CLUSTAL format seed alignment for MF_00115

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

MSCL_ECOLI        -----------MSIIKEFREFAMRGNVVDLAVGVIIGAAFGKIVSSLVADIIMPPLGLLI
MSCL_SALPA        -----------MSFIKEFREFAMRGNVVDLAVGVIIGAAFGKIVSSLVADIIMPPLGLLI
MSCL_PECAS        -----------MSIIKEFREFAMRGNVVDLAVGVIIGAAFGKIVSSLVSDIIMPPLGLLI
MSCL_PECCA        -----------MSIIKEFREFAMRGNVVDLAVGVIIGALFGKIVSSLVSDIIMPPLGLLI
MSCL_SODGM        -----------MSFLQKFRKFAMRGNVVDLAVGIIIGAAFGKIVSSLVANVIMPQLGLLI
MSCL_HAEIN        -----------MNFIKEFREFAMRGNVVDMAVGVIIGSAFGKIVSSLVSDIFTPVLGILT
MSCL_HAES1        -----------MSFIKEFREFAMRGNVIDMAVGVIIGGAFGKIVSSLVADVIMPILSFFT
MSCL_ACTPJ        -----------MSILKEFREFAVKGNVVDMAVGVIIGGAFGKIVSSLVSDVVMPPIGWLI
MSCL_PSEA7        -----------MGLLSEFKAFAVKGNVVDMAVGIIIGAAFGKIVSSFVGDVIMPPIGLLI
MSCL_PSEFL        -----------MGLLSEFKAFAVKGNVVDMAVGIIIGAAFGKIVSSFVGDVIMPPIGLLI
MSCL_XYLFA        -----------MSFIREFKEFVMRGNVIDLAVAVVIGAAFGKIVTALVDKIISPLIGVMV
L7WC41_NONDD      -------------MLKEFKNFIMTGNVIDLAVAVILAGAVSAVVKGFVSMIMMPIIGHFA
MSCL_BACAC        -------------MWNEFKKFAFKGNVIDLAVGVVIGAAFGKIVSSLVKDIITPLLGMVL
MSCL_LISMO        ----------MKKMLVEFRDFALKGNVLDLAVAVVIGAAFGKIVSSLVDNIIMPLVGVLL
MSCL_BACSU        -------------MWNEFKAFAMRGNIVDLAIGVVIGGAFGKIVTSLVNDIIMPLVGLLL
MSCL_STAAM        -------------MLKEFKEFALKGNVLDLAIAVVMGAAFNKIISSLVENIIMPLIGKIF
MSCL_STAEQ        -------------MLKEFKEFALKGNVLDLAIAVVMGAAFNKIVTSLVQYIIMPLIGKLF
MSCL_ROSS1        -------------MFEGFKTFVMRGNVIDLAVGVVIGTAFSAVVNSLVNDILMAIVATLI
MSCL_RENSM        -------------MIKGFRDFILKGNVVDLAVAVVIGAAFGTVVTTLVNNIIMPLIAGIV
Q2JGX8_FRACC      --------------MKGFRQFLMRGNVVDLAVAVMVGTAFTAVVTSLVKTIFTPLIAAIF
MSCL_MYCTU        -------------MLKGFKEFLARGNIVDLAVAVVIGTAFTALVTKFTDSIITPLINRI-
MSCL_MYCUA        -------------MLKGFKEFLSRGNIVDLAVAVVIGTAFTALVTRFTDSIITPLINRV-
MSCL_MYCLE        -------------MFRGFKEFLSRGNIVDLAVAVVIGTAFTALITKFTDSIITPLINRV-
B1VFH0_CORU7      -------------MLSGFKEFLMRGNVVELAVAVVVGSAFTAIVTAFTDKIVNPLIAAL-
C7NFA7_KYTSD      --------------MQGFKDFIMRGNVVELAVAVVIGSAFAAVVNKVVENLIDPILAAI-
C3PF23_CORA7      -------------MLKGFKDFIMRGNVIELAVAVIIGGAFTAIVTSVTDSLIQPLINSF-
U5E8J9_NOCAS      -------MRSVKSVFDGFKDFLMRGNVIDLAVAVVMGTAFTAVVTSFTKGIVNPLLAVF-
S5V4T9_STRC3      -----MSAKKEPSVWQGFKAFLMRGNVVDLAVAVVIGAAFTNIVNSVVKGLINPLVGAI-
Q82H65_STRAW      -----MSEKKETGVLAGFKAFLMRGNVVDLAVAVVIGAAFTNIVNSVVKGIINPLVGAF-
Q9KYV5_STRCO      -----MSEKNEPSVWQGFKAFLMRGNVIDLAVAVVIGAAFTKIVNSVVDGVINPLVGAF-
E8V4U4_TERSS      -------------MLKGFRDFILRGNVMDLAVAVIIGAAFTAIVNSLVEKIINPLLGAFI
MSCL_SYNE7        ---MTSRRGRAVGFIRDFQAFILKGNVVELAVAVIIGGAFNKIVSSFVGDLVMPLVNPLI
MSCL_SYNY3        --MVKSARQGAGGFWRDFKDFILRGNVVDLAVAVVIGGAFTSIVNAFVAWLMAVLLQPVL
Q8DHB2_THEEB      MGMARLNRRQVKQFWQEFREFALKGNVIDLAIAVVVGGAFSRIVTSVVEDLIMPLVNPLI
J3AIX8_STRRT      -------------MIKELKEFLFRGSVLELAVAVVMGAAFNAIITSFVSDVITPLFLNPA
E6J3C7_STRAP      -------------MLKDLKEFLLRGNVIDLAVGVIIANAFGAIVTSLIGDVITPLFLNPA
K9XXA2_STAC7      ------MVRRARGFWADFRDFIMRGNVVDLAVAVIIGAAFGKIIESLVADIITPAILNPA
MSCL_BURP1        -----------MSIIKEFKEFAVKGNVMDLAIGVIIGGAFSKIVDSVVKDLIMPVIGVLT
MSCL_BURM1        -----------MSIIKEFKEFAVKGNVMDLAVGVIIGGAFSKIVDSVVKDLIMPVIGVLT
MSCL_CUPMC        -----------MGMMSEFKTFAMRGNVIDLAVGVIIGAAFGKIVDSVVNDLIMPVIGRIV
MSCL_THIDA        -----------MSFASEFKQFIAKGNAMDLAVGVIIGAAFSKIVASIVDDLIMPIVGAVF
MSCL_ZYMMO        -----------MSILTDFKNFISKGNVLGLGIAVIMGDAFNKIISSVTGDLLMPIIGAVF
MSCL_PSYCK        -----------MSMVSEFKEFALKGNVMDLAVGVIIGGAFATITKSLVEDVIMPIVAFIV
MSCL_PSYA2        -----------MSMVSEFKKFALKGNVMDLAVGVIIGGAFATITKSLVEDVIMPIVAFIA
MSCL_SINMW        -------------MLNEFKEFIARGNVMDLAVGVIIGAAFSKIVDSVVNDLVMPVVGALT
MSCL_CHLAA        -------------MIKEFREFISRGNVIDLAVGVIVGAAFTAIINSLVNDIINPLIGLLV
MSCL_PEDPA        -------------MLKEFKEFVSRGNVLDLAVGVIIGGAFTSIVKSLVNYLINPLIGLFI
MSCL_ENTFA        -------------MIKEFKEFIMRGSVLDLAVGVVIGSAFTAIVTQVVEGLITPLISLIF
MSCL_CHRVO        -----------MSVLKEFKEFAVKGNVIDLAVGVVIGGAFGSIVKSLVDDVIMPPIGLLI
MSCL_TOLAT        -------------MLGEFKKFAMRGNVVDMAVGIVIGAAFGSIVKSLVDDVLMPPIGLLL
MSCL_PELLD        -------------MLKEFKEFALKGNVVDMAVGIIVGGAFGSIVNTLVSEVMMPPLGLLT
MSCL_DEHMB        -------------MFKEFKIFIMRGNVVDLAVGIVIGAAFGAIVNSLVKDVLMPPIGLLL
MSCL_LARHH        -------------MFKEFREFAMRGNVIDLAVGVVIGAAFGSIVKSLVDDIIMPPIGLLI
MSCL_GEODF        -------------MFKEFKEFAVKGNAVDLAVGVIIGAAFGKIVTSLVNDILMPPLGLLT
MSCL_PELPD        -------------MLKEFKEFAIRGNVIDLAIGIIIGGAFGKIVDSLVKDVIMPPVGMIM
MSCL_CLOPE        -------------MWKEFKEFAMKGNVIDLAIGVIIGGAFGKIVTSLVNDIIMPVIGRLV
D6YRW8_WADCW      ----------MKKIFEEFKTFAIRGNAIDMAIGIIIGAAFSQVVNSLVNDMIMPPIGWLV
E1KV91_FINMA      -------------MLKEFKKFITEGNVMDLTVAVIMGAAVKEMVDGLINGLIAPLIGAAT
L1Q3K8_ANAHA      ----------MKKFLEEFKSFALRGNVMDMAVGVLIGGAFSGIVTSLTDNFIQPIIKLVM
G2PNV8_MURRD      -----------MGFLKEFKEFAMKGNLVDIAVGFVMGAAFKEVVSSFTGGIVSPLIGLLF
B3QZY1_PHYMT      ---MNINKILNNNFTKGFKKFINKGNVLNLSIAFVISQLFSKIVNSLSSDIIMPFMNLLF
                                   :: *   *. : : :..::.  .  :   .   ..   .    

MSCL_ECOLI        --GGIDFKQFAVTLRDA--------------QGDIPAVVMHYGVFIQNVFDFLIVAFAIF
MSCL_SALPA        --GGIDFKQFAFTLREA--------------QGDIPAVVMHYGVFIQNVFDFVIVAFAIF
MSCL_PECAS        --GGVDFKQLSLILRDA--------------QGEIPAVVMNYGAFIQNIFDFVIVAFAIF
MSCL_PECCA        --GGVDFKQFALFLRNA--------------QGGIPAVVMNYGAFIQNIFDFIIVAFAIF
MSCL_SODGM        --GGIDFKQFSWVLKPA--------------QGDTPAVVMKYGIFLQNIFDFIIVAFAVF
MSCL_HAEIN        --GGIDFKDMKFVLAQA--------------QGDVPAVTLNYGLFIQNVIDFIIIAFAIF
MSCL_HAES1        --SSVDFKDLHIVLKEA--------------TDKTPAMTLKYGMFIQNIFDFIIIAFAIF
MSCL_ACTPJ        --GGVDFKDLAIEIAPA--------------KEGAEAVMLKYGAFIQNVFLLGVIAIAAD
MSCL_PSEA7        --GGVDFSDLAITLKAA--------------EGDVPAVVLAYGKFIQTILDFVIVAFAIF
MSCL_PSEFL        --GGVDFSDLAITLKA---------------EGDVPAVVLAYRKFIQTVLNFVIVAFAIF
MSCL_XYLFA        --GGIDFSKLSLTLKAATVDA---------AGKEVPAVVIGYGDFLNTILQFIIIAFAIF
L7WC41_NONDD      --GGVDFKDLKIILSDAVVGA--------DGVVTKPENAIMYGEWVNTIISLIIIGFVLF
MSCL_BACAC        --GGVDFTDLKITFGKS---------------------SIMYGNFIQTIFDFLIIAAAIF
MSCL_LISMO        --GGLDFTDLSFKVGKS---------------------VIQYGAFIQSIVDFIIIAFAIF
MSCL_BACSU        --GGLDFSGLSFTFGDA---------------------VVKYGSFIQTIVNFLIISFSIF
MSCL_STAAM        --GSVDFAKEWSFWG------------------------IKYGLFIQSVIDFIIIAFALF
MSCL_STAEQ        --GSVNFAEDWSFWG------------------------IKYGLFIQSIIDFIIIAFALF
MSCL_ROSS1        --GQPDFSDVLVFGA------------------------VRLGAFITTIVNFLIISAALY
MSCL_RENSM        --GKPSFNDVWAFQIGS-----------------DPANKLLLGAFITVLLNFVIIAAAIY
Q2JGX8_FRACC      --GKPDFS-ALTFTIN--------------------GSVFRYGEFINSVIAFLSVATVIY
MSCL_MYCTU        --GVNAQSDVGILRIGI-----------------GGGQTIDLNVLLSAAINFFLIAFAVY
MSCL_MYCUA        --GVNEQSDLGILKIGI-----------------GRGQSIDLNVLLSATINFILVAGVVY
MSCL_MYCLE        --GVNQQTNISPLRIDI-----------------GGDQAIDLNIVLSAAINFLLIALVVY
B1VFH0_CORU7      --GGSPEFGLGFHIREG-----------------NPATFVDFGAVITAAINFLIVAAVVY
C7NFA7_KYTSD      --GGADAAGLGFHLREG-----------------NPATFMDFGAILTALITFLITAAVVY
C3PF23_CORA7      --GSPEVAGLGFQITD------------------NPKTFVDFGAVITAIINFLIIAAVVY
U5E8J9_NOCAS      --GSTNELGLGVQLIGD-----------------KPATFIAIGPIITAFIDFFMVAAVLY
S5V4T9_STRC3      --GTQNLDHYYSCLQAPCAVNP--------DGSVKNGVPILWGTVIGATLTFVITAAVVY
Q82H65_STRAW      --GTKDLDKYSSCFRAPCQVAK--------DGTVTKGIPIMWGTVLSSTLSFVITAAVVY
Q9KYV5_STRCO      --GTQSLDSYSSCLKGPCTGT----------GDSATGVRILWGSVLGATLTFLITAAVVY
E8V4U4_TERSS      --GKPNFGFLIAHVH---------------------GGEVRYGDFLTAIINFILMASVVY
MSCL_SYNE7        --PGGDWRTAVIGP------------------------GLKIGSFAGSVIDFLIIAFVLY
MSCL_SYNY3        --DQA-GVSQLQDL------------------------PLGLGELVIAIINFLIIAFVIF
Q8DHB2_THEEB      --PGGDWRELTLGS------------------------GMRIGKFLGSLLDFGVIALSLF
J3AIX8_STRRT      --LKAAGVDKIADLSWN---------------------GVAYGNFLSAVINFLIVGTTLF
E6J3C7_STRAP      --LKAAGVEQIAGLKWN---------------------GIAYGSFLSAVINFLVIGTVLF
K9XXA2_STAC7      --MKAAGVERLAELSAG---------------------GIQYGLFLAAIINFLVIAFCMF
MSCL_BURP1        --GG-LDFSNKFVLLGQIPASFKGNPESFKDLQAAGVATFGYGSFITVLINFIILAFIIF
MSCL_BURM1        --GG-LDFSNKFVLLGTVPASFKGNPDSFKDLQAAGVAVFGYGSFITVLINFIILAFIIF
MSCL_CUPMC        --GK-LDFSNMFVMLADPPP---GTPQTLDALKKAGVPVFAYGNFLTIVVNFVILAFIIF
MSCL_THIDA        --GG-FDFSNLFIALGSVPEGVALTLA---EVRKAGVPVLAYGNFVTVLLNFLILALIVF
MSCL_ZYMMO        --GG-VDFSGFFIRLGAVPAGYTGSLTSYNDLKKAGVPLFGYGQFLTVVVNFVIVAFILF
MSCL_PSYCK        --GGEINFKNMFLILGDAPE---GVARTNDALKAAGIPVLAYGSFITVLINFLILAFIIF
MSCL_PSYA2        --GGEINFKNMFLILGDTPE---GVVMTYDALKAAGVPVLAYGNFITVLINFLILAFIIF
MSCL_SINMW        --GGGFDFSDYFLPLSGNVT-----AQTLAAAREQG-AVFAYGNFITVFINFLILAWIIF
MSCL_CHLAA        --GGRADFSNYFIPLAGQTA------TTLAEAQAAG-PVLAYGSFLTAVINFLLIAFVVF
MSCL_PEDPA        --GGID--------FSDWVL------------KVAG-ATFKFGSFINAVINFLIIAFVVF
MSCL_ENTFA        --VLTTGKKSADDALGALVY------------KVEG-VEFNIGSVISALITFLITAFVLF
MSCL_CHRVO        --GNVDFSNLFFVLKDGAKQ--AGPYVSVAAAKQAGATTLNLGLFINALVSFTIVAFAIF
MSCL_TOLAT        --GGVDFSDFFVVLKEGVKA--AAPYQTLAEAKAAGAVTLNFGLFVNAIISFTIVAFALF
MSCL_PELLD        --GGVDFSNLYVVMKEGVE---PGPYAALANARAAGAVTLNYGLFLNALVSFTIMAFSVF
MSCL_DEHMB        --GNVDFGNLFIVLKEGAI---GGPYESLLVAQTAGAVTINYGVFINALINFLILAMAIF
MSCL_LARHH        --GKVNFADLFITLKAGAT---PGPYATVAAAKAAGAVTMNVGQFINSVVSFVLIAFSVF
MSCL_GEODF        --GKMDFSNLFINLSGT-------PVDTVAKAKAAGIPTINYGLFFNNIIDFVLVAFSVF
MSCL_PELPD        --GKMDFASLFLNLSGT-------EYATLAEAKKAGAATLNYGIFISTIVDFLIMAFVVF
MSCL_CLOPE        --GKVDFSNLYINLSGQ-------QFNSLQEAQAAGAATINYGLFLNNLINFLIIAFSIF
D6YRW8_WADCW      --GGVDFSDLSVTIKQA--------------SGNQEAVNVNYGAFLNTLINFTIVAIATF
E1KV91_FINMA      --AGVNMKEMAVTIAGV---------------------KLQYGLFLDALVKFIIIAFIVF
L1Q3K8_ANAHA      --TG-----KVYTLEEI---------------------SGYASAFGSSVVNFLIMAFILF
G2PNV8_MURRD      --NADFNDLKYVITEGTLNE----------AGEIVGEIAVLYGAFLTNVIDFIIVAFVMF
B3QZY1_PHYMT      SSDKNDFSDLRFRITSN------------------SNIYIYYGKFLKTVFEFLIMSFFIY
                                                                   . :   .    

MSCL_ECOLI        MAIKLINKLNRKK--------EEPAAAPAPTKEEVLLTEIRDLLKEQNNRS---------
MSCL_SALPA        VAIKLINRLNRKKA-------EEPAAPPAPSKEEVLLGEIRDLLKEQNNRS---------
MSCL_PECAS        IAIKLMNKMRRKQE-------DTPAAAPKPSAEEKLLAEIRDLLKEQHKQ----------
MSCL_PECCA        IAIKLMNKMRCKQE-------DTPAAPPKPSAEEKLLAEIRDLLKEQQTRQ---------
MSCL_SODGM        CIIKLINRNASQRGG------KTRRAVQTECGRDAAYRDPRSLETTKQRHGAGYNDD---
MSCL_HAEIN        MMIKVINKVRKPE-----------EKKTAP-KAETLLTEIRDLLKNK-------------
MSCL_HAES1        LMIKALNKLKKEEP--------KVEKVITPSNEEKLLTEIRDLLKK--------------
MSCL_ACTPJ        GMGTLINKIKKPAE----------AAPAEPTAEEKLLTEIRDLLKK--------------
MSCL_PSEA7        MGVKAINRLKREEA-------VAPSEPPVPSAEETLLTEIRDLLKAQQNKP---------
MSCL_PSEFL        MGVKAINRLKREEA-------VAPSEPPVPSAEETLLTEIRDLLKAQQNKS---------
MSCL_XYLFA        IIVKMINKVINKQP----------LPPETPSEDVLLLREIRDSLKK--------------
L7WC41_NONDD      MIVKAYNKARKPKE---------APAPAGPSKEEVLLTEIRDALRAQK------------
MSCL_BACAC        MFVKVFNKLTSKREE------EKEEEIPEPTKEEELLGEIRDLLKQQNSSKDRA------
MSCL_LISMO        IFVKVLTSFIKKKEQ------TVEETPVPPT--EEYLKEIRDLLKEQQK-----------
MSCL_BACSU        IVIRTLNGLRRKKEA------EEEAAEEAVDAQEELLKEIRDLLKQQAKSPE--------
MSCL_STAAM        IFVKIANTLMKKEEA------EEEAVVEENV---VLLTEIRDLLREKK------------
MSCL_STAEQ        IFVKIANTVMKKEEK------EEE--VEENT---VLLTEIRDLLKK--------------
MSCL_ROSS1        FLVVVPINKLSEFTR-RNEP---PPAPPAPSAEEKLLTEIRDLLRQNIT-----------
MSCL_RENSM        FMVVVPMNHV--IAR-RNAKLGIKAGEETPDPQIVLLTEIRDALKSRS------------
Q2JGX8_FRACC      FVVVLPLNTIN--ER-RTRGQVPPEEDPALTDEARLLTEIRDLLAEHRPTG---------
MSCL_MYCTU        FLVVLPYNTLRKKG---EVE---QPGD----TQVVLLTEIRDLLAQTNGDSPGRH---GG
MSCL_MYCUA        FLVVVPYNTLRKKG---EVE---QADD----AQIVLLTEIRDLLAQTNSNSSGRHEAPGT
MSCL_MYCLE        FLVVLPYTTIRKHG---EVE---QFDTDLIGNQVVLLAEIRDLLAQSNGAPSGRH-VDTA
B1VFH0_CORU7      FILIMPMNKLAEMNA-RRKG---ISTEEAAATETELLAEIRDLLQQQNGVSTKKV-----
C7NFA7_KYTSD      YAFVMPMNKFNE-----RRG---VL---AAQTDSEVLAEIRDLLKTNRGL----------
C3PF23_CORA7      FGIIAPINAITERAK-RRQG---VDPEEPAPTTEQLLAEIRDLIAAENGGTTTNK-----
U5E8J9_NOCAS      FVLMLPMKSLKN-----KFG---TT-KAAEPTETELLIEIRDLLAKQQGLSTEQT-----
S5V4T9_STRC3      FLMVLPMSKYLARQE-ARKKARMGTQEVIEVTELEVLKEIRDALLAQRGTERGTERDTR-
Q82H65_STRAW      FLMVLPMSKYLARME-ARRKAKAGMQEVIEVTELQVLKEIRDALVAQRGP--GHSQD---
Q9KYV5_STRCO      FLMVLPMSKYLARQE-ARRKAKESAEEVIEVSELEVLKEIRDALIAQRGS--GHDRP---
E8V4U4_TERSS      FLLVLPTQYLLKKFN-P--PAPPSTKTCPECKSDIPLDAKRCKFCAQPVAV---------
MSCL_SYNE7        LAIRAIERFKRK----EEAVVAAAEPD----VQQQMLATLERIADNLEAR----------
MSCL_SYNY3        LIIKAIEKMQRKKAV-EEEIVAEAQPDPVLEAQTNLTDSINRLITTLENQQSSSQ-----
Q8DHB2_THEEB      ILLKLILPFLPN-----RPPAPEQRQCPYCLESVPLKASRCRACTSELPPL---------
J3AIX8_STRRT      FVVKAANHAMA-LTK-KTEEDTAEAEPTEVELLADIKALLEKQK----------------
E6J3C7_STRAP      FIVKSVEKAQS-LTR-KEDTAEEAAGPTELEVLQEIKALLESK-----------------
K9XXA2_STAC7      LLVRSYETAKKRFIR-QEEITTEEASDPAVVAQERLTVAMERLATVMERNNNQP------
MSCL_BURP1        LMVKFINKLRK----------PEEAAPAATPEDVLLLREIRDSLKQR-------------
MSCL_BURM1        LMVKFINKLRK----------PAEAAPAATPEDIVLLREIRDSLKQR-------------
MSCL_CUPMC        MMVRAFNKMREK--------EAEPAAPAVTPEDIVLLREIRDSLKAPRS-----------
MSCL_THIDA        IIVRQINRL---------KRPAPGAAPAAPPEDIVLLREIRDALRQK-------------
MSCL_ZYMMO        MIMKLAAKLQKELDKTEAKKEEKIAEAAPTPEDIVLLREIRDELRGKK------------
MSCL_PSYCK        MMVKMVNRLRRA----DEVEEAIEEAIEEPSEEVQLLREISAKLGNINK-----------
MSCL_PSYA2        MMVKMVNRLRRA----DEVVEKIAG----PSEEVQLLREISAKLGNINK-----------
MSCL_SINMW        LLIKLVNRARASVE-----REKAPEPAAPPPQDILLLSEIRDLLKQRA------------
MSCL_CHLAA        MIVRTVNRMRSK-------PEAVPPAPPEPTPSERLLAEIRDLLARQG------------
MSCL_PEDPA        ILVKLVNKFLPK------KEEQEDDEAEAIENSEIYLKEIRDALVNNPELLSNLKNKEDS
MSCL_ENTFA        LIVKAANKMKNR------GKKEEAAEEEVVPTSEDYLKEIRDLLAAQTPPAETVKTDSTF
MSCL_CHRVO        M-LVKAINRLKRE---EAAPAPAAPATKECRYCLSAIPEKATRCPCCTSQLD--------
MSCL_TOLAT        M-IVKAMNKLRAD---EEV---KPVTTKKCPHCCSEIALEATRCPHCTSEL---------
MSCL_PELLD        I-LVKAINRLRQK---ADA-APAPPSKKTCPYCLTLVPQQASRCPACTSELPGAADPGAR
MSCL_DEHMB        FFVVRPLNQLAARQKSKEAVIPAQTDKKDCPYCATQIPLKASKCPYCTSELM--------
MSCL_LARHH        L-LVKVVNRLYQK----KDAAAPAPATRDCPFCATAIPLAATRCPHCTSQVPPAD-----
MSCL_GEODF        L-VVKQINRLRRP----E--TPPPPSTRQCPFCLSPIPLAASRCPQCTSAVEPTAT----
MSCL_PELPD        L-MVKQINRMKKE----APAPVAASDSKDCPFCLSPIPLQATRCPHCTSNLK--------
MSCL_CLOPE        I-AIKQINKLKNFTK-KKEEVQVEATEKDCPYCCTKIDIKATRCPHCTSVLEEATN----
D6YRW8_WADCW      A-IVKTVNKLTKHK-------EKETTTKECPECKLSIPKKAKRCGHCTTKLE--------
E1KV91_FINMA      M-MVKAINKGRDA--LHK-ELAPEPTTKTCPYCKSEIDITATRCPHCTSELTE-------
L1Q3K8_ANAHA      C-LLKAMNKVMSF--GSKPEEPAQPTTKICPFCMSEIDIRATRCPHCTSVQPESEADQK-
G2PNV8_MURRD      LVVKAVNRMKKKEEP--------APEPPKGPTQEELLAEIRDLLKK--------------
B3QZY1_PHYMT      IILIIVFRQNLNSEK--------VNIESLTKEQIILIKEIKEILKKKN------------
                                                                              

MSCL_ECOLI        -----------------
MSCL_SALPA        -----------------
MSCL_PECAS        -----------------
MSCL_PECCA        -----------------
MSCL_SODGM        -----------------
MSCL_HAEIN        -----------------
MSCL_HAES1        -----------------
MSCL_ACTPJ        -----------------
MSCL_PSEA7        -----------------
MSCL_PSEFL        -----------------
MSCL_XYLFA        -----------------
L7WC41_NONDD      -----------------
MSCL_BACAC        -----------------
MSCL_LISMO        -----------------
MSCL_BACSU        -----------------
MSCL_STAAM        -----------------
MSCL_STAEQ        -----------------
MSCL_ROSS1        -----------------
MSCL_RENSM        -----------------
Q2JGX8_FRACC      -----------------
MSCL_MYCTU        RGTPSPTDGPRASTESQ
MSCL_MYCUA        AGTPPPNYGPRADT---
MSCL_MYCLE        DLTPTPNHEPRADT---
B1VFH0_CORU7      DPSVVNDDDPTGRHAE-
C7NFA7_KYTSD      -----------------
C3PF23_CORA7      PGSNF------------
U5E8J9_NOCAS      EALSKERATESA-----
S5V4T9_STRC3      -----------------
Q82H65_STRAW      -----------------
Q9KYV5_STRCO      -----------------
E8V4U4_TERSS      -----------------
MSCL_SYNE7        -----------------
MSCL_SYNY3        -----------------
Q8DHB2_THEEB      -----------------
J3AIX8_STRRT      -----------------
E6J3C7_STRAP      -----------------
K9XXA2_STAC7      -----------------
MSCL_BURP1        -----------------
MSCL_BURM1        -----------------
MSCL_CUPMC        -----------------
MSCL_THIDA        -----------------
MSCL_ZYMMO        -----------------
MSCL_PSYCK        -----------------
MSCL_PSYA2        -----------------
MSCL_SINMW        -----------------
MSCL_CHLAA        -----------------
MSCL_PEDPA        TK---------------
MSCL_ENTFA        TEK--------------
MSCL_CHRVO        -----------------
MSCL_TOLAT        -----------------
MSCL_PELLD        VAAK-------------
MSCL_DEHMB        -----------------
MSCL_LARHH        -----------------
MSCL_GEODF        -----------------
MSCL_PELPD        -----------------
MSCL_CLOPE        -----------------
D6YRW8_WADCW      -----------------
E1KV91_FINMA      -----------------
L1Q3K8_ANAHA      -----------------
G2PNV8_MURRD      -----------------
B3QZY1_PHYMT      -----------------