVILETAYLTDK----EKVEACLISK
DEOC_THEMA       VINVGMLKAKEWEYVYEDIRSVVESVKG---KVVKVIIETCYLDTE----EKIAACVISK
DEOC_STRP1       VINLTDVKNGDFDTVEEEIRQIKAKCQD---HILKVIVETCQLTKE----ELIELCGVVT
DEOC_STRP3       VINLTDVKNGDFDTVEEEIRQIKAKCQD---HILKVIVETCQLTKE----ELIELCGVVT
DEOC_UREPA       VININQLINGNREYCLNEINQIKEVCGD---KILKVIVETAFLNRE----QKEFAAKIIL
DEOC_SYNY3       VINLGLLKDGNTEAVYNDIAPIVEATG----LTVKAILEMGRLTES----EKRLAAEICL
DEOC_TREPA       VVRIDKVCAGEREVVEREIAQVAARCHA-RGAIVKVIVETALLDEM----HIAFACSCVE
DEOC_HALSA       VIPIGRLKGGDHEAVTAEIAAVNDAT----PLPVKVIIETPVLTDA----EKHAACEAAA
DEOC_AERPE       VPHLSLGPEA----VYREVSGIVKLAKS-YGAVVKVILEAPLWDDK----TLSLLVDSSR
DEOC_PYRAE       VAPIGLVKSRRWAEVRRDLISVVGAAGG---RVVKVITEEPYLRDE----ERYTLYDIIA
DEOC_THEAC       VVPMGYVKSHRWDYVDQDLTDVVKIAKD-HDLVIKIITEDGYLTQD----EKDRLYRSVI
DEOC_THEVO       VIPIGYVKSHRWDKVEQDINDVVSTARD-LGLVSKIITEDGYLTLD----EKLKTYDIVI
                 :  :             ::               * * *                     

DEOC_NOSS1       DAGATFLKTNTGWN--G----------GATVA----DVKLLKDIT---RERVGIKASGGI
DEOC_AQUAE       EAGADFIKTSTGFA-PR----------GTTLE----EVRLIKSSA---KGRIKVKASGGI
DEOC_CORGL       AAGADFAKTSTGFHPAG----------GATVE----AVRVMASAS---RGRVGIKAAGGV
DEOC_MYCLE       AAGADFVKTSTGFHPAG----------GASVR----AVTLMTEAV---GGRLGVKASGGI
DEOC_MYCTU       DAGADFVKTSTGCHPAG----------GATVR----AVELMAETV---GPRLGVKASGGI
DEOC_DEIRA       QGGADFVKTSTGFG-TG----------GATVD----DVRLMAEVI---GGRAGLKAAGGV
DEOC_MYCGE       DGNADYVKTSTGFS-FR----------GASLE----DVQIMNNAA---ANLIKIKASGGI
DEOC_MYCPN       DGNADFVKTSTGFS-MR----------GASLE----DITIMREAS---GNLIKIKASGGV
DEOC_MYCPI       DGGADFIKTSTGFS-SR----------GASIK----DIEIMKNVIEKNNSKLKIKASGGI
DEOC_MYCHO       QSGADFIKTSTGFS-YR----------GASFE----DIQTMKETC---GDKLLIKASGGI
DEOC_MYCPU       NSGAEFVKTSTGYS-YR----------GASES----DIEIMKKTV---GDKVLIKASGGI
DEOC_BACHD       KAGADFVKTSTGFS-GG----------GATAE----DIALMRKVV---GPNLGVKASGGV
DEOC_LISIN       KAGTDFVKTSTGFS-TG----------GATAE----DIALMRKTV---GPNIGVKASGGV
DEOC_LISMO       KAGTDFVKTSTGFS-TG----------GATAE----DIALMRKTV---GPNIGVKASGGV
DEOC_BACSU       SAGADFVKTSTGFS-TG----------GATKE----DIALMRKTV---GPDIGVKASGGV
DEOC_CLOAB       KAGADFVKTSTGFS-TG----------GAKAE----DIKLMRKTV---GAGMGVKASGGI
DEOC_CLOPE       KAGADFVKTSTGFS-TG----------GATPE----DIKLMRETV---GPEMGVKASGGV
DEOC_LACLA       AVGADFVKTSTGFS-TG----------GATVH----DVKLMRQTV---GPDMGVKASGGV
DEOC_HAEIN       EIGVAFVKTSTGFN-KG----------GATVE----DVALMKNTV---G-NIGVKASGGV
DEOC_PASMU       TLNVAFVKTSTGFN-RG----------GATKE----DVALMKRTV---G-DIGVKASGGV
DEOC_RHIME       ESGAAFVKTGTGWT-PS----------ATTLE----KLKLIVETV---GGAVEIKASGGI
DEOC1_STAAM      AAGADFVKTSTGFA-GG----------GATAE----DVKLMKDTV---GADVEVKASGGV
DEOC2_STAAW      AAGADFVKTSTGFA-GG----------GATAE----DVKLMKDTV---GADVEVKASGGV
DEOC1_STAAW      AAGADFVKTSTGFA-GG----------GATAE----DVKLMKDTV---GADVEVKASGGV
DEOC2_STAAM      VAGADFVKTSTGFA-GG----------GATAE----DVKLMKDTV---GADVEVKASGGV
DEOC_STRPN       KAGADFVKTSTGFS-TG----------GATIA----DVTLMRETV---GSDMGVKAAGGA
DEOC_CALS4       EAGADFVKTSTGFG-PG----------GATVE----DVKLMRKVV---GENFGVKASGGI
DEOC1_YERPE      ELDVAFVKTSTGFS-TG----------GAKEE----HVKLMRATV---GPVMGVKASGAV
DEOC_METTH       EAGAAFVKTSTAYGGLA----------GATVE----DVMLMRKTV---GDEMGVKASGGI
DEOC_THEMA       LAGAHFVKTSTGFG-TG----------GATAE----DVHLMKWIV---GDEMGVKASGGI
DEOC_STRP1       RSGADFIKTSTGFS-TA----------GATFE----DVEVMAKYV---GEGVKIKAAGGI
DEOC_STRP3       RSGADFIKTSTGFS-TA----------GATFE----DVEVMAKYV---GEGVKIKAAGGI
DEOC_UREPA       ESNADFIKTSTGFA-KE----------GAKLE----DIILWKRIL---GDVKQIKASGGI
DEOC_SYNY3       DAGVQYLKTSTGWG-K-----------GATVA----DVRLLHQIS---QGRVGIKASGGI
DEOC_TREPA       AGHADFIKTSTGYA-SR----------GGTEG----DIQCFKKYL---KGETKIKASGGI
DEOC_HALSA       DADAAMVKTATGFT-DG----------GATVP----DVSLMSE-------YLPVKASGGV
DEOC_AERPE       RAGADIVKTSTGVY-TK----------GGDP------VTVFRLASLAKPLGMGVKASGGI
DEOC_PYRAE       EAGAHFIKSSTGFA-EE----AYAARQGNPVHSTPERAAAIARYIKEKGYRLGVKMAGGI
DEOC_THEAC       RAKPDFIKTSTGFA-NKDYCASLGNAAGATPD----NVSLMSRIAEELGSDIGIKAAGGI
DEOC_THEVO       RSAPDFIKTSTGFA-DKEFCKSLGNETGATPE----NVKLMSEIAKKIGSNIGIKAAGGI
                        *: *.               .                         :* :*. 

DEOC_NOSS1       RTLNQALDLILA-------GATRLGTSRGIDLIHQRDNPEKVE----------
DEOC_AQUAE       RDLETAISMIEA-------GADRIGTSSGISIAEEFLKRHLI-----------
DEOC_CORGL       KTWEDAVAFVEA-------GATRIGTSNAGAILEGAPE---------------
DEOC_MYCLE       RTAVDAIALLDA-------GATRLGLSSTREVLDGLS----------------
DEOC_MYCTU       RTAADAVAMLNA-------GATRLGLSGTRAVLDGLS----------------
DEOC_DEIRA       RTPADAQAMIEA-------GATRLGTSGGVGLVSGGENGAGY-----------
DEOC_MYCGE       KTAKQFIDLFQA-------GASRIGTSNAVQIMQELKKMNHEYH---------
DEOC_MYCPN       QTAQQFLDFFNA-------GVSRIGTSNAVKIMEELHKLESHEHR--------
DEOC_MYCPI       KTLTFVEELIKA-------GAERIGSSKSVEIIKETLNKN-------------
DEOC_MYCHO       KNLADAQEMIRL-------GANVWVCLNQFQLWKNYLN---------------
DEOC_MYCPU       KNQESLKKMIEL-------GSSRIGTSSSVALMENQEIKKGY-----------
DEOC_BACHD       RDLSDAKAMIDA-------GATRIGASAGVAIVNGERSEGSY-----------
DEOC_LISIN       RTKEDVEKMIEA-------GATRIGASAGVAIVSGEKPAKPDNY---------
DEOC_LISMO       RTKEDVEKMIEA-------GATRIGASAGVAIVSGEKPAKPDNY---------
DEOC_BACSU       RTKEDVDTMVEA-------GASRIGASAGVSIVKGENASGGDNY---------
DEOC_CLOAB       HTREEAIKLIEA-------GATRIGASASIDIISEN-----------------
DEOC_CLOPE       RSIEDAEAVIKN-------GATRIGASASIAICEGKVSDSTY-----------
DEOC_LACLA       HNLEEAKAMIDA-------GATRLGVSAGVAIMEGLTSNDNY-----------
DEOC_HAEIN       RDTETALAMIKA-------GATRIGASAGIAIISGTQDTQSTY----------
DEOC_PASMU       RDTETAIAMINA-------GASRIGASAGIAIIHGLQDVSSTY----------
DEOC_RHIME       RSLDAIAGMMRL-------GVTRFGINTQVAVDLVRQCAALPGGRLDIAGKAG
DEOC1_STAAM      RNLEDFNKMVEA-------GATRIGASAGVQIMQGLEADSDY-----------
DEOC2_STAAW      RNLEDFNKMVEA-------GATRIGASAGVQIMQGLEADSDY-----------
DEOC1_STAAW      RNLEDFNKMVEA-------GATRIGASAGVQIMQGLEADSDY-----------
DEOC2_STAAM      RNLEDFNKMVEA-------GATRIGASAGVQIMQGLEADSDY-----------
DEOC_STRPN       RSYADALAFVEA-------GATRIGTSAGVAILKGELADGDY-----------
DEOC_CALS4       RSYEDAKAMIEA-------GANRIGASAGVKIVEEWKKQGLG-----------
DEOC1_YERPE      RDRATAETMIQA-------GATRIGTSSGVAIVSGQQAAASGY----------
DEOC_METTH       RDLETALAMIDA-------GADRIGTSTGVQIIEGWR----------------
DEOC_THEMA       RTFEDAVKMIMY-------GADRIGTSSGVKIVQGGEERYGG-----------
DEOC_STRP1       SSLEDAKTFIAL-------GASRLGTSRIIKIVKNEATKTDSY----------
DEOC_STRP3       SSLEDAKTFIAL-------GASRLGTSRIIKIVKNEATKPDSY----------
DEOC_UREPA       KNFEDFKSFIEA-------GATRIGTSSAIKILNNH-----------------
DEOC_SYNY3       RTVEQAIALIEA-------GATRLGTSRGVELIQQQQQLWEQG----------
DEOC_TREPA       RTRAQAQRFIEL-------GCARIGTSNGVAIMEERAS---------------
DEOC_HALSA       GTYADAAAMFDA-------GAVRIGASSGVDIVASFAE---------------
DEOC_AERPE       RSGIDAVLAVGA-------GADIIGTSSAVKVLESFKSLV-------------
DEOC_PYRAE       RTREQAKAIVDAIGWGEDPARVRLGTSTPEALL--------------------
DEOC_THEAC       HTYREIESIIDAAKRPIDPEKLRIGMSGTGKVFEEMKKIKK------------
DEOC_THEVO       HTYDQVEKIIDSAGMIPEPSNIRLGMSGTKKLYEEMKKASVQQS---------
                          .