CLUSTAL format seed alignment for MF_00116

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

DUT_RHILO       ---MRAALQNSSVIGPTVGFVRLPHAEGLPLPAYESTGAAGMDLRAAVPDDRPLLILPGK
DUT_RHIME       ---MHTP-ENRPALTPGLTLVRLPHGEGLDLPAYETAGAAGMDLRAALPADEPMTIRPGE
DUT_BRUME       ---MTAA----SSSAPTLGIIRLEHAKGLDLPAYETAGSAGMDLRAAVAEDRQIVLLPGR
DUT_AGRFC       ---MTVQ----NDNRPLLRLVRLANGADLELPSYETRGAAGMDLRAAVPADEPLNLQPGE
DUT_CAUVC       ---MSAI-----PAGLAIRFKRWEGNADLPVPAYATVGAAGFDLRAHVPDDAPIVLKPGA
DUT_TREPA       ----------------MIRVRAV-VYPGASFPEYQTLGSSGADLRAFLPGG-PLEVHPLG
DUT_WOLSU       -----------MSELKKMKIRLLKLHPNAVIPAYQSAGAAGFDLCCVES----LEIPPLG
DUT_BACTN       ---------------MNVQVIN---KSKHPLPAYATELSAGMDIRANLSE--PITLAPLQ
DUT_PORGI       ---------------MKIKIIN---RSHHPLPTYATSASAGMDLRASIEE--PITLLPLE
DUT_FUSNN       ------------MKKVQVKVIR---EEGVELPKYETEGSAGMDVRANIKE--SITLKSLE
DUT_CHLCV       ---------------MTIVCEL---ESGADLPEYATEGASGADLRAHIEE--PIAVLPGQ
DUT_CHLPN       ---------------MTVFCEL---DSGGELPEYTTPGAAGADLRANIEE--PIALLPGQ
DUT_CHLTR       ---------------MKFFCKL---ESGSSLPEYATSGASGADVRANINE--PIAILPGQ
DUT_TREDE       ---------------MEVFTKL---KEGALLPEYKTSGSAGADLRALIEE--PIILKPMQ
DUT_AQUAE       ------------MSKVILKIKRLPHAQDLPLPSYATPHSSGLDLRAAIEK--PLKIKPFE
DUT_BRADU       -----------MSTKVTVELQRLPHAEGLPLPAYQTAEAAGLDLMAAVPEDAPLTLASGR
DUT_RHOPA       -----------MTQKITVSIRHLPHGEGLPLPEYQTAHAAGLDLIAAVPQDAPLTLQPGR
DUT_GEOSL       ------------MQPCLVKIRRIRSGSDLPLPRYMTPHAAGMDLCADV--DADLVLEPGE
DUT_CLOAB       --------------MVNLKIKKIDDAAILP--ECAHEGDAGLDLFSVEEK----VIKAGE
DUT_CLOTE       ------------MTEYTLKIKLLKEDAKLP--QYAHDNDAGMDLFSTEDK----IINPGK
DUT_CORGL       -----------MTDLAAIKIVRLDKELPLP--KRAHRGDAGVDLHATTDA----VIAPGH
DUT_CORDI       -------MENDQEKPSMVAIQRLDPELPLP--VRKHRGDAGADLFSAESV----TIEPGH
DUT_MYCTU       -------------MSTTLAIVRLDPGLPLP--SRAHDGDAGVDLYSAEDV----ELAPGR
DUT_STRCO       ----------MSRAGLEVLIRRVDPDVPLP--AYAQPGDAGADLRTTVER----ELAPGE
DUT_BIFLO       ---MAFDETYNEPESTEVLVKSLDPEHPAQL-HYAHAGDAGADLITTVDV----TLKPFE
DUT_TROWT       -----------------MTVEVLFKGGYTP--QRAFDGDAGFDLQSSHTA----VIQPRC
DUT_GLOVI       ------------MDPVRVAIQRLAHCFALP--TCAHPGDAGLDLFAAHAVP--LSIAPGR
DUT_CHLTE       --------------MIKVKIVRLNQKAILP--VYATAHAAGMDVSACLDAP--VTVPSSA
DUT_RICPR       ------------MTIIEVKIKKLENFLGNLP-EYATEHSAGMDLVAANEQS--ITIKVGS
DUT_CALS4       -------------MSIVLKIKRTEDAKDLPLPAYMSEGAAGMDLYANVKGE--VTINPGE
DUT_WOLPM       ----------MQRSKIKVEIKRLSHGEDLSLPCYATTQSAGMDLYAALNDS--AVLNPLE
DUT_LEPIN       ---------------MKIFVQKLRPNAELPL--LQTKQAAGYDIHACLDSK--LVLEPGN
DUT_BUCAI       ----------MSNIEIKILDSRMKNN--FSLPSYATLGSSGLDLRACLDET--VKLKAHK
DUT_BUCAP       ----MQKHLINNNIKIRILDSNIKKNSSFFLPQYATPGSSGLDLRASIKKK--ISLPSKE
DUT_BUCBP       ----------MKKIKIKILDDRIGTQ--FSLPSYATSGSSGLDLRACIKDS--IILLPNE
DUT_WIGBR       ---------MKKKVNIRILDKRFGKE--FFLPKYFTDGSSGMDLRACIDKE--INLNPNE
DUT_BLOFL       ----------MKIINIKIIRNNINNF---SLPQHITPGSAGLDLLACIEKP--VSILPKE
DUT_ECOLI       ---------MMKKIDVKILDPRVGKEF--PLPTYATSGSAGLDLRACLNDA--VELAPGD
DUT_PASMU       ----------MKKIDVKILDQRIGTEF--PLPTYATEGSAGLDLRALIDAP--MTVEAGQ
DUT_PSESM       ----------MHALQAKILDPRIGNEF--PLPAYATVGSAGLDLRAMLKED--TLLEPGQ
DUT_SHEON       ---------MKTPIELKILDSRIGSEF--PLPAYATPGSAGMDLRAMIDTT--MTIAPGE
DUT_COXBU       ---------MTHSVQLKILDKRLGSEF--PLPAYATTGSAGLDLRACLDEP--LKIEPDE
DUT_BORPE       ----------MKSVDLKILDARMREY----LPAYATPGSAGLDLRACTEAS--LVIEPGQ
DUT_CHRVO       ---------MQAVIDVKILDARLRDN----LPAYATAGSAGLDLRAATEET--MTIQPGE
DUT_RALSO       -----------MKLDVQILDARLHEQ----LPQYATPGSAGLDLRACLDAP--LTLEPGS
DUT_NITEU       ----------MKQVDIKLLDPRLQDV----FPGYATPGSAGLDLRACIDER--MEIHPGE
DUT_NEIMB       ---------MNIEVEMKVLDERMADV----VPVYATEGSAGLDLRACLDEE--VVLQPGE
DUT_XANCP       ---------MTQSLQVKLLDPRFGDLW--PLPAYATEASAGMDLRAALEAP--MTLEPGD
DUT_XYLFT       ------MSAAVKPLQIKILDPRLGTVW--PLPTYATEASAGLDLRAALDAP--MTLVPGD
                                 .                     :* *:           :    

DUT_RHILO       RSLVPTGLILEIPE-GMEGQVRPRSGLAFKHGLTVLNSPGTVDSDYRGEVKVLLINLG-D
DUT_RHIME       RALVPTGFIFEIPA-GHEGQIRPRSGLAFKHGITCLNTPGTVDSDYRGEVKVLLVNLG-A
DUT_BRUME       RTLVPTGLILEIPQ-GYEVQIRPRSGLAFKNGITCLNTPGTIDSDYRGEVKVLLINLG-D
DUT_AGRFC       RALVPTGFIFEVPQ-GYEAQIRPRSGLAIKNGITCLNSPGTVDSDYRGEVKVILANLG-Q
DUT_CAUVC       RCMAPTGFSVAIPD-GYEMQVRPRSGLALKNGVTVVNAPGTVDSDYRGQVCVLLINLG-E
DUT_TREPA       RVLVPTGVCVELPV-GLEMQIRPRSGLALEYGVTVLNSPGTIDADYRGEIRVLLVNLG-L
DUT_WOLSU       RALVSTGLALALEE-GYELQIRPRSGLALKHGITVLNTPGTVDSDYRGEIKVILINLG-A
DUT_BACTN       RCLVPTGIYIALPQ-GFEAQVRPRSGLAIKKGITVLNSPGTIDADYRGEVCIILVNLS-S
DUT_PORGI       RRLIPTGLFIELPV-GYEAQIRPRSGLALRHGITLVNSPGTIDADYRGEIGIIMINLS-N
DUT_FUSNN       RILVPTGLKVAIPE-GYEIQVRPRSGLAIKHGITMLNTPGTVDSDYRGELKVIVVNLS-N
DUT_CHLCV       RVLIPTGIKMQIPQ-GYEVQVRPRSGLALKHGIMVVNSPGTIDADYRGEVCIILANFG-E
DUT_CHLPN       RALIPTGIKAEIPE-GYELQVRPRSGLALKHGITVLNSPGTIDSDYRGEIRVILINFG-D
DUT_CHLTR       RALIPTGISVEIPH-GYEIQVRSRSGLASKYGVIVLQSPGTVDADYRGEIRVILANLG-E
DUT_TREDE       RCLIPTGLSVELPK-GIELQVRPRSGLALKHGITVLNTPGTVDSDYRGELAVLLINLG-N
DUT_AQUAE       RVLIPTGLILEIPE-GYEGQVRPRSGLAWKKGLTVLNAPGTIDADYRGEVKVILVNLG-N
DUT_BRADU       YALVPTGLAIALPP-GHEAQVRPRSGLAAKHGVTVLNSPGTIDADYRGEIKVILINHG-A
DUT_RHOPA       YVLVPTGLTIALPE-NYEAQVRPRSGLAAKHGVTVLNAPGTIDADYRGEIGVLLINHG-T
DUT_GEOSL       RALVPTGIAIALPD-GFEAQIRPRSGLALKHGIALVNSPGTIDPDYRGEIGVIIVNHG-A
DUT_CLOAB       SALIGTGIQMELPP-ETEAQVRPRSGLALKHSITVLNSPGTIDEGYRGEVKIILINHG-K
DUT_CLOTE       HALILTGISIELPE-NTEAQIRPRSGLALKNGVTVLNTPGTIDAGYRGEIGIILINHG-E
DUT_CORGL       REIVGTGIAIALPL-GTVGLVHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPE
DUT_CORDI       RILVGTGIAIALPI-GTVGLIHPRSGRALKEGLSIVNTPGTIDADYRGEIKVCLINLDPT
DUT_MYCTU       RALVRTGVAVAVPF-GMVGLVHPRSGLATRVGLSIVNSPGTIDAGYRGEIKVALINLDPA
DUT_STRCO       RAVLPTGVSVALPE-GYAAFVHPRSGLAARCGVALVNAPGTIDAGYRGEIKVIVVNLDPR
DUT_BIFLO       RALVPTGVAIALPA-GYVALVHPRSGLAAKQGVTVLNAPGTVDAGYRGEIKVPLINLDPK
DUT_TROWT       RQVVKTGIAIALPD-GYAGFIMPRSGLASENGITLVNSPGVIDAGYRGEISVVLINTDLH
DUT_GLOVI       FTRVPTGIALGLPA-GYMAFVQPRSGLAARHGISVLNTPGLIDCGYRGEIQVLLINHG-E
DUT_CHLTE       SALIPTGFAIELPE-GYEAQLRPRSGLALRHCISLPNSPATIDADYRGEVGVILINHG-R
DUT_RICPR       IQLIPTGIAIALPE-SFEAQIRPRSGLAVKHGITVANSPGTIDADYRGEIKVLLINLG-N
DUT_CALS4       VELIPTGIQIELPP-NYEAQIRPRSGLALNYGITLLNTPGTVDSDYRGEIKLIVINLG-K
DUT_WOLPM       RLLVPTGIVIAIPN-GFEGQIRPRSGLAAKHGITVLNSPGTIDSDYRGEVKICLINLS-N
DUT_LEPIN       VGLVPTGLSFAIPQ-EFHFEIRPRSGFSTKNRILIPNSPGTIDSDYRGELMIPLLNLG-D
DUT_BUCAI       TILIPTGIAIYIANPNITALILPRSGLGHKKGIVLGNLVGLIDSDYQGQLMISLWNRS-D
DUT_BUCAP       VILVPTGIAIHIDNPYITALVLPRSGLGHKNGIILGNLIGLIDSDYQGELMISLWNRS-K
DUT_BUCBP       TVLIPTGIAVYIDDPYITAIILPRSGLGHVQGIVLGNLVGLIDSDYQGQVMVSLWNRG-S
DUT_WIGBR       TVLISTGVSIDISDQKISGLILPRSGLSHKYGIILSNTIGLIDSDYQGPIMISMLNRS-N
DUT_BLOFL       TRLIPTGIAIYIEDIEVAGIILPRSGLGHYYGIVLGNTIGLIDSDYQGEIMISLWNRG-S
DUT_ECOLI       TTLVPTGLAIHIADPSLAAMMLPRSGLGHKHGIVLGNLVGLIDSDYQGQLMISVWNRG-Q
DUT_PASMU       TVLIPTGLSLYIADPTLAAVILPRSGLGHKHGIVLGNLVGLIDSDYQGPLMVSLWNRS-T
DUT_PSESM       TLLIPTGLSIYIGDPGLAALILPRSGLGHKHGIVLGNLVGLIDSDYQGELMVSCWNRG-Q
DUT_SHEON       TQLVPTGIAIHVADPGLAALILPRSGLGHKHGIVLGNLVGLVDSDYQGPLMVSCWNRS-D
DUT_COXBU       TCLISTGLAIYLGHSNVAATILPRSGLGHKHGIVLGNLVGLIDSDYQGPLMVSCWNRG-K
DUT_BORPE       TVLVPTGLAIHIGDPRYAAMILPRSGLGHKHGIVLGNLVGLIDSDYQGQLMVSTWNRG-T
DUT_CHRVO       TQLVPTGIAIHLSDPGLAAMLLPRSGLGHKHGIVLGNLVGLIDSDYQGQMFVSVWNRG-Q
DUT_RALSO       THLIPTGMAIHLADPGYAALILPRSGMGHKHGIVLGNLVGLIDSDYQGQLMISTWNRG-D
DUT_NITEU       TLLIPSGIAIHLADPGFAAMVLPRSGLGHKHGIVLGNLVGLIDSDYQGQILVSCWNRG-Q
DUT_NEIMB       TFLVPTGLAIYLANPAYAAVLLPRSGLGHKHGIVLGNLVGLIDSDYQGELKVSLWNRS-S
DUT_XANCP       AALIPSGIAIHLDDPQVCAVILPRSGLGHRHGIVLGNGTGLIDADYQGPLLISTWNRG-R
DUT_XYLFT       AELLSTGIAIHLVDPSLCAVVLPRSGLGHRHGIVLGNGTGLIDSDYQGPLLVSVWNRG-R
                     :*.   :        : .*** .    :   :  . :* .*:* : :   * .  

DUT_RHILO       EDFAVTRGMRIAQIVFAVVTQAAVEER---SLAGG-----TARGSGGFGSTGTV------
DUT_RHIME       EDFAVERGMRIAQMVIAPVTRLAIREA---GGATT-----TARGAGGFGSTGTK------
DUT_BRUME       DDFRIERGMRIAQAVFAPVIQPKIEER---AKISE-----TARGAGGFGSTGTA------
DUT_AGRFC       DDFTIERGMRIAQMVIAPVTQVTVSEV---TETSE-----TARGAGGFGSTGV-------
DUT_CAUVC       EDFTIRRGDRIAQGVIAAAPQWPLVEV---EDLDA-----TERGAGGFGSTGV-------
DUT_TREPA       AAFVVSHGDRIAQAVISSVLRVEYVRS---GSISL-----TERGKGGYGSTGVL------
DUT_WOLSU       ESFSIQAGDRIAQGVVSRLSIAELCEV---ESLDE-----TARGAGGFGSTGKS------
DUT_BACTN       EPFVIEDGERIAQMVIARHEQAVWQEV---EVLDE-----TERGAGGFGHTGRG------
DUT_PORGI       TPFTIADGERICQLVIARHEQAEWVLT---DELAD-----TERGAGGFGHTGKE------
DUT_FUSNN       EAYTIEPNERIGQFVLNKIEQIEFVEV---EELDS-----TERGESGFGHTGK-------
DUT_CHLCV       STFIIEPKMRIAQAVVAPVVQAKFIVVDQEEGLTA-----TSRGSRGFGHTGEK------
DUT_CHLPN       STFIIEPKMRIAQVVLSPVVQATFVVK--QESLAE-----TARGSGGFGHTGAS------
DUT_CHLTR       ATFIVEPGMRIAQLVVAKVEQVSFVET--QEELTA-----TARGTGGFGHTGEC------
DUT_TREDE       EDFKIENGDRIAQAVIAQAIQADFLQK---DELSN-----TERGAGGYGSTGIA------
DUT_AQUAE       EEVVIERGERIAQLVIAPVQRVEVVEV---EEVSQ-----TQRGEGGFGSTGTK------
DUT_BRADU       AAFVIKRGERIAQMVIAPVVQAALVPV---ATLSA-----TDRGAGGFGSTGR-------
DUT_RHOPA       EPFAIRRGERIAQMVIAPVSRAQFVAV---EALPE-----SGRGAGGFGSTGR-------
DUT_GEOSL       DAFVVRRGERIAQMVFAPFVRAELLDV---DELDE-----TARGDGGFGHTGR-------
DUT_CLOAB       EDFKVEKSMKIAQMVIKPVLKVKVEEV---KELSS-----SDRGTGGFGSTGLKK-----
DUT_CLOTE       KNFQVEKGMKIAQMVIKPIVKVNIEEV---KMLSE-----SQRGKGGFGSTGK-------
DUT_CORGL       KPIMITRGDRIAQLVIQKVELVDFEEV---EELDD-----TVRGDQGYGSTGKTA-----
DUT_CORDI       TPIRIERGERIAQLLVQKVELVDFCEV---ETLSE-----TERGVNGYGSTGVN------
DUT_MYCTU       APIVVHRGDRIAQLLVQRVELVELVEV---SSFDEAGLASTSRGDGGHGSSGGHASL---
DUT_STRCO       ESVRFERFDRIAQLVVQQVERVRFRQV---AELPG-----SARAEGGFGSTGGHAGLDPA
DUT_BIFLO       HTAVFHPGDRIAQLVIQRYVEARFIPA---ETLPG-----SDRAERGFGSTGVAS-----
DUT_TROWT       QAFHISQGDRIAQLVIMPVCHASFIEV---DTLPG-----SARGISAFGSSGRHDTRG--
DUT_GLOVI       VPVVVSRGDRIAQLVVLPVPQVQFVEV---STLES-----SERQTGSFGSSGY-------
DUT_CHLTE       EPFTVSHGDRIAQMVVAKVDHVVFEEV---ESLSE-----TARGEGGFGHTGVQAKAECL
DUT_RICPR       KDFIIEKGMRIAQMIIAKYERVLWAET---SILTE-----TMRGRGGFGSTGL-------
DUT_CALS4       QPVTIKRGQRIAQMVINQVVRPKIIEV---EELSE-----TERMDRGFGHTGV-------
DUT_WOLPM       QPYEIKRGDRIAQILISPVSQVIWDDR---EEFCAE---ETGRNAGGFGSSGR-------
DUT_LEPIN       SSFIIEHGMRIAQLLIRKTWYADWELV---SEFADR----TERGANGFGSTGH-------
DUT_BUCAI       QDFYVNPHDRVAQIIFVPIIRPCFLLV---KNFN-----ETSRSKKGFGHSGVSGVI---
DUT_BUCAP       NIFFINPYDRIAQMIFVPIIRPTFSIV---DDFE-----ETVRFGKGFGHSGVQ------
DUT_BUCBP       RNFSVKVGMRIAQIVFIPIIRPIFEIV---TNFVV----DTERKVQGFGHSGVK------
DUT_WIGBR       KNFLISIGDRIAQIIFVPLIQIEWNIV---NKFVK----ITNRKDMGFGHSGKN------
DUT_BLOFL       NKFILYPGKRIAQLLFISILRVKLSLV---KSFDPFM--KTIRGVKGFGHSM--------
DUT_ECOLI       DSFTIQPGERIAQMIFVPVVQAEFNLV---EDFDA-----TDRGEGGFGHSGRQ------
DUT_PASMU       EPFKVEVGDRIAQLVFVPVVQAEFNVV---SDFAQ-----TERGEGGFGHSGKQ------
DUT_PSESM       TAFTIAVGERIAQLVLVPVVQARFELV---EEFDE-----SQRGTGGFGHSGSH------
DUT_SHEON       TPFTLEIGDRLAQLVFVPVVQAQFKLV---DEFDS-----SDRGEGGFGHSGTK------
DUT_COXBU       EPYTINPGDRIAQLVVLPILKAQFAVV---EEFEL-----TERGAGGFGSSGQN------
DUT_BORPE       QPFTLDPMERLAQLVIVPVQQVAFNVV---EDFDA-----SERGAGGFGSTGRG------
DUT_CHRVO       QPFRLEPMERIAQMVIVPVVQASFNIV---DDFDA-----SDRGAGGFGSTGRG------
DUT_RALSO       TAFVLNPMERLAQLVIVPVVQAELNIV---DAFAE-----SERGAGGFGSTGRH------
DUT_NITEU       AGFTLDPMERIAQLVIVPVVQAGFNVV---ENFQP-----SQRGEQGFGSTGKC------
DUT_NEIMB       EPFTVKPFERIAQMVVVPIVQAGFKRV---EEFVG-----SSRGEGGFGSTGSH------
DUT_XANCP       EAFTIEPGDRIAQLVILPIVRVSLQVV---DTFVD-----SARGAGGFGHTGVR------
DUT_XYLFT       EAFTIEPGDRIAQLVVLPIVRVVLQVV---DTFVE-----SGRGAGGFGHTGVR------
                    .    :: * :.                        : *   ..* :         

DUT_RHILO       ----------------------------
DUT_RHIME       ----------------------------
DUT_BRUME       ----------------------------
DUT_AGRFC       ----------------------------
DUT_CAUVC       ----------------------------
DUT_TREPA       ----------------------------
DUT_WOLSU       ----------------------------
DUT_BACTN       ----------------------------
DUT_PORGI       ----------------------------
DUT_FUSNN       ----------------------------
DUT_CHLCV       ----------------------------
DUT_CHLPN       ----------------------------
DUT_CHLTR       ----------------------------
DUT_TREDE       ----------------------------
DUT_AQUAE       ----------------------------
DUT_BRADU       ----------------------------
DUT_RHOPA       ----------------------------
DUT_GEOSL       ----------------------------
DUT_CLOAB       ----------------------------
DUT_CLOTE       ----------------------------
DUT_CORGL       ----------------------------
DUT_CORDI       ----------------------------
DUT_MYCTU       ----------------------------
DUT_STRCO       SGTSGQVAEGGPTGGNRYASVVSDREGQ
DUT_BIFLO       ----------------------------
DUT_TROWT       ----------------------------
DUT_GLOVI       ----------------------------
DUT_CHLTE       ----------------------------
DUT_RICPR       ----------------------------
DUT_CALS4       ----------------------------
DUT_WOLPM       ----------------------------
DUT_LEPIN       ----------------------------
DUT_BUCAI       ----------------------------
DUT_BUCAP       ----------------------------
DUT_BUCBP       ----------------------------
DUT_WIGBR       ----------------------------
DUT_BLOFL       ----------------------------
DUT_ECOLI       ----------------------------
DUT_PASMU       ----------------------------
DUT_PSESM       ----------------------------
DUT_SHEON       ----------------------------
DUT_COXBU       ----------------------------
DUT_BORPE       ----------------------------
DUT_CHRVO       ----------------------------
DUT_RALSO       ----------------------------
DUT_NITEU       ----------------------------
DUT_NEIMB       ----------------------------
DUT_XANCP       ----------------------------
DUT_XYLFT       ----------------------------