CLUSTAL format seed alignment for MF_00118_B

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

EFTU_OLTVI       ------MAREKFERSKPHVNIGTIGHVDHGKTTLTAAITMAMSVFS---GAGAGKKYDEI
EFTU_TUPAK       ------MAREKFERKKQHVNIGTIGHVDHGKTTLTAAITMCLQSFS----KNKGKRYDEI
EFTU_NEPOL       ------MAREKFERTKPHVNIGTIGHVDHGKTTLTAAITMVMACNT---AGSKGKKYEDI
EFTU_OSTTA       ------MAREKFERTKPHVNIGTIGHVDHGKTTLTAAITMAMAAR----GGSAGKKYDEI
EFTU_CHLVU       ------MAREKFQRKKPHVNIGTIGHVDHGKTTLTAAITMALAAR----GGAKGRKYDDI
EFTU_PLETE       ------MARQKFERKKPHVNIGTIGHVDHGKTTLTAAITMAMAAR----GGGKGKKYDDI
EFTU_PROWI       ------MARAKFERKKPHVNIGTIGHVDHGKTTLTAAITMALAAR----GGGKGKKYAEI
EFTU_CHLAT       ------MAREKFERKKPHVNIGTIGHVDHGKTTLTAAITMALAAS----TGAKGKRYDEI
EFTU_MESVI       ------MAREKFERKKPHINIGTIGHVDHGKTTLTAAITMALAVG----TGKSGKRYDEI
EFTU_EUGGR       ------MARQKFERTKPHINIGTIGHVDHGKTTLTAAITMALAAT----GNSKAKRYEDI
EFTU_EUGLO       ------MSRQKFERIKPHINIGTIGHVDHGKTTLTAAITMALSVT----GNTKSKKYEEI
EFTU_BIGNA       ------MAREKFERVKPHVNIGTIGHVDHGKTTLTAAITMALASV----SGKKGKKYDDI
EFTU_HELSJ       ------MAREKFERIKPHINIGTIGHVDHGKTTLTAAITMALASI----GNTKGKNYADI
EFTU_CODFR       ------MIREKFERIKPHLNIGTIGHVDHGKTTLTAAITMALAVK----GYTKAKNYMDI
EFTU_TETOB       ------MARAKFERSKPHVNIGTIGHVDHGKTTLTAAITMALAAL----GGATGKKYDEI
EFTU_CHLRE       ------MSRAKFERKKPHVNIGTIGHVDHGKTTLTAAITMTLAAA----GGSVGKKYDEI
EFTU_STIHE       ------MARAKFERKKPHVNIGTIGHVDHGKTTLTAAITMALAAR----GGATGRKYDEI
EFTU1_ECOLI      ------MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKT-YGG---AARAFDQI
EFTU1_YERE8      ------MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKT-YGG---NARAFDQI
EFTU_HAEDU       ------MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKH-FGG---AARAFDQI
EFTU_BUCBP       ------MSKEKFKRSKPHINVGTIGHVDHGKTTLTSAITTVLSKK-YGG---AACAFDQI
EFTU_BUCAI       ------MSKEKFQRLKPHINVGTIGHVDHGKTTLTAAITTVLSKK-FGG---SARAFDQI
EFTU_BUCCC       ------MSKEKFNRSKPHINVGTIGHVDHGKTTLTSAITTVLSKR-FGG---KACAFEQI
EFTU_AERS4       ------MSKEKFERNKPHVNVGTIGHVDHGKTTLTAAITNVLAKH-FGG---KAFAFDQI
EFTU2_PSEHT      ------MAKAKFERVKPHVNVGTIGHVDHGKTTLTAAITNVLAKV-YGG---VAKDFASI
EFTU1_PHOPR      ------MSKEKFERLKPHVNVGTIGHVDHGKTTLTAAICTVLAKV-YGG---DAKDFASI
EFTU_PSEA6       ------MAKAKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKT-YGG---AASAFDQI
EFTU_PSYIN       ------MSKAKFERKKPHLNVGTIGHVDHGKTTLTAAISAVLTKA-HGG---EVKDFASI
EFTU_COLP3       ------MAKEKFERNKPHVNVGTIGHVDHGKTTLTAAISAVLTKV-HGG---EVKDFAQI
EFTU_SHEAM       ------MAKAKFERTKPHVNVGTIGHVDHGKTTLTAAISHVLAKT-YGG---EAKDFSQI
EFTU_BLOPB       ------MSKEKFKRIKPHINVGTIGHVDHGKTTLTAAITTVLSKK-YGG---YARAFDQI
EFTU_BLOFL       ------MSKEKFQRIRTHINVGTIGHVDHGKTTLTAAITTVLSKK-YGG---CARAFDQI
EFTU_BAUCH       ------MSKEKFQRTKLHINVGTIGHVDHGKTTLTAAITAVLAKA-YGG---NALAFDQI
EFTU_WIGBR       ------MSKEKFQRIKPHINVGTIGHVDHGKTTLTAAITNVLAKK-YGG---IPKAFDQI
EFTU_PSYA2       ------MAKAKFERLKPHVNVGTIGHVDHGKTTLTAAIATVAAIT-SGG---EAKDYASI
EFTU_ACIAD       ------MAKAKFERNKPHVNVGTIGHVDHGKTTLTAAIATICAKT-YGG---EAKDYSQI
EFTU_NEIGO       ------MAKEKFERSKPHVNVGTIGHVDHGKTTLTAALTTILAKK-FGG---AAKAYDQI
EFTU_CHRVO       ------MAKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTILSKK-FGG---EAKDYSQI
EFTU_NITMU       ------MAKSKFERTKPHINVGTIGHVDHGKTTLTAAITMVLAKK-FGG---EAKSYAQI
EFTU1_METFK      ------MAKGKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLTKK-FGG---EAKDYSQI
EFTU_THIDA       ------MAKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTILSKK-FGG---AAKKYDEI
EFTU_DECAR       ------MAKEKFARTKPHVNVGTIGHVDHGKTTLTAAITTVLSAK-FGG---AAKKYDEI
EFTU_HERAR       ------MAKGKFERTKPHVNVGTIGHVDHGKTTLTAAIATVLSKK-FGG---EAKGYDQI
EFTU_POLAQ       ------MAKEKFERTKPHVNVGTIGHVDHGKTTLTAAIATVLSKA-FGG---EAKAYDQI
EFTU2_RHOFT      ------MGKEKFSRSKPHVNVGTIGHVDHGKTTLTAAITSVLAAK-FGG---TAKAYDQI
EFTU_BORA1       ------MAKGKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLSTK-FGG---EARGYDQI
EFTU1_XANCB      ------MARAKFLREKLHVNVGTIGHVDHGKTTLTAALTKIGAER-FGG---EFKAYDAI
EFTU_XYLFT       ------MAQDKFKRTKLHVNVGTIGHVDHGKTTLTAALTKVGAER-FGG---EFKAYDAI
EFTU_METCA       ------MSKEKFTRTKPHVNVGTIGHVDHGKTTLTAALTKCMAAK-FGG---EFKAYDQI
EFTU_DICNV       ------MSKEKFERAKPHVNVGTIGHVDHGKTTLTAALTKVSAAR-FGS---AAQDYDQI
EFTU_PSEA7       ------MAKEKFERNKPHVNVGTIGHVDHGKTTLTAALTKVCSDT-WGG---SARAFDQI
EFTU_PSEF5       ------MAKEKFERNKPHVNVGTIGHVDHGKTTLTAALTRVCSEV-FGS---ARVDFDKI
EFTU_HAHCH       ------MAKEKFERSKPHVNVGTIGHVDHGKTTLTAALTRVCSEV-WGG---QAVAFDGI
EFTU_SACD2       ------MAKEKFERNKPHVNVGTIGHVDHGKTTLTAALTRVCSEV-WGG---AAVAFDGI
EFTU_MARMS       ------MAKSKFERNKPHVNVGTIGHVDHGKTTLTAALTRVCAEV-FGG---TAVAFDGI
EFTU_CHRSD       ------MAKEKFERNKAHINVGTIGHVDHGKTTLTAALTRVSAEV-FGG---DWREFDTI
EFTU_ALCBS       ------MAKEKFERNKPHVNVGTIGHVDHGKTTLTAALTRVCAEV-WGG---NAVAFDGI
EFTU_LEGPL       ------MAKEKFERKKPHVNVGTIGHVDHGKTTLTAAITTIMAKK-YGG---TAKAYDQI
EFTU1_HALHL      ------MSKEKFERKKPHINVGTIGHVDHGKTTLTAALTKVLAEA-HGG---DARAFDQI
EFTU_ALKEH       ------MSKSKFERKKPHVNVGTIGHVDHGKTTLTAAMTVVLAEA-FGG---DARAFDQI
EFTU_COXBU       ------MSKEKFVREKPHVNVGTIGHVDHGKTTLTAALTKVLSEK-YGG---EKKAFDQI
EFTU_NITOC       ------MSKSKFERKKPHINVGTIGHVDHGKTTLTAALTRILSEQ-YGG---EFRAYDQI
EFTU_VESOH       ------MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITKVMAEV-RGG---EFKDYADI
EFTU_HYDCU       ------MAKEKFERSKPHVNVGTIGHVDHGKTTLTAALTIVQGKK-FGG---DSKDYASI
EFTU_FRAP2       ------MAKEKFERSKPHVNVGTIGHVDHGKTTLTAAITKVMAEK-NGG---SARKFDEI
EFTU_FUSNN       ------MAKEKYERSKPHVNIGTIGHVDHGKTTTTAAISKVLSDK-GWA---SKVDFDQI
EFTU_CAMJD       ------MAKEKFSRNKPHVNIGTIGHVDHGKTTLTAAISAVLSRR-GLA---ELKDYDNI
EFTU_CAMHC       ------MAKEKYNRTKPHVNIGTIGHVDHGKTTLTAAISAVLSRK-GLA---ELKDYSNI
EFTU_HELAH       ------MAKEKFNRTKPHVNIGTIGHVDHGKTTLSAAISAVLSLK-GLA---EMKDYDNI
EFTU_WOLSU       ------MAKEKFVKNKPHVNIGTIGHVDHGKTTLSAAISAVLATK-GLC---ELKDYDAI
EFTU_NITSB       ------MAKEKFVKTKPHVNIGTIGHVDHGKTTLTAAITAVLAEK-GYA---EKRDYDQI
EFTU_ARCB4       ------MAKEKFSRNKPHVNIGTIGHVDHGKTTLTAAISAVLAVK-YGG---EMKDYDQI
EFTU_SULNB       ------MAKEKFERTKPHINIGTIGHVDHGKTTLTAAITAVLAVA-GDT---ELMDYDAI
EFTU_SULDN       ------MAKEKFARNKPHVNIGTIGHVDHGKTTLTAAITAVLAVT-NGA---KMMDYDAI
EFTU_RICAH       ------MAKAKFERTKPHVNIGTIGHVDHGKTSLTAAITTVLAKTG-GA---KATAYDQI
EFTU_RICBR       ------MAKAKFERTKPHVNIGTIGHVDHGKTSLTAAITMVLGKDNKDI---KVKKYDEI
EFTU_MAGSA       ------MAKAKFERNKPHCNIGTIGHVDHGKTSLTAAITKILAET-GGA---TFTAYDQI
EFTU_PARL1       ------MAKEKFERNKPHCNIGTIGHVDHGKTSLTAAITKVLAET-GGA---TYSAYDQI
EFTU_GLUOX       ------MAKAKFERTKPHCNIGTIGHVDHGKTSLTAAITKVLAKT-GGA---TYSAYDQI
EFTU_AZOC5       ------MAKAKFERNKPHCNIGTIGHVDHGKTSLTAAITKVLAETSGGA---TFTAYDQI
EFTU1_RHORT      ------MSKEKFARTKPHCNVGTIGHVDHGKTSLTAAITKVLAEA-GGA---TFQAYDQI
EFTU_ACICJ       ------MAKAKFERTKPHCNIGTIGHVDHGKTSLTAAITKVLAES-GGA---TFRAYDSI
EFTU_NOVAD       ------MAKAKFERNKPHCNIGTIGHVDHGKTTLTAAITKVLAEQ-GGA---EFTDYANI
EFTU_ERYLH       ------MAKEKFERNKPHCNVGTIGHVDHGKTTLTAAITKVMADV-YGG---SAVDFANI
EFTU_SPHAL       ------MAKAKFERTKPHCNIGTIGHVDHGKTSLTAAITKVLAENVAGN---AAVDFANI
EFTU_ZYMMO       ------MAKAKFERNKPHCNIGTIGHVDHGKTTLTAAITKVLAEAGGGN---TFVDYANI
EFTU_SPHWW       ------MAKAKFERTKPHCNIGTIGHVDHGKTSLTAAITKVLAET-GGA---TFVDYANI
EFTU_RHIL3       ------MGKSKFERNKPHVNIGTIGHVDHGKTSLTAAITKYFGE---------YKAYDQI
EFTU_RHILO       ------MAKGKFERTKPHVNIGTIGHVDHGKTSLTAAITKYFGE---------YKRYDQI
EFTU_JANSC       ------MAKEKFERSKPHVNIGTIGHVDHGKTTLTAAITKQFGD---------FQDYASI
EFTU_ROSDO       ------MAKAKFERNKPHVNIGTIGHVDHGKTTLTAAITKYFGD---------FQAYDQI
EFTU_RHOS5       ------MAKAKFERNKPHVNIGTIGHVDHGKTTLTAAITKYFGE---------FRAYDQI
EFTU_PARDP       ------MAKAKFERTKPHVNIGTIGHVDHGKTTLTAAITKYFGE---------FKAYDQI
EFTU_CAUVC       ------MAKEKFERTKPHCNIGTIGHVDHGKTTLTAAITMTLAKS-GGA---TAKKYDEI
EFTU1_HYPNA      ------MGKAKFERNKPHVNIGTIGHVDHGKTTLTAAITITLAKT-GGA---TAKNYADI
EFTU_MARMM       ------MAKEKFERTKPHANIGTIGHVDHGKTTLTAAITMVLAEA-SGG---TAKGYDEI
EFTU_MAGMM       ------MAKEKFARTKPHVNIGTIGHVDHGKTTLTAAITKVMAAA-GRA---EFRAYDQI
EFTU_ANADF       ------MAKEKFERNKPHVNVGTIGHVDHGKTTLTAAITKYCATQ-GRA---QFMAYDQI
EFTU_STIAU       ------MAKEKFERNKPHVNIGTIGHVDHGKTSLTAAITKVLAKT-GGA---TFLAYDQI
EFTU_BDEBA       ------MSKEKFTRNKPHVNIGTIGHVDHGKTTLTAAITTTLAAS-GKA---QAMAYDQI
EFTU_PELUB       ------MSKEKFVRNKPHCNIGTIGHVDHGKTTLTAAITITLAEL-GGG---KAVAYDQI
EFTU_CHLPD       ------MAKESYKRDKPHVNIGTIGHVDHGKTTLTAAITSVLAKQ-GLA---QQRDFGSI
EFTU_GEOUR       ------MAKAKFERTKPHVNIGTIGHVDHGKTTLTAAITKVLAGK-GQA---EFKAFDQI
EFTU1_PELCD      ------MSKAKFERTKPHVNIGTIGHVDHGKTTLTAAITQTMAAR-GLA---EFKAFDQI
EFTU2_DESPS      ------MSKEKFERTKPHVNVGTIGHIDHGKTTLTAAITRVLSTK-GQA---SFTDFSDI
EFTU_FLESI       ------MSKQKYERKKPHVNVGTIGHVDHGKTTLTAAMTHVLSLK-GYA---DYIEFGNI
EFTU_DESVH       ------MGKEKFERKKPHVNIGTIGHIDHGKTTLTAAITKTAGLL-GQG---KFIAYDEI
EFTU_DESAG       ------MGKEKFERTKPHVNIGTIGHIDHGKTTLTAAITKIASLK-MGS---KAVAYDEI
EFTU_LAWIP       ------MAKEKFTRNKPHVNVGTIGHIDHGKTTLTAAITKVASMK-MGG---KFVGYDEI
EFTU_SYNFM       ------MGKKKFERTKPHVNVGTVGHIDHGKTTLTAAITKQLAKR-GRA---EFVPFDQI
EFTU_SYNAS       ------MAKKKFERTKPHLNIGTIGHVDHGKTTLTAAITKWLAKK-GLA---EFRAFDSI
EFTU_EHRRG       ----------MVDGRKPHINVGTIGHVDHGKTTLTAALTTVLAKRLSGE-GNKSVKYDEI
EFTU_ANAPZ       ----------MTEGRKPHINVGTIGHVDHGKTTLTAALTTVLARKLSG--ANKVVKYDEI
EFTU2_WOLPM      ------MTAIVEAFGKPHVNVGTIGHVDHGKTTLTAAITKHYGNFVA---------YDQI
EFTU1_ORITB      -------MAVAFNRDKPHCNIGTIGHVDHGKTSLATAITIVSSELSDG--AVKVKNYDEI
EFTU_NEOSM       ---MAVKQKQVFVNDRPHLNIGTIGHVDHGKTTLTAAITKFCSEEGGGY-EADFRAYDNI
EFTU_AYWBP       ------MANEKFIRNKTHLNVGTIGHVDHGKTTLTAAITQVLSARGLA----KSRAYDQI
EFTU_APPPP       ------MSSKVFLRDKVHVNVGTIGHVDHGKTTLTAAITKILSTKGLA----ENKSYDQI
EFTU_CARRP       ------MAKKKFNREKIHLNVGTIGHVDHGKTTLTAALTKVSSDLYGS----ECRPFDSI
EFTU_SORC5       ------MAKEKFTRTKPHVNVGTIGHIDHGKTTLTAALVKVQSK--RNL-A-KAISYADI
EFTU_RHOBA       ------MAKDKFERTKPHVNVGTIGHIDHGKTTTTGAILAVQAA--KGL-A-KAKGYSDI
EFTU_BRAHO       ------MAKGTYEGNKTHVNVGTIGHVDHGKTTLTSAITAVSSAMFPAT-V-QKVAYDSV
EFTU_TREDE       ------MAKEKFNRTKVHMNVGTIGHVDHGKTTLSAAITTYCAKK-YGD---KLLKYDEI
EFTU_TREPA       ------MAKEKFARTKVHMNVGTIGHVDHGKTTLSAAITSYCAKK-FGD---KQLKYDEI
EFTU_BORBU       ------MAKEVFQRTKPHMNVGTIGHVDHGKTTLTAAISIYCSKL-NKD-A-KALKYEDI
EFTU_LEPBL       ------MAKEKFDRSKPHLNVGTIGHVDHGKTTLTAAITTTLAKAIGGK--NKAVAYDQI
EFTU_RUBXD       ------MAKGVFERTKPHINVGTIGHVDHGKTTLTAAITKVLAKHVPDDPANKEVAFEQI
EFTU2_PELTS      ------MAKQKFERTKPHVNIGTIGHVDHGKTTLTAAITMVLATV----GKAQVKKYDKI
EFTU_DESRM       ------MAKAKYERTKPHVNIGTIGHVDHGKTTLTAAITVVLSTS----GGASVKRYDEI
EFTU2_CARHZ      ------MAKAKFERVKPHVNIGTIGHVDHGKTTLTAAITTVLAKK----GLAQQKRYDEI
EFTU1_SYNWW      ------MAKAKYERTKPHLNIGTIGHIDHGKTTLTAAITKTLSQV----GGAKATSYEEI
EFTU_MOOTA       ------MAKQKYERTKPHVNVGTIGHVDHGKTTLTAAITFCLAKA----GGAVPTAYDQI
EFTU2_CALS4      ------MAKQKFERTKPHVNVGTIGHVDHGKTTLTAAITLILSKA----GLAQAKGYDEI
EFTU_DESHY       ------MAKQKFERTKPHVNVGTIGHVDHGKTTSTAAITLVLSKA----GGAVAQAFDQI
EFTU_CLOBM       ------MAKAKFERSKPHVNIGTIGHVDHGKTTLTAAITTVLAQK----GGASATKYDEI
EFTU_CLOK5       ------MSKEKFERTKPHVNIGTIGHVDHGKTTLTAAITMVLAKE----GKASATKYDEI
EFTU_CLOAB       ------MAKEKFERTKPHVNIGTIGHVDHGKTTLTAAITTILAKE----GKAKAFNYEEI
EFTU_CLOTE       ------MAKEKFERSKPHVNIGTIGHVDHGKTTLTAAITTILGHK----GFAKAFKYDEI
EFTU_CLONN       ------MARQKFERNKPHVNIGTIGHVDHGKTTTTAAITMTLAKA----GGAEVQNYEDI
EFTU_CLOPS       ------MSKAKFERSKPHVNIGTIGHVDHGKTTLTAAITTVLAQA----GGAEAFKYDEI
EFTU_CLOB8       ------MAKAKYERSKPHVNIGTIGHVDHGKTTLTAAITTVLANK----GFAEAFNYADI
EFTU_CALS8       ------MAKAKFERTKPHVNIGTIGHVDHGKTTLTAAITKVLALK----GKAQFMAYDQI
EFTU_SYMTH       ------MAKQRFERTKPHVNIGTIGHVDHGKTTLTAAITKVLAEK----GKAQFMAYDAI
EFTU_HUNT2       ------MSKAKFERTKPHVNIGTIGHVDHGKTSLTAAITKVLGFQ----GKANYTSYENI
EFTU_ALKOO       ------MAKEKFDRSKPHVNIGTIGHVDHGKTTLTAAITNTLNTRY---GTGAAVAFDKI
EFTU_CLOD6       ------MAKAKYERTKPHVNIGTIGHVDHGKTTLTAAITKTLYDRY---QLGEAVDFANI
EFTU2_ALKMQ      ------MGKAKYERSKPHVNIGTIGHVDHGKTTLTAAITITMHNRY---GTGGAVAFDMI
EFTU_LACP7       ------MGKAKFERNKPHCNIGTIGHVDHGKTTLTAAITKTLHDRL---GTGEAVAFDKI
EFTU_THEAQ       ------MAKGEFIRTKPHVNVGTIGHVDHGKTTLTAALTYVAAAEN---PNVEVKDYGDI
EFTU_DEIGD       ------MAKGTFERTKPHVNVGTIGHVDHGKTTLTAAITFTAAAMD---PTVEKLAYDQI
EFTU_LACBA       -----MAEKEHYERTKPHVNIGTIGHIDHGKTTLTAAITKVLADK----GLAKAEDYADI
EFTU_PEDPA       ------MAKEHYERTKPHVNIGTIGHVDHGKTTLTAAITKVLSEK----GLAKASDYADI
EFTU_LACP3       -----MAEKEHYERTKPHVNIGTIGHVDHGKTTLTAAITKVLSEK----GLAKAQDYASI
EFTU_LACRD       -----MAEKEHYERTKPHVNIGTIGHVDHGKTTLTAAITKVLAAK----GLAKAEDYADI
EFTU_OENOB       -----MAEKEHYERTKPHVNIGTIGHVDHGKTTLTAAITKVLSEK----GLAQAQDYASI
EFTU_LACS1       ------MAKEHYERTKPHVNIGTIGHVDHGKTTLTAAITKVLAEK----GLAEASDYASI
EFTU_LACSS       -----MAEKAHYERTKPHVNIGTIGHVDHGKTTLTAAITKMLADK----GLAEAQDYANI
EFTU_LACJO       -----MAEKEHYERTKPHVNIGTIGHVDHGKTTLTAAITTVLAED----GLAQAEDYSQI
EFTU_LACDA       -----MAEKEHYVRTKPHVNIGTIGHVDHGKTTLTAAITTVLAKK----GLAQAEDYSQI
EFTU_LEUMM       ------MAKETYVRTKPHVNIGTIGHVDHGKTTLTAAISKVLAEK----QGVDATDFAEI
EFTU_STRMU       ------MAKEKYDRSKPHVNIGTIGHVDHGKTTLTAAITTVLARRLP-SAVNQPKDYSSI
EFTU_LACLS       ------MAKEVYDRSKPHVNIGTIGHVDHGKTTLSAAISKVLSDK----GYSKATDFASI
EFTU_GEOTN       ------MAKAKFERTKPHVNIGTIGHVDHGKTTLTAAITTVLAKQGK----AEARAYDQI
EFTU_BACCN       ------MAKEKFERSKPHVNIGTIGHVDHGKTTLTAAITTVLAKAGG----AEARGYDQI
EFTU_BACSK       ------MAKEKFDRSKTHANIGTIGHVDHGKTTLTAAITTVLAKRSGK---GQAMAYDAI
EFTU_BACLD       ------MAKEKFDRSKSHANIGTIGHVDHGKTTLTAAITTVLHKKSGK---GTAMAYDQI
EFTU_OCEIH       ------MAKEKFDRSKSHVNVGTLGHVDHGKTTLTAAITTVLAKHGG----GEARAYDQI
EFTU_STAS1       ------MAKEKFDRSKEHANIGTIGHVDHGKTTLTAAIATVLAKNGD----SVAQSYDMI
EFTU_ENTFA       ------MAKEKFDRSKSHVNIGTIGHVDHGKTTLTAAIATVLSKHGG----GEAQSYDSI
EFTU_LISIN       ------MAKEKFDRSKPHVNIGTIGHVDHGKTTLTAAITTVLAKKGF----ADAQAYDQI
EFTU_ACHLI       ------MAKQKFERTKPHVNVGTIGHVDHGKTTLTAAITSVLAGKGL----ATKRDYNQI
EFTU_MYCGE       ------MAREKFDRSKPHVNVGTIGHIDHGKTTLTAAICTVLAKEG----KSAATRYDEI
EFTU_MYCGA       ------MAKERFDRSKPHVNIGTIGHIDHGKTTLTAAICTVLSKAG----TSEAKKYDEI
EFTU_MYCPE       ------MAKQKFDRSKAHVNIGTIGHIDHGKTTLTAAICTYLAKKG----GAKAMKYDEI
EFTU_UREP2       ------MAKAKFERTKPHVNIGTIGHVDHGKTTLTAAISTVLAKKG----QAIAQSYADV
EFTU_MYCPU       ------MAKLDFDRSKEHVNIGTIGHVDHGKTTLTAAIATVLSKKG----LAEAKDYASI
EFTU_MYCHJ       MAVVKTTGKKDFDRSKEHINIGTIGHVDHGKTTLTAAISTVLAKRG----LAEAKDYASI
EFTU_MYCMO       ------MAKIDFDRSKEHVNIGTIGHVDHGKTTLTAAIATVLAKHVE---GNEARDYGSI
EFTU_MYCS5       ------MAKLDFDRSKEHVNVGTIGHVDHGKTTLTAAIATVLSKKG----LSEARDYASI
EFTU_MYCMS       ------MAKEQFDRSLPHVNIGTIGHVDHGKTTLTAAITKVLSEQG----NAEFKDYANI
EFTU_MESFL       ------MAKEAFDRSLPHVNIGTIGHVDHGKTTLTAAITKVLADKG----GAEFKDYANI
EFTU_THEMA       ------MAKEKFVRTKPHVNVGTIGHIDHGKSTLTAAITKYLSLK----GLAQYIPYDQI
EFTU_FERIS       ------MAKVTFVRTKPHMNVGTIGQIDHGKTTLTAAITKYCSFF----GWADYTPYEMI
EFTU_THEM4       ------MAKEKFVRSKPHLNVGTIGHIDHGKTTLTAAITKYLSLF----GRADYTPYEQI
EFTU_PSELT       ------MAKEKFVRTKPHVNVGTIGHIDHGKTTLTAAITKYLSYK----GFASFVPFEQI
EFTU_PETMO       ------MAKEKFVRAKTHMNVGTIGHIDHGKTTLTAAITKALSYK----GGADFTPFDMI
EFTU_AQUPY       ------MAKEKFERTKEHVNVGTIGHVDHGKSTLTSAITCVLAAGLVEGGKAKCFKYEEI
EFTU2_ROSCS      ------MAKQKFERTKPHVNVGTIGHVDHGKTTLTAAITKVLALQ----GAAQFVSYDQI
EFTU_CHLAA       ------MAKQKFERTKPHINVGTIGHVDHGKTTLTAAITKVLSLK----GAAQFMAYDQI
EFTU_HERAU       ------MAKQKFERNKPHINIGTIGHVDHGKTTLTAAITKTMALR----GRAEFRAFDQI
EFTU_DEHM1       ------MAKQKFDRSKPHCNVGTIGHVDHGKTTLTAAITRTLSTK----GWADFRAYDQI
EFTU_STRCJ       ------MAKAKFERTKPHVNIGTIGHVDHGKTTLTAAITKVLHDAIP--DLNPFTPFDEI
EFTU2_STRRA      ------MAKAKFQRTKPHVNIGTIGHIDHGKTTLTAAITKVLHDRFP--DLNPFTPFDQI
EFTU_PLARO       ------MAKAKLERTKPHMNIGTIGHIDHGKTTLTAAITKVLHDRYP--ELNKATPFDKI
EFTU_THEFY       ------MAKAKFERTKPHVNIGTIGHIDHGKTTLTAAITKVLHDKYP--DLNPFTPFEDI
EFTU_FRACC       ------MAKQKFERTKPHVNIGTIGHIDHGKTTLTAAITKVLHDAYP--DLNPFTPFDQI
EFTU_KINRD       ------MAKAKFERTKPHVNIGTIGHIDHGKTTLTAAITRVLHDKFP--ELNKASAFDQI
EFTU_SALAI       ------MAKAKFERTKPHVNIGTIGHIDHGKTTLTAAITKVLHDQHP--DLNPYMPFDEI
EFTU_NOCSJ       ------MAKAKFERTKPHVNIGTIGHIDHGKTTLTAAITKVLHDKYP--DLNPFTPFDEI
EFTU_SACEN       ------MAKAKFERDKPHVNIGTIGHVDHGKTTLTAAITKVLHDKHP--ELNPFTPFDEI
EFTU_RHOJR       ------MAKAKFERTKPHVNIGTIGHVDHGKTTLTAAITKVLHDAYP--DLNEASAFDEI
EFTU_CORDI       ------MAKAKFERTKPHVNIGTIGHVDHGKTTTTAAITKVLADAYP--ELNEAFAFDAI
EFTU_CORJK       ------MAKAKFERSKPHVNIGTIGHVDHGKTTTTAAITKVLADKFP--EANKSFAFDAI
EFTU_ACIC1       ------MAKAKFERTKPHVNIGTIGHIDHGKTTLTAAITKVLHDQNP--DINPYTPFEQI
EFTU_CUTAK       ------MAKAKFERTKPHCNIGTIGHIDHGKTTLTAAISKVLHDKYP--ELNEESPFDQI
EFTU_TROW8       ------MAKAKFERTKPHVNIGTIGHVDHGKTTLTAAISRVLSERLPS-NTNVKQDFDAI
EFTU_LEIXX       ------MAKAKFQRTKPHVNIGTLGHVDHGKTTLTAAISKVLADKYPS-ATNVQRDFASI
EFTU_MICLU       ------MAKAKFERTKAHVNIGTIGHVDHGKTTLTAAISKVLYDKYP--DLNEARDFATI
EFTU_BRELN       ------MAKASFERTKPHVNIGTIGHVDHGKTTLTAAITKVLADQYP--DLNEARAFDQV
EFTU_BIFAA       ------MAKEKYERTKPHVNIGTIGHVDHGKTTLTAAISKVLHEEYP--DVNPEYDFNQI
EFTU3_STRRA      ------MSKTAYVRTKPHLNIGTMGHVDHGKTTLTAAITKVLAERGS----GTFVPFDRI
EFTU_PAROE       ------MAKETFDRSKPHVNIGTIGHVDHGKTTLTAAITTVLANK----GLAAKRDFSSI
EFTU_CYTH3       ------MAKENFDRSKPHVNVGTIGHVDHGKTTLTAAITKVLADK----GLAEKRDFSQI
EFTU_PARD8       ------MAKEKFDRSKPHVNIGTIGHVDHGKTTLTAAITTVLAKK----GLSELRSFDSI
EFTU_CELLY       ------MAKETFDRSKPHLNIGTIGHVDHGKTTLTAAITTVLANA----GLSELRSFDSI
EFTU_GRAFK       ------MAKEKYDRSKPHLNIGTIGHVDHGKTTLTAAITKVMADA----GYSEASAFDQI
EFTU_FLAPJ       ------MAKETFNRSKPHLNIGTIGHVDHGKTTLTAAITKVLSDA----GYCQAKSFDQI
EFTU_SULMW       ------MAKEIFRRDKPHLNIGTIGHVDHGKTTLTASITKVLAKK----GLAVAKEFSSI
EFTU_TERFE       ------MAKETFKREKPHVNIGTIGHVDHGKTTLTAAITDILSKK----GLAQAKKYDEI
EFTU_SALRD       ------MAKEEFAREKPHVNVGTIGHVDHGKTTLTAAITKVLAERV---GGAAEQTFEAI
EFTU_SOLUE       ------MAKEKFDRSKPHVNIGTIGHIDHGKTTLTAAITKVLAKHN---PKNKFRSFDSI
EFTU_KORVE       ------MAKEKFDRSKPHVNVGTIGHIDHGKTTLTAAITKVLSKHN---PKIAFRSFDSI
EFTU_CHLPN       ------MSKETFQRNKPHINIGTIGHVDHGKTTLTAAITRALSGD----GLASFRDYSSI
EFTU_PARUW       ------MAKETFQRKKPHVNVGTIGHVDHGKTTLTAAITKVLAEA----GGAKFRDYASI
EFTU_TRIV2       ------MARAKFERTKPHVNIGTIGHVDHGKTTLTAAITMTLAALG----QAVAKGYDQI
EFTU_THEEB       ------MARAKFERTKPHVNVGTIGHVDHGKTTLTAAITMTLAAQG----KAQARKYDEI
EFTU_MICAN       ------MARAKFERTKPHVNIGTIGHVDHGKTTLTAAITMTLAALG----NAQAKKYDEI
EFTU_SYNJA       ------MARAKFERTKPHVNVGTIGHVDHGKTTLTAAITMTLAALG----QATAKRYDEI
EFTU_GLOVI       ------MARAKFERNKPHVNIGTIGHVDHGKTTLTAAITMTLAALG----RAKAKKYDEI
EFTU_SYNE7       ------MARAKFERTKPHANIGTIGHVDHGKTTLTAAITTVLAKAG----MAKARAYADI
EFTU_ACAM1       ------MARAKFERTKPHVNIGTIGHVDHGKTTLTAAITMSLAALG----QAKARKYDDI
EFTU_TRIEI       ------MARAKFERNKPHVNIGTIGHVDHGKTTLTAAITMSLAAQG----KAKARNYADI
EFTU_SYNY3       ------MARAKFERTKDHVNIGTIGHVDHGKTTLTAAITMTLAELG----GAKARKYEDI
EFTU_ARTPT       ------MARAKFERNKPHVNIGTIGHVDHGKTTLTAAITMTLAASG----GAKARKYDDI
EFTU_CYAM1       ------MARTKFERTKPHVNIGTIGHVDHGKTTLTAAISAVLASKDN---TVQLKKFEEI
EFTU_CYACA       ------MARAKFERSKPHINIGTIGHVDHGKTTLTAAISAVLASIDN---TVKLKKFDEI
EFTU_EMIHU       ------MAREKFERSKPHVNIGTIGHVDHGKTTLTAAISATLAVYS----GSK-KDISLI
EFTU_GUITH       ------MARDKFERSKPHVNIGTIGHVDHGKTTLTAAISATLSQYT----GKS-KKFDEI
EFTU_GRATL       ------MARAKFERKKPHVNIGTIGHVDHGKTTLTAAISATLAAAN----DTKAKKFDEI
EFTU_CYAPA       ------MARQKFDGNKPHVNIGTIGHVDHGKTTLTAAITTALASQG----KGKARKYDEI
EFTU_CYCME       ------MGPEKFARAKPHINIGTIGHVDHGKTTFTAAITATLANDG----ESFAKAYSDI
EFTU_PHATC       ------MAREKFERTKPHVNIGTIGHVDHGKTTLTAAITATLALDG----GAQAKAYADI
EFTU_TRICV       ------MAREKFERTKPHVNIGTIGHVDHGKTTLTAAITATLALDG----NAKVKDYPDI
EFTU_PROM1       ------MAREKFERNKPHVNIGTIGHVDHGKTTLTAAITKVLAKKG----QAEAQDYAEI
EFTU_CHACO       ------MAQEVFQRTKPHVNIGTIGHVDHGKTTLTAAITMTLAVN----STCTPKKYDEI
EFTU_COLOB       ---MERLLHMTFRNKKIHLNVGTIGHFSHGKTTLTAAITAVLAGI----GYTQPKQNDAI
EFTU_TOXGO       ------MAKEIFKKQKPHINIGTIGHVDHGKTTLTAAITYVLAKNN----QAKLKTYKEI
EFTU_EIMTE       ------MAKKFFEKTKTHLNIGTIGHVDHGKTTLTAAITSYLSKIN----NTKAKSYSEI
EFTU_THEPA       ------MSKEQFLRNKPHVNIGTIGHVDHGKTTLTSAITSVLKLKGC---TEKSYSYEDI
EFTU_PLAF7       ------MNNKLFLRNKQHINLGTIGHVDHGKTTLTTAISYLLNLQGL---SKK-YNYSDI
                                  * *:**:*:..***:: : ::                     :

EFTU_OLTVI       DSAPEE-----KARGITINTAHVEYETENRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_TUPAK       DSAPEE-----KARGITINTAHVEYETENRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_NEPOL       DSAPEE-----KARGITINTAHVEYETATRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_OSTTA       DSSPEE-----KARGITINTAHVEYETATRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_CHLVU       DSAPEE-----KARGITINTAHVEYETENRHYAHVDCPGHADYVKNMITGAAQMDGGILV
EFTU_PLETE       DSAPEE-----KQRGITINTAHVEYETEKRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_PROWI       DSAPEE-----KARGITINTAHVEYETESRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_CHLAT       DAAPEE-----RARGITINTAHVEYETEKRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_MESVI       DAAPEE-----KARGITINTAHVEYETETRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_EUGGR       DSAPEE-----KARGITINTAHVEYETKNRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_EUGLO       DSSPEE-----KARGITINTAHVEYETKNRHYAHVDCPGHADYIKNMITGAAQMDGAILV
EFTU_BIGNA       DSAPEE-----KARGITINTAHVEYETETRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_HELSJ       DSAPEE-----KARGITINTTHVEYETAKRHYAHVDCPGHADYIKNMITGAAQMDGAILV
EFTU_CODFR       DSAPEE-----KARGITINTAHVEYETDVRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_TETOB       DSAPEE-----KARGITINTAHVEYETPNRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_CHLRE       DSAPEE-----KARGITINTAHVEYETEKRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_STIHE       DSAPEE-----KARGITINAAHVEYETENRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU1_ECOLI      DNAPEE-----KARGITINTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU1_YERE8      DNAPEE-----KARGITINTSHVEYDTPSRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_HAEDU       DNAPEE-----KARGITINTSHVEYDTETRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_BUCBP       DNAPEE-----KARGITINTSHVEYDTSIRHYAHVDCPGHADYIKNMITGAAQMDGAILV
EFTU_BUCAI       DNAPEE-----KARGITINTSHVEYDTEFRHYAHVDCPGHADYIKNMITGAAQMDGAILV
EFTU_BUCCC       DNAPEE-----KARGITINTSHVEYDTELRHYAHVDCPGHADYIKNMITGAAQMDGAILV
EFTU_AERS4       DKAPEE-----RERGITINTSHVEYDTAIRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU2_PSEHT      DNAPEE-----RERGITISTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU1_PHOPR      DNAPEE-----RERGITISTSHVEYDTPARHYAHVDCPGHADYVKNMITGAAQMDGGILV
EFTU_PSEA6       DNAPEE-----RERGITISTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_PSYIN       DNAPEE-----RERGITINTSHIEYDTDTRHYAHVDCPGHADYVKNMITGAAQMDAGILV
EFTU_COLP3       DNAPEE-----RERGITINTSHIEYDTEARHYAHVDCPGHADYIKNMITGAAQMDGAILV
EFTU_SHEAM       DNAPEE-----RERGITINTSHIEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_BLOPB       DNAPEE-----KARGITINTSHVEYDTAYRHYAHVDCPGHADYIKNMITGAAQMDGAILV
EFTU_BLOFL       DNAPEE-----KARGITINTSHVEYDTEFRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_BAUCH       DNAPEE-----KARGITINTSHVEYDTKNRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_WIGBR       DNAPEE-----KARGITINTSHVEYDTKIRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_PSYA2       DSAPEE-----KARGITINTSHVEYDTPSRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_ACIAD       DSAPEE-----KARGITINTSHVEYDSPIRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_NEIGO       DNAPEE-----KARGITINTSHVEYETETRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_CHRVO       DSAPEE-----KARGITINTAHVEYETETRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_NITMU       DSAPEE-----KARGITINTSHVEYETEKRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU1_METFK      DNAPEE-----KARGITINTSHVEYETETRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_THIDA       DSSPEE-----KARGITINTAHVEYETASRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_DECAR       DAAPEE-----KARGITINTAHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_HERAR       DNAPEE-----KARGITINTSHVEYETTTRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_POLAQ       DAAPEE-----KARGITINTAHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU2_RHOFT      DAAPEE-----KARGITINTAHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_BORA1       DAAPEE-----KARGITINTAHVEYETESRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU1_XANCB      DAAPEE-----KARGITISTAHVEYESAVRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_XYLFT       DAAPEE-----KARGITISTAHVEYETEVRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_METCA       DAAPEE-----RARGITIATAHVEYESAARHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_DICNV       DGAPEE-----RARGITISTSHVEYESPLRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_PSEA7       DNAPEE-----KARGITINTSHVEYDSAVRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_PSEF5       DSAPEE-----KARGITINTAHVEYDSNIRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_HAHCH       DNAPEE-----KARGITIATSHVEYESPIRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_SACD2       DNAPEE-----RERGITIATSHVEYDSPIRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_MARMS       DNAPEE-----RERGITISTSHVEYDSPTRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_CHRSD       DNAPEE-----RERGITIATAHVEYQSEERHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_ALCBS       DNAPEE-----RERGITIATSHVEYDSPTRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_LEGPL       DAAPEE-----RERGITISTAHVEYESASRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU1_HALHL      DNAPEE-----RARGITIATAHVEYESESRHYAHVDCPGHADYVKNMITGAAQMDGSILV
EFTU_ALKEH       DNAPEE-----KARGITIATAHVEYETSERHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_COXBU       DNAPEE-----RARGITIATSHVEYQSDKRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_NITOC       DNAPEE-----RERGITIATSHVEYETEERHYAHVDCPGHADYVKNMITGAAQMDGAVLV
EFTU_VESOH       DNAPEE-----RERGITISTAHVEYESEIRHYAHVDCPGHADYIKNMITGAAQMDGAIIV
EFTU_HYDCU       DNAPEE-----RERGITISTAHVEYESETRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_FRAP2       DNAPEE-----KARGITINTSHVEYESPNRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_FUSNN       DAAPEE-----KERGITINTAHIEYETEKRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_CAMJD       DNAPEE-----KERGITIATSHIEYETDNRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_CAMHC       DNAPEE-----KERGITIATSHIEYETEKRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_HELAH       DNAPEE-----KERGITIATSHIEYETENRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_WOLSU       DNAPEE-----RERGITIATSHIEYETENRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_NITSB       DNAPEE-----RERGITIATSHVEYETDKRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_ARCB4       DNAPEE-----RERGITIATSHIEYETAKRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_SULNB       DNAPEE-----RERGITIATSHVEYETATRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_SULDN       DNAPEE-----RERGITIATSHVEYETNNRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_RICAH       DAAPEE-----KERGITISTAHVEYETKNRHYAHVDCPGHADYIKNMITGAAQMDGAILV
EFTU_RICBR       DAAPEE-----KERGITISTAHVEYETKSRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_MAGSA       DKAPEE-----KARGITISTAHVEYETSNRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_PARL1       DKAPEE-----KARGITISTAHVEYQTEARHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_GLUOX       DKAPEE-----RARGITISTAHVEYETADRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_AZOC5       DKAPEE-----KARGITISTAHVEYETQNRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU1_RHORT      DKAPEE-----RARGITISTAHVEYETEARHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_ACICJ       DAAPEE-----RARGITIATAHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_NOVAD       DKAPEE-----RERGITISTAHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_ERYLH       DKAPEE-----RERGITISTAHVEYETDARHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_SPHAL       DKAPEE-----RERGITISTAHVEYETESRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_ZYMMO       DKAPEE-----RERGITISTSHVEYETETRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_SPHWW       DKAPEE-----RERGITISTAHVEYETEQRHYAHVDCPGHADYVKNMITGAAQMDGGILV
EFTU_RHIL3       DAAPEE-----KARGITISTAHVEYETPARHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_RHILO       DAAPEE-----KARGITISTAHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_JANSC       DSAPEE-----RARGITISTAHVEYETENRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_ROSDO       DGAPEE-----KARGITISTAHVEYETENRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_RHOS5       DGAPEE-----RARGITISTAHVEYESESRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_PARDP       DGAPEE-----RARGITISTAHVEYESENRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_CAUVC       DAAPEE-----KARGITINTAHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU1_HYPNA      DAAPEE-----KARGITINTAHVEYETPARHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_MARMM       DSAPEE-----KARGITISTAHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_MAGMM       DGAPEE-----RERGITISTAHVEYETEARHYAHVDCPGHADYVKNMITGAAQMDGGILV
EFTU_ANADF       DKAPEE-----RERGITIATAHVEYSTDKRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_STIAU       DKAPEE-----RERGITISTAHVEYQTKNRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_BDEBA       DKSPEE-----KARGITISTTHVEYETDNRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_PELUB       DKAPEE-----KERGITISTAHVEYETEKRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_CHLPD       DKAPEE-----RERGITISTAHVEYQTKKRHYAHIDCPGHADYIKNMITGAAQMDGAILV
EFTU_GEOUR       DNAPEE-----RERGITIATAHVEYETDKRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU1_PELCD      DNAPEE-----RERGITIATAHVEYQTDTRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU2_DESPS      DKAPEE-----KERGITIATAHVEYETVNRHYAHVDCPGHADYIKNMITGAAQMDGAILV
EFTU_FLESI       DKAPEE-----KERGITIATAHVEYESDKRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_DESVH       DKAPEE-----KERGITIATAHVEYETATRHYAHVDCPGHADYIKNMITGAAQMDGAIIV
EFTU_DESAG       DKAPEE-----KERGITIATAHVEYETTLRHYAHVDCPGHADYIKNMITGAAQMDGAIIV
EFTU_LAWIP       DKAPEE-----KERGITIATAHVEYETPKRHYAHVDCPGHADYIKNMITGAAQMDGAIIV
EFTU_SYNFM       DKAPEE-----RERGITIATAHVEYETDKRHYAHVDCPGHADYIKNMITGAAQMDGAILV
EFTU_SYNAS       DNAPEE-----KERGVTINISHVEYQTDKRHYAHVDCPGHADYIKNMISGAAHMDGTILV
EFTU_EHRRG       DKAPEE-----KARGITISTAHVEYETENRHYAHVDCPGHADYIKNMITGAAQMDAAILV
EFTU_ANAPZ       DKAPEE-----KARGITISTAHVEYETEGRHYAHVDCPGHADYIKNMITGAAQMDVAILV
EFTU2_WOLPM      DKAPEE-----RKRGITIATAHVEYQTEKRHYAHVDCPGHADYVKNMIVGAAQMDAAILV
EFTU1_ORITB      DSAPEE-----RARGITIQTAHVEFISKKRHYALVDCPGHVDYIKNMITGASQTDGLILV
EFTU_NEOSM       DKAPEE-----RQRGITISTAHVEYKTPERHYAHVDCPGHADYIKNMITGAAQMDGAILV
EFTU_AYWBP       DNAPEE-----RERGITIKTSHVEYETEKRHYAHVDCPGHADYVKNMITGAAQMDAAILV
EFTU_APPPP       DKTKEE-----KERGITINTTHVSYETVKRHYAHVDCPGHADYVKNMITGAAQMDAGILV
EFTU_CARRP       DNAPEE-----RERGITISTSHVEYESETKHYAHVDCPGHADYIKNMITGAAQMDGAILV
EFTU_SORC5       AKGGTV---RDETKTVTIAAAHVEYESANRHYAHVDCPGHADYIKNMITGAAQMDGAILV
EFTU_RHOBA       AKGGTV---RDATKTVTIAVAHVEYESENRHYAHIDCPGHADFVKNMITGAAQMDGAILV
EFTU_BRAHO       AKASESQGRRDPTKILTIATSHVEYESDNRHYAHVDCPGHADYIKNMITGAAQMDGAILV
EFTU_TREDE       DNAPEE-----KERGITINTRHLEYQSDKRHYAHIDCPGHADYVKNMITGAAQMDGAILV
EFTU_TREPA       DNAPEE-----KARGITINTRHLEYQSDRRHYAHIDCPGHADYVKNMITGAAQMDGGILV
EFTU_BORBU       DNAPEE-----KARGITINARHIEYETANRHYAHVDCPGHADYIKNMITGAAQMDAAILL
EFTU_LEPBL       DNAPEE-----KARGITIATSHQEYETNNRHYAHVDCPGHADYVKNMITGAAQMDAAILV
EFTU_RUBXD       DNAPEE-----RQRGITIATSHQEYATKNRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU2_PELTS      DNAPEE-----RERGITINTAHVEYETEKRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_DESRM       DNAPEE-----RERGITINTAHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU2_CARHZ      DNAPEE-----RERGITINTAHVEYETEKRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU1_SYNWW      DKAPEE-----RERGITINTSHVEYQTETRHYAHVDCPGHADYIKNMITGAAQMDGSILV
EFTU_MOOTA       DKAPEE-----RERGITIATAHVEYETEKRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU2_CALS4      DKAPEE-----KARGITINTTHVEYETAKRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_DESHY       DKAPEE-----RERGITISTSHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_CLOBM       DKAPEE-----KERGITINTSHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_CLOK5       DKAPEE-----KERGITINTAHVEYETEVRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_CLOAB       DKAPEE-----KERGITINTAHVEYETENRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_CLOTE       DKAPEE-----KERGITISTSHVEYETENRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_CLONN       DKAPEE-----KERGITINTSHVEYETENRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_CLOPS       DKAPEE-----KERGITINTAHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_CLOB8       DKAPEE-----KERGITINTAHVEYQTENRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_CALS8       DKAPEE-----RERGITINTAHVEYETDARHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_SYMTH       DKAPEE-----RERGITINTSHVEYETDARHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_HUNT2       DKAPEE-----RERGITISTSHVEYETDNRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_ALKOO       DKAPEE-----RERGITISTSHVEYETPNRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_CLOD6       DKAPEE-----RERGITISTAHVEYETPNRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU2_ALKMQ      DKAPEE-----RERGITISTAHVEYETDKRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_LACP7       DKAPEE-----RERGITISTSHVEYESKARHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_THEAQ       DKAPEE-----RARGITINTAHVEYETAKRHYSHVDCPGHADYIKNMITGAAQMDGAILV
EFTU_DEIGD       DKAPEE-----KARGITINTAHVEYNTPARHYSHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_LACBA       DAAPEE-----RERGITINTAHVEYETEKRHYAHIDAPGHADYIKNMITGAAQMDGAILV
EFTU_PEDPA       DAAPEE-----KERGITINTAHVEYETEKRHYAHIDAPGHADYVKNMITGAAQMDGAILV
EFTU_LACP3       DAAPEE-----KERGITINTAHVEYETEKRHYAHIDAPGHADYVKNMITGAAQMDGAILV
EFTU_LACRD       DAAPEE-----KERGITINTAHVEYETEKRHYAHIDAPGHADYVKNMITGAAQMDGAILV
EFTU_OENOB       DAAPEE-----RERGITINTAHVEYETDKRHYAHIDAPGHADYVKNMITGAAQMDGAILV
EFTU_LACS1       DAAPEE-----RERGITINTAHVEYETEKRHYAHIDAPGHADYVKNMITGAAQMDGAILV
EFTU_LACSS       DAAPEE-----RERGITINTAHVEYETENRHYAHIDAPGHADYVKNMITGAAQMDGAILV
EFTU_LACJO       DAAPEE-----KERGITINTAHVEYETKNRHYAHMDAPGHADYIKNMITGAAQMDGAILV
EFTU_LACDA       DAAPEE-----KERGITINTAHVEYETEKRHYAHMDAPGHADYIKNMITGAAQMDGAILV
EFTU_LEUMM       DNAPEE-----KERGITINTSHIEYETEKRHYAHIDAPGHADYVKNMITGAAQMDGAILV
EFTU_STRMU       DAAPEE-----RERGITINTAHVEYETEKRHYAHIDAPGHADYVKNMITGAAQMDGAILV
EFTU_LACLS       DAAPEE-----RERGITINTAHIEYETEKRHYAHIDAPGHADYVKNMITGAAQMDGAILV
EFTU_GEOTN       DAAPEE-----RERGITISTAHVEYETENRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_BACCN       DAAPEE-----RERGITISTAHVEYETETRHYAHVDCPGHADYVKNMITGAAQMDGGILV
EFTU_BACSK       DGAPEE-----RERGITISTAHVEYETDSRHYAHVDCPGHADYVKNMITGAAQMDGGILV
EFTU_BACLD       DGAPEE-----RERGITISTAHVEYETDNRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_OCEIH       DGAPEE-----RERGITISTAHVEYETETRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_STAS1       DNAPEE-----KERGITINTSHIEYTTDKRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_ENTFA       DNAPEE-----KERGITINTSHIEYETETRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_LISIN       DGAPEE-----RERGITISTAHVEYQTDNRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_ACHLI       DGAPEE-----KARGITINASHVEYETVNRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_MYCGE       DKAPEE-----KARGITINSAHVEYSSDKRHYAHVDCPGHADYIKNMITGAAQMDGAILV
EFTU_MYCGA       DAAPEE-----KARGITINTAHVEYATQNRHYAHVDCPGHADYVKNMITGAAQMDGGILV
EFTU_MYCPE       DKAPEE-----KARGITINTAHVEYETENRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_UREP2       DKTPEE-----RERGITINASHVEYETKTRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_MYCPU       DAAPEE-----KARGITINTAHIEYETEKRHYAHVDCPGHADYVKNMITGAAQMDGGILV
EFTU_MYCHJ       DAAPEE-----KARGITINTAHIEYSTDKRHYAHVDCPGHADYIKNMITGAAQMDGAILV
EFTU_MYCMO       DNAPEE-----RERGITINTSHIEYNTEKRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_MYCS5       DNAPEE-----KARGITINTSHIEYQTEKRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_MYCMS       DNAPEE-----RERGITINTAHVEYKTANRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_MESFL       DNAPEE-----RERGITINTSHVEYKTENRHYAHVDCPGHADYVKNMITGAAQMDGGILV
EFTU_THEMA       DKAPEE-----KARGITINITHVEYETEKRHYAHIDCPGHADYIKNMITGAAQMDGAILV
EFTU_FERIS       DKAPEE-----RARGITINITHVEYQTEKRHYAHIDCPGHADYIKNMITGAAQMDGAILV
EFTU_THEM4       DKAPEE-----KERGITINIAHIEYETEKRHYAHIDCPGHADYIKNMITGAAQMDGAILV
EFTU_PSELT       DKAPEE-----KARGITINITHVEYQSEKRHYAHIDCPGHADYIKNMITGAAQMDGAILV
EFTU_PETMO       DKAPEE-----KARGITINVSHVEYQTDKRHYAHIDCPGHADYIKNMITGAAQMDGAILV
EFTU_AQUPY       DKAPEE-----KERGITINITHVEYETAKRHYAHVDCPGHADYIKNMITGAAQMDGAILV
EFTU2_ROSCS      DNAPEE-----RARGITIAIRHVEYQTAKRHYAHVDCPGHADYIKNMITGAAQMDGAILV
EFTU_CHLAA       DNAPEE-----RARGITIAIRHVEYQTDKRHYAHVDCPGHADYIKNMITGAAQMDGAILV
EFTU_HERAU       DNAPEE-----RARGITISISHVEYETENRHYAHVDCPGHADYIKNMITGAAQMDGAILV
EFTU_DEHM1       DNAPEE-----KARGLTIAISHIEYQTETRHYAHIDCPGHADYIKNMITGAAQMDGAILV
EFTU_STRCJ       DKAPEE-----RQRGITISIAHVEYQTESRHYAHVDCPGHADYIKNMITGAAQMDGAILV
EFTU2_STRRA      DKAPEE-----RQRGITISIAHVEYQTEARHYAHVDCPGHADYIKNMITGAAQMDGAILV
EFTU_PLARO       DKAPEE-----KARGITISIAHVEYQTEKRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_THEFY       DKAPEE-----RERGITISISHVEYQTESRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_FRACC       DKAPEE-----KARGITISIAHVEYQTDTRHYAHVDCPGHADYIKNMITGAAQMDGAILV
EFTU_KINRD       DKAPEE-----RQRGITISIAHVEYQTEARHYAHVDCPGHADYIKNMITGAAQMDGAILV
EFTU_SALAI       DKAPEE-----KARGITISIAHVEYQTEARHYAHVDCPGHADYIKNMITGAAQMDGAILV
EFTU_NOCSJ       DKAPEE-----RQRGITISIAHVEYQTESRHYAHVDCPGHADYIKNMITGAAQMDGAILV
EFTU_SACEN       DKAPEE-----KQRGITIQIAHVEYQTEKRHYAHVDAPGHADYVKNMITGAAQMDGAILV
EFTU_RHOJR       DKAPEE-----KARGITINISHVEYQTEKRHYAHVDAPGHADYIKNMITGAAQMDGAILV
EFTU_CORDI       DKAPEE-----KERGITINISHVEYQTEKRHYAHVDAPGHADYIKNMITGAAQMDGAILV
EFTU_CORJK       DKAPEE-----KERGITINISHVEYETEKRHYAHVDAPGHADYIKNMITGAAQMDGAILV
EFTU_ACIC1       DKAPEE-----RARGITISIAHVEYQTEKRHYAHVDCPGHADYIKNMITGAAQMDGAILV
EFTU_CUTAK       DKAPEE-----RQRGITISIAHIEYQTEKRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_TROW8       DSAPEE-----RQRGITINISHIEYETEKRHYAHVDAPGHADYIKNMITGAAQMDGAILV
EFTU_LEIXX       DSAPEE-----RQRGITINISHVEYETPKRHYAHVDAPGHADYIKNMITGAAQMDGAILV
EFTU_MICLU       DSAPEE-----RQRGITINISHVEYQTEKRHYAHVDAPGHADYIKNMITGAAQMDGAILV
EFTU_BRELN       DNAPEE-----KERGITINVSHVEYQTEKRHYAHVDAPGHADYVKNMITGAAQMDGAILV
EFTU_BIFAA       DSAPEE-----AARGITINIAHIEYQTEKRHYAHVDCPGHADFVKNMITGAAQMDGAILV
EFTU3_STRRA      DRAPEE-----AARGITINIAHVEYETDTRHYAHVDMPGHADYVKNMVTGAAQLDGAILV
EFTU_PAROE       DNAPEE-----KERGITINTAHVEYSTANRHYAHVDCPGHADYVKNMVTGAAQMDGAILV
EFTU_CYTH3       DNAPEE-----KERGITINTSHVEYATATRHYAHVDCPGHADYVKNMVTGAAQMDGAILV
EFTU_PARD8       DNAPEE-----KERGITINTSHVEYQTANRHYAHVDCPGHADYVKNMVTGAAQMDGAIIV
EFTU_CELLY       DNAPEE-----KERGITINTSHVEYSTANRHYAHVDCPGHADYVKNMVTGAAQMDGAILV
EFTU_GRAFK       DNAPEE-----KERGITINSSHVEYSTEKRHYAHVDCPGHADYVKNMVTGAAQMDGAILV
EFTU_FLAPJ       DNAPEE-----KERGITINTSHVEYETANRHYAHVDCPGHADYVKNMVTGAAQMDGAILV
EFTU_SULMW       DNAPEE-----KERGITINTSHVEYQTEIRHYAHVDCPGHADYVKNMVTGAAQMDGAILV
EFTU_TERFE       DGAPEE-----KERGITINTAHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_SALRD       DNAPEE-----RERGITIATSHVEYETENRHYAHVDCPGHADYVKNMVTGAAQMDGAILV
EFTU_SOLUE       DNAPEE-----KARGITIAVAHVEYETAKRHYAHVDCPGHADYIKNMITGAAQMDGAIVV
EFTU_KORVE       DNAPEE-----RERGITIATAHVEYETANRHYAHVDCPGHADYIKNMITGAAQMDGAILV
EFTU_CHLPN       DNTPEE-----KARGITINASHVEYETPNRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_PARUW       DNTPEE-----KARGITINSSHVEYETDARHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_TRIV2       DNAPEE-----KARGITINTAHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_THEEB       DAAPEE-----KARGITINTAHVEYETEKRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_MICAN       DAAPEE-----KARGITINTAHVEYETASRHYAHVDCPGHADYVKNMITGAAQMDGGILV
EFTU_SYNJA       DAAPEE-----RARGITINTAHVEYQTEKRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_GLOVI       DQAPEE-----KARGITINTAHVEYETEKRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_SYNE7       DAAPEE-----KARGITINTAHVEYETGNRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_ACAM1       DAAPEE-----RERGITINTAHVEYETQDRHYAHVDCPGHADYVKNMITGAAQMDGAVLV
EFTU_TRIEI       DAAPEE-----KARGITINTAHVEYETEGRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_SYNY3       DAAPEE-----KARGITINTAHVEYETDSRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_ARTPT       DAAPEE-----KQRGITINTAHVEYETEQRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_CYAM1       DSAPEE-----RARGITINTSHVEYQTEKRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_CYACA       DAAPEE-----KARGITINTSHVEYQTPLRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_EMIHU       DSAPEE-----KARGITINTAHVEYETETRHYAHVDCPGHADYVKNMITGAAQMDGGILV
EFTU_GUITH       DSAPEE-----RARGITINTAHVEYETDKWYYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_GRATL       DAAPEE-----KARGITINTAHVEYETQNRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_CYAPA       DAAPEE-----KARGITINTAHVEYETEKRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_CYCME       DGAPEE-----RARGITINTAHVEYQTRDRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_PHATC       DGAPEE-----RARGITINTAHVEYETKDRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_TRICV       DGAPEE-----RARGITINTAHVEYETENGHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_PROM1       DGAPEE-----RERGITINTAHVEYETDGRHYAHVDCPGHADYVKNMITGAAQMDGAILV
EFTU_CHACO       DAAPEE-----RARGITINTAHVEYETALRHYAHVDCPGHADYIKNMITGAAQMDGAILV
EFTU_COLOB       DSTSEE-----KARNMSIYVHHVEYETAARHYSHLDCPGHVNYINNMITGVSQMDGAILV
EFTU_TOXGO       DCAPEE-----IARGITIKTSHIEYETAVRHYAHIDCPGHADYIKNMITGAAQMDGAILV
EFTU_EIMTE       DSAPEE-----KARGITINTSHIEYETNLRHYAHIDCPGHADYIKNMITGAAQMDGAILV
EFTU_THEPA       DSTKEE-----KKRGITINTTHVEYESDLRHYAHIDCPGHADYIKNMIIGAVQMDGAILV
EFTU_PLAF7       DSAPEE-----KIRGITINTTHIEYETLTKHCAHIDCPGHSDYIKNMIIGATQMDIAILV
                              : ::*   * .: :   : : :* *** ::::**: *. : *  :::

EFTU_OLTVI       VSGADGPMPQTKEHLLLAKQVGVPKIVVFLNKKDQVDD----------DELLELVELEVR
EFTU_TUPAK       VSGADGPMPQTKEHLLLAKQVGVPTLVVFLNKEDQVDD----------PELLELVELEVR
EFTU_NEPOL       VSGADGPMPQTKEHILLAKQVGVPNIVVFLNKQDQVDD----------EELLELVELEVR
EFTU_OSTTA       VSGADGPMPQTKEHILLAKQVGVPNIVVFLNKEDQVDD----------EELLELVDMEIR
EFTU_CHLVU       VSGADGPMPQTKEHLLLAKQVGVPNIVVFLNKEDQVDD----------AELLELLELEIR
EFTU_PLETE       VSGADGPMPQTKEHILLAKQVGVPNVVVFLNKEDQVDD----------AELLELVELEVR
EFTU_PROWI       VSGADGPMPQTKEHILLAKQVGVPNIVVFINKEDQVDD----------IELIELVELEVR
EFTU_CHLAT       VSGADGPMPQTKEHILLAKQVGVPNVVVFLNKEDQVDD----------AELLELVELEVR
EFTU_MESVI       VSGADGPMPQTKEHILLAKQVGVPNMVVFLNKEDQVDD----------PELLELVELEVR
EFTU_EUGGR       VSAADGPMPQTKEHILLAKQVGVPNIVVFLNKEDQVDD----------SELLELVELEIR
EFTU_EUGLO       ISATDGPMPQTKEHILLAKQVGVPNLVVFLNKEDQIDD----------NELLELIELEIR
EFTU_BIGNA       VSGADGPMPQTKEHLLLAKQVGVPSIVVFLNKEDQVDD----------EELLELVELEIR
EFTU_HELSJ       VSGADGPMPQTREHIVLAKQVGVPSMVVFINKEDQVDD----------PEILELVELEVR
EFTU_CODFR       VSGADGPMPQTKEHILLAKQVGVPAIVVFLNKADQVDD----------DELLELVELEIQ
EFTU_TETOB       VSGADGPMPQTKEHILLAKQVGVPNMVVFLNKEDQVDD----------AELLELVELEVR
EFTU_CHLRE       VSGADGPMPQTKEHILLAKQVGVPNVVVFLNKEDQVDD----------KELLELVELEVR
EFTU_STIHE       VSGADGPMPQTTEHVLLAKQVGVPAIVVFLNKADQVDD----------PELLELVELEVR
EFTU1_ECOLI      VAATDGPMPQTREHILLGRQVGVPYIIVFLNKCDMVDD----------EELLELVEMEVR
EFTU1_YERE8      VAATDGPMPQTREHILLGRQVGVPYIIVFMNKCDMVDD----------EELLELVEMEVR
EFTU_HAEDU       VAATDGPMPQTREHILLGRQVGVPYIIVFLNKCDMVDD----------EELLELVEMEVR
EFTU_BUCBP       VAATDGPMPQTREHILLGRQVGVPYIVVFLNKCDMVDD----------EELLELVEMEVR
EFTU_BUCAI       VAATDGPMPQTREHILLGRQVGVPYIIVFLNKCDMVDD----------EELLELVEMEVR
EFTU_BUCCC       VAATDGPMPQTREHILLGRQVGVPHIIVFLNKCDMVDD----------EELLELVEMEVR
EFTU_AERS4       VAATDGPMPQTREHILLGRQVGIPYMIVFMNKCDMVDD----------EELLELVEMEVR
EFTU2_PSEHT      VAATDGPMPQTREHILLSRQVGVPYIIVFMNKCDMVDD----------EELLELVEMEVR
EFTU1_PHOPR      VAATDGPMPQTREHILLGRQVGIPYIIVFMNKCDMVDD----------EELLELVEMEVR
EFTU_PSEA6       VAATDGPMPQTREHILLGRQVGVPFMVVFMNKCDMVDD----------EELLELVEMEVR
EFTU_PSYIN       VAATDGPMPQTREHILLSRQVGVPHLIVFMNKCDMVDD----------EELLELVEMEVR
EFTU_COLP3       VAATDGPMPQTREHILLSRQVGVPFIIVFMNKCDVVDD----------EELLELVEMEVR
EFTU_SHEAM       VAATDGPMPQTREHILLSRQVGVPFIIVFMNKCDMVDD----------EELLELVEMEVR
EFTU_BLOPB       VAATDGPMPQTREHILLARQVGVPHIIVFMNKCDMVND----------EELLELVEMEMR
EFTU_BLOFL       VAATDGPMPQTREHILLARQVGVPHIVVFLNKCDMVDD----------LELLELVEMEVR
EFTU_BAUCH       VAATDGPMPQTREHILLARQVGVPYIIVFINKCDMVDD----------SELLELVEIEVR
EFTU_WIGBR       VAATDGPMPQTREHILLGRQVGVPYIVVFMNKCDMVDD----------EELLELVEIEIR
EFTU_PSYA2       VSATDGPMPQTREHILLSRQVGVPYIVVFMNKCDVVDD----------EELLELVEMEVR
EFTU_ACIAD       CAATDGPMPQTREHILLSRQVGVPYIVVFLNKCDLVDD----------EELLELVEMEVR
EFTU_NEIGO       CSAADGPMPQTREHILLARQVGVPYIIVFMNKCDMVDD----------AELFQLVEMEIR
EFTU_CHRVO       CSAADGPMPQTREHILLSRQVGVPYIIVYLNKADLVDD----------AELLELVEMEVR
EFTU_NITMU       VSAADGPMPQTREHILLARQVGVPYIIVYMNKADMVDD----------AELLELVEMEVR
EFTU1_METFK      VSAADGPMPQTREHILLARQVGVPYIIVFLNKADMVDD----------AELLELVEMEVR
EFTU_THIDA       VSSADGPMPQTREHILLARQVGVPYIIVYMNKADMVDD----------AELLELVEMEVR
EFTU_DECAR       CSAADGPMPQTREHILLARQVGVPYVLVFMNKCDMVDD----------AELLELVEMELR
EFTU_HERAR       CSAADGPMPQTREHILLARQVGVPYIIVFLNKCDMVDD----------AELLELVEMEVR
EFTU_POLAQ       CSAADGPMPQTREHILLARQVGVPYIVVFLNKCDMVDD----------AELLELVEMEVR
EFTU2_RHOFT      VSAADGPMPQTREHILLARQVGVPYIIVFLNKCDMVDD----------AELLELVEMEVR
EFTU_BORA1       VSAADGPMPQTREHILLSRQVGVPYIIVFLNKADMVDD----------AELLELVEMEVR
EFTU1_XANCB      CSAADGPMPQTREHILLSRQVGVPHIVVFLNKADMVDD----------AELLELVEMEVR
EFTU_XYLFT       CSAADGPMPQTREHILLARQVGVPYIVVFLNKADMVDD----------AELLELVEMEVR
EFTU_METCA       VSAADGPMPQTREHILLARQVGVPYIVVFLNKADMVDD----------PELLELVEMEVR
EFTU_DICNV       CSAADGPMPQTREHILLSRQVGVPYIIVFLNKADMVDD----------AELLELVEMEVR
EFTU_PSEA7       CSAADGPMPQTREHILLSRQVGVPYIVVFLNKADMVDD----------AELLELVEMEVR
EFTU_PSEF5       CSAADGPMPQTREHILLSRQVGVPYIVVFLNKADMVDD----------AELLELVEMEVR
EFTU_HAHCH       CSAADGPMPQTREHILLARQVGVPYIVVFLNKADMVDD----------EELLELVEMEVR
EFTU_SACD2       CGSTDGPMPQTREHILLSRQVGVPYIVVFLNKADLLAEDCGGVDSEEYAEMMELVEMELR
EFTU_MARMS       CGATDGPMPQTREHILLSRQVGVPYIVVFLNKSDLLADDCGGADSEEYAEMLELVEMELR
EFTU_CHRSD       CSAADGPMPQTREHILLSRQVGVPTIVVFLNKADMVDD----------EELLELVEMEVR
EFTU_ALCBS       CSAADGPMPQTREHILLSRQVGVPYIVVFLNKADMVDD----------EELLELVEMEVR
EFTU_LEGPL       VSAADGPMPQTREHILLSRQVGVPYIVVFMNKADMVDD----------PELLELVEMEVR
EFTU1_HALHL      VSAADGPMPQTREHILLARQVGVPAIVVFLNKADMVDD----------AELLELVEMEVR
EFTU_ALKEH       VSAADGPMPQTREHILLARQVGVPYIVVYLNKADMVDD----------EELLELVEMEVR
EFTU_COXBU       VSAADGPMPQTREHIVLAKQVGVPNIVVYLNKADMVDD----------KELLELVEMEVR
EFTU_NITOC       VSAADGPMPQTREHILLARQVGVPFILVYLNKADMVDD----------PELLELVEMEVR
EFTU_VESOH       IAATDGPMAQTREHILLSKQVGVPYIVVYMNKADMVDD----------EELVELVEMEIR
EFTU_HYDCU       CSAADGPMPQTREHILLSRQVGVPYIVVYLNKADMVDD----------EELLELVEMEVR
EFTU_FRAP2       CSAADGPMPQTREHILLSRQVGVPYIVVFLNKCDMVDD----------EELLELVEMEVR
EFTU_FUSNN       VSAADGPMPQTREHILLSRQVGVPYIVVYLNKSDMVED----------EELLELVEMEVR
EFTU_CAMJD       VSAADGPMPQTREHILLSRQVGVPYIVVFMNKADMVDD----------AELLELVEMEIR
EFTU_CAMHC       IASTDGPMAQTREHILLARQVGVPYIVVFLNKTDMVDD----------PELIELVEEEVK
EFTU_HELAH       VSAADGPMPQTREHILLSRQVGVPHIVVFLNKQDMVDD----------QELLELVEVEVR
EFTU_WOLSU       VSAADGPMPQTREHILLSRQVGVPYIVVFLNKEDMVDD----------AELLELVEMEVR
EFTU_NITSB       VSAADGPMPQTREHILLARQVGVPYIVVFLNKEDMVDD----------PELLELVEMEVR
EFTU_ARCB4       IASTDGPMAQTREHILLSKQVGVPYIVVFMNKEDQLDPQDK-------EEMLELVEMEIR
EFTU_SULNB       IAATDGPMAQTREHILLSKQVGVPYIVVFLNKEDQLDDEDK-------EEMLELVEMEVR
EFTU_SULDN       VSAADGPMPQTREHILLSKQVGVPYIVVFMNKEDMVDD----------EELLELVEMEIR
EFTU_RICAH       VSAADGPMLQTREHILLAKQVGVPAMVVFLNKVDVVDD----------PALLELVEMEVR
EFTU_RICBR       VSAADGPMPQTREHILLAKQVGVPKMVVFLNKVDMVDD----------PDLLELVEMEVR
EFTU_MAGSA       VSAADGPMPQTREHILLARQVGVPALVVFMNKCDMVDD----------PELLDLVELEVR
EFTU_PARL1       VSAADGPMPQTREHILLARQVGVPALVVFMNKVDQVDD----------PELLELVEMEIR
EFTU_GLUOX       VSAADGPMPQTREHILLARQVGVPALVVFLNKVDQVDD----------PELLELVEMEVR
EFTU_AZOC5       VSAADGPMPQTREHILLARQVGVPALVVFLNKCDMVDD----------PELLELVELEVR
EFTU1_RHORT      VSAADGPMPQTREHILLARQVGVPALVVFLNKCDMVDD----------EELLELVELEVR
EFTU_ACICJ       VSAADGPMPQTREHILLARQVGVPALVVFLNKMDMAD-----------PDLVELVEMEVR
EFTU_NOVAD       VNAADGPMPQTREHILLARQVGVPALVVYMNKVDQVDD----------EEILELVELEVR
EFTU_ERYLH       VNAADGPMPQTREHILLSRQVGVPALVVYLNKVDQVDD----------EELLELVELEVR
EFTU_SPHAL       VSAADGPMPQTKEHILLAKQVGVPTMVVFLNKVDQLDD----------PELLELVELEIR
EFTU_ZYMMO       VSAADGPMPQTREHILLARQVGVPALVVFMNKVDQVDD----------PELLELVEMEIR
EFTU_SPHWW       VSATDGPMPQTREHILLARQVGVPALVVFMNKVDLVDD----------AEILELVELEVR
EFTU_RHIL3       CSAADGPMPQTREHILLARQVGVPAIVVFLNKVDQVDD----------AELLELVELEVR
EFTU_RHILO       VSAADGPMPQTREHILLARQVGVPSIVVFLNKVDQVDD----------AELLELVELEVR
EFTU_JANSC       VNAADGPMPQTREHILLGRQVGIPYMVVYMNKVDQVDD----------EELLELVEMEIR
EFTU_ROSDO       VNAADGPMPQTREHILLGRQVGIPTMVVFMNKVDQVDD----------EELLELVEMEIR
EFTU_RHOS5       VNAADGPMPQTREHILLGRQVGIPYMVVYMNKVDQVDD----------PELLELVEMEIR
EFTU_PARDP       VNAADGPMPQTREHILLGRQVGIPYMVVYLNKVDQVDD----------PELLELVEMEVR
EFTU_CAUVC       VSAADGPMPQTREHILLARQVGVPALVVFMNKVDMVDD----------EELLELVEMEVR
EFTU1_HYPNA      CSAADGPMPQTREHILLARQVGVPALVVFLNKVDMVDD----------EELLELVEMEVR
EFTU_MARMM       VNAADGPMPQTREHILLARQVGVPALVVFLNKVDQVDD----------EELLELVEMEVR
EFTU_MAGMM       VSAADGPMPQTREHILLARQVGVPALVVFLNKVDQVDD----------EELLELVEMEVR
EFTU_ANADF       VSAADGPMPQTREHILLARQVGVPYMVVFLNKVDMVDD----------KELLDLVELEVR
EFTU_STIAU       VSAADGPMPQTREHILLARQVGVPYIVVFLNKVDMLDD----------PELRELVEMEVR
EFTU_BDEBA       VSSADGPMPQTREHILLARQVGVPALVVFMNKVDMVDD----------KELLELVELEVR
EFTU_PELUB       VNAADGPMPQTREHILLGRQVGIPAIVVYLNKVDQVDD----------KDMIELVEEEIR
EFTU_CHLPD       VAGTDGPMPQTREHILLARQVNVPALVVYLNKVDIAD-----------PELIELVELELR
EFTU_GEOUR       VSAADGPMPQTREHILLARQVGVPYIVVFLNKADMVDD----------EELLELVELEIR
EFTU1_PELCD      VSAADGPMPQTREHILLARQVGVPAMVVFLNKADMVDD----------EELMELVELEVR
EFTU2_DESPS      VAATDGAMPQTREHILLARQVGVPAMVVFLNKCDMVDD----------DELIELVEMELR
EFTU_FLESI       VSAADGPMPQTREHILLARQVGVPSIVVFMNKCDMVDD----------EELLELVELEIR
EFTU_DESVH       VAATDGPMPQTREHILLARQVGVPYIVVFLNKCDMVDD----------EELLELVELEVR
EFTU_DESAG       VAATDGPMPQTREHILLARQVGVPSIVVFLNKCDMVDD----------EELLELVELEVR
EFTU_LAWIP       VAATDGPMPQTREHILLARQVGVPYLVVFMNKCDMVDD----------PELLELVELEIR
EFTU_SYNFM       VAADDGPMPQTREHILLSRQVGVPYIVVFLNKVDMVDD----------PELIELVELELR
EFTU_SYNAS       VAASDGPMPQTREHILLARQVQVPSIVVFLNKVDLVDD----------PELLDLVELELR
EFTU_EHRRG       VSATDGAMPQTREHILLAKQVGVKDIVVWMNKCDVVD----------DEEMLSLVEMEIR
EFTU_ANAPZ       VSATDGAMPQTREHILLAKQVGVKDIVVWINKCDVVE----------DEEMLSLVDMEIR
EFTU2_WOLPM      VSGVDGPMPQTREHILLAKQVGVGYIVVYINKADVA-----------DADMIDLVEMEVR
EFTU1_ORITB      VSGVDGVMPQTREHVLLAKQVGVPSIIVCINKIDQA-----------DPELLELIEMEVR
EFTU_NEOSM       VAGTDGAMQQTKEHILLAKQVGVGSIVVYINKCDSSEL---------DEELLELVESDIK
EFTU_AYWBP       VSGADSVMPQTREHILLARQVGVPKIVVFLNKCDLSP----------DEQILELVEMEVR
EFTU_APPPP       VSAYHGVMPQTREHVLLAGQVGISKLIVFLNKCDLVK----------EEEWIHLVEMEVR
EFTU_CARRP       CSAVDGPMPQTREHILLARQVGVPTIIVYLNKADCVK----------DKELLELVEMEIR
EFTU_SORC5       VSSLDSVMPQTREHVLLARQVGLNHIVVFLNKCDAVD----------DPEMLDLVEMEVR
EFTU_RHOBA       VSAADGPMPQTKEHVLLGRQVGVPYIVVYLNKCDLVD----------DEELLELVELEVR
EFTU_BRAHO       VSAEDGVMPQTKEHVLLSRQVGVNYIVVFLNKCDKLD----------DPEMAEIVEAEVI
EFTU_TREDE       VSAPDSVMPQTKEHLLLARQVGVPSIIVFLNKVDLVD----------DPELVELVEEEVR
EFTU_TREPA       VSAPDGVMPQTKEHLLLARQVGVPSIIVFLNKVDLVD----------DPELLELVEEEVR
EFTU_BORBU       VAADSGAEPQTKEHLLLAQRMGIKKIIVFLNKLDLAD-----------PELVELVEVEVL
EFTU_LEPBL       VSATDGPMPQTKEHILLARQVGVPYVIVFINKADMLAADE-------RAEMIEMVEMDVR
EFTU_RUBXD       VSAADGPMPQTREHILLARQVGVPYIVVYLNKADMVDD----------PELLELVEMEVR
EFTU2_PELTS      VSAADGPMPQTREHILLARQVGVPYIVVYLNKADMVDD----------PELLELVDMEVR
EFTU_DESRM       VSAADGPMPQTREHILLSRQVGVPYIVVFLNKSDMVDD----------EELLELVDMEVR
EFTU2_CARHZ      VSAADGPMPQTREHILLARQVGVPYIVVFLNKADMVDD----------PELMELVEMEVR
EFTU1_SYNWW      VSAADGPMPQTREHILLSRQVGVPYIVVFMNKTDMVDD----------PELLELVEMEVR
EFTU_MOOTA       VSAADGPMPQTREHILLARQVGVPYIVVFLNKVDQVDD----------PELLELVEMEVR
EFTU2_CALS4      VSAADGPMPQTREHILLARQVGVPYIVVFLNKADMVDD----------PELIELVEMEVR
EFTU_DESHY       VSAADGPMPQTREHILLARQVGVPYIVVWLNKADMVDD----------PELMELVEMEIR
EFTU_CLOBM       VSAADGPMPQTREHILLASRVGVQYIVVFLNKADQVDD----------PELIELVEMEVR
EFTU_CLOK5       VSAADGPMPQTREHILLASRVGVQYIVVFLNKSDQVDD----------PELIELVEMEVR
EFTU_CLOAB       VSAADGPMPQTREHILLASRVGVEYIVVFLNKADQVDD----------PELIDLVEMEVR
EFTU_CLOTE       VSAADGPMPQTREHILLASRVGVEHIVVFLNKADQVDD----------AELIELVEMEVR
EFTU_CLONN       VSAADGPMPQTREHILLASRVGVNHIVVFLNKADQVDD----------PELLELVEMEVR
EFTU_CLOPS       CSAADGPMPQTREHILLSSRVGVDHIVVFLNKADMVDD----------EELLELVEMEVR
EFTU_CLOB8       VSAADGPMPQTREHILLGSRVGIQYIVVFLNKADMVDD----------PELLELVEMEVR
EFTU_CALS8       VSAADGPMPQTREHILLARQVNVPYIVVFLNKVDMVDD----------PELIELVEMEVR
EFTU_SYMTH       VSAADGPMPQTREHILLARQVGVPAIVVFLNKCDMVDD----------EELLELVELEVR
EFTU_HUNT2       VSAADGPMPQTREHILLARQVGVPYIVVFLNKCDMVDD----------EELLELVEMEIR
EFTU_ALKOO       CSAADGPMPQTREHILLSRQVGVPYIVVFLNKCDMVDD----------EELLELVEMEVR
EFTU_CLOD6       CSATDGPMPQTREHILLSRQVGVPYIVVFLNKCDMVDD----------EELLELVEMEVR
EFTU2_ALKMQ      CSAADGPMPQTREHILLSRQVGVPYIVVFLNKCDMVDD----------EELLELVEMEVR
EFTU_LACP7       VAATDGVMAQTKEHILLSRQVGVPYIVVFMNKCDMVDD----------PELLELVEMEIR
EFTU_THEAQ       VSAADGPMPQTREHILLARQVGVPYIVVFMNKVDMVDD----------PELLDLVEMEVR
EFTU_DEIGD       VSSADGPMPQTREHILLARQVGVPYIVVFMNKVDMVDD----------EELLELVEMEVR
EFTU_LACBA       VAATDGPMPQTREHILLARQVGVDYIVVFLNKTDLVDD----------DELVDLVEMEVR
EFTU_PEDPA       VAATDGPMPQTREHILLAHQVGVDYIVVFLNKTDLVDD----------DELVDLVEMEVR
EFTU_LACP3       VAATDGPMPQTREHILLARQVGVDYIVVFLNKTDLVDD----------PELIDLVEMEVR
EFTU_LACRD       VAATDGPMPQTREHILLARQVGVQYIVVFLNKTDLVDD----------DELVDLVEMEVR
EFTU_OENOB       VAATDGPMPQTREHILLARQVGVNYIVVFLNKTDLVDD----------PELIDLVEMEVR
EFTU_LACS1       VAATDGPMPQTREHILLARQVGVEYIVVFLNKCDLVDD----------DELLDLVEMEVR
EFTU_LACSS       VAATDGPMPQTREHILLAHQVGVDYIIVFLNKTDLVDD----------DELTDLVEMEVR
EFTU_LACJO       VAATDGPMPQTREHILLARQVGVQYIVVFLNKVDLVDD----------PELIDLVEMEVR
EFTU_LACDA       VAATDGPMPQTREHILLARQVGVNSIVVFLNKCDLVDD----------PELIDLVEMEVR
EFTU_LEUMM       VAATDGPMPQTREHILLARQVGVDYLVVFLNKTDLVDD----------EELVELVEMEVR
EFTU_STRMU       VASTDGPMPQTREHILLSRQVGVKYLIVFMNKVDLVDD----------EELLELVEMEIR
EFTU_LACLS       VAATDGPMPQTREHILLSRQVGVKYLIVFLNKADLVDD----------EELMELVEMEVR
EFTU_GEOTN       VSAADGPMPQTREHILLSRQVGVPYIVVFLNKCDMVDD----------EELLELVEMEVR
EFTU_BACCN       VSAADGPMPQTREHILLSRQVGVPYIVVFLNKCDMVDD----------EELLELVEMEVR
EFTU_BACSK       VSAADGPMPQTREHILLSRNVGVPYLVVFLNKCDMVDD----------EELLELVEMEVR
EFTU_BACLD       VSAADGPMPQTREHILLSRNVGVPYIVVFLNKCDMVDD----------EELLELVEMEVR
EFTU_OCEIH       VSAADGPMPQTREHILLSRNVGVPAFVVFLNKTDMVDD----------EELLELVEMEVR
EFTU_STAS1       VSAADGPMPQTREHILLSRNVGVPALVVFLNKVDMVDD----------EELLELVEMEVR
EFTU_ENTFA       VSAADGPMPQTREHILLSRNVGVPYIVVFLNKMDMVDD----------EELLELVEMEVR
EFTU_LISIN       VSAADGPMPQTREHILLSRQVGVPYIVVFMNKCDMVDD----------EELLELVEMEIR
EFTU_ACHLI       VSAADGPMPQTREHILLSRQVGVPKLVVFLNKADLVDD----------EELLDLVEMEVR
EFTU_MYCGE       VSATDSVMPQTREHILLARQVGVPKMVVFLNKCDIASD----------EEVQELVAEEVR
EFTU_MYCGA       VSATDGPMPQTREHILLARQVGVPKMVVFLNKCDVADD----------PEMQELVEMEVR
EFTU_MYCPE       VAASDGPMPQTREHILLARQVGVPKMVVFLNKCDMVSD----------AEMQDLVEMEVR
EFTU_UREP2       IAASDGVMAQTKEHILLARQVGVPKIVVFLNKCDFMTD----------PDMQDLVEMEVR
EFTU_MYCPU       VSATDGPMPQTREHILLSKQVGVPKMVVFLNKVDMLEG---------EDEMIELVELEIR
EFTU_MYCHJ       VAATDGPMPQTREHILLSKQVGVPKMVVFLNKIDLLEG---------EEEMVDLVEVEIR
EFTU_MYCMO       VAATDGPMPQTREHILLSKQVGVPKMVVFLNKVDLLGSGSE------AEEMADLVEFEIR
EFTU_MYCS5       VAATDGPMPQTREHILLSKQVGVPRMVVFLNKCDMVDD----------EEMIGLVEMEIR
EFTU_MYCMS       VAATDGPMPQTREHILLSRQVGVPKIVVFLNKCDMVED----------DEMIDLVEMEIR
EFTU_MESFL       VAATDGPMPQTREHILLSRQVGVPKIVVFLNKCDMVDD----------EEMIDLVEMEVR
EFTU_THEMA       VAATDGPMPQTREHVLLARQVEVPYMIVFINKTDMVDD----------PELIDLVEMEVR
EFTU_FERIS       LAATDGPMPQTREHVLLARQVNVPAMIVFINKVDMVD-----------PELVDLVEMEVR
EFTU_THEM4       VAATDGPMPQTREHVLLARQVNVPAMIVFINKTDMVDD----------EELVDLVEMEVR
EFTU_PSELT       VAATDGPMPQTREHVLLARQVNVPAMVVFLNKVDAVDD----------QELVDLVEMEVR
EFTU_PETMO       VAATDGVMPQTREHVLLARQVNVPALVVFINKVDMVDD----------EELIDLVEMEVR
EFTU_AQUPY       VSAADGPMPQTREHVLLARQVNVPYIVVFMNKCDMVDD----------EELLELVELEVR
EFTU2_ROSCS      VSAPDGPMPQTREHVLLARQVQVPAMVVFLNKVDMMDD----------EELLELVELELR
EFTU_CHLAA       VSAPDGPMPQTREHILLARQVQVPAIVVFLNKVDMMDD----------PELLELVELELR
EFTU_HERAU       VSAPDGPMPQTREHILLAGQVEVPAMVVFLNKVDMMDD----------PELLELVEMELR
EFTU_DEHM1       VSAPDGPMPQTREHVLLIHQVEVPAVVVALNKCDMMDD----------EELLELVELEVR
EFTU_STRCJ       VAATDGPMPQTKEHVLLARQSGVPYIVVALNKADMVDD----------EEIMELVELEVR
EFTU2_STRRA      VAATDGPMPQTKEHVLLARQVGVPYIVVALNKTDMVDD----------EEILELVELEVR
EFTU_PLARO       VAATDGPMPQTKEHVLLARQVGVPYIVVALNKADMVDD----------EEILELVELEVR
EFTU_THEFY       VAATDGPMPQTKEHVLLARQVGVPYIVVALNKSDMVDD----------EEIFDLVELEVR
EFTU_FRACC       VSATDGPMPQTKEHVLLARQVGVPYIVVALNKADMVDD----------EEILELVELEVR
EFTU_KINRD       VAATDGPMPQTKEHVILARQVGVPYIVVALNKADMVED----------EELLELVEMEVR
EFTU_SALAI       VAATDGPMPQTREHVLLARQVGVPYIVVALNKSDMVDD----------EELLELVELEVR
EFTU_NOCSJ       VAATDGPMPQTREHVLLARQVGVPALVVALNKCDMVDD----------EELIELVEMEVR
EFTU_SACEN       VAATDGPMPQTREHVLLARQVGVPYILVALNKADMVDD----------EEIIELVEMEVR
EFTU_RHOJR       VAATDGPMPQTREHVLLARQVGVPYILVALNKADMVDD----------DEIIELVEMEVR
EFTU_CORDI       VAATDGPMPQTREHVLLARQVGVPYILVALNKCDMVDD----------EEIIELVEMEIR
EFTU_CORJK       VAATDGPMPQTREHVLLARQVGVPYILVALNKCDMVDD----------EELLELVEMEVR
EFTU_ACIC1       VSAADGPMPQTKEHVLLARQVGVPYIVVALNKADVVDD----------EEILQLVELEVR
EFTU_CUTAK       VAATDGPMPQTREHVLLARQVGVPAIVVALNKCDMVDD----------EELIELVEMEVR
EFTU_TROW8       VAATDGAMAQTREHVLLAKQVGVPYLLVALNKADMVSD----------EEILELVELEVR
EFTU_LEIXX       VAATDGPMAQTREHVLLAKQVGVPYLLVALNKSDMVDD----------EEILELVELEVR
EFTU_MICLU       VAATDGPMAQTREHVLLARQVGVPALLVALNKSDMVED----------EELLERVEMEVR
EFTU_BRELN       VAATDGPMPQTREHVLLARQVGVPYIVVALNKSDMVDD----------EELLELVEFEVR
EFTU_BIFAA       VAATDGPMAQTREHVLLARQVGVPKILVALNKCDMVDD----------DELIELVEEEVR
EFTU3_STRRA      VSALDGIMPQTAEHVLLARQVGVDHIVVALNKADAG-D----------EELTDLVELEVR
EFTU_PAROE       VAATDGPMPQTREHILLARQVGVPQLVVFMNKVDMVDD----------PELLELVEMEIR
EFTU_CYTH3       VAATDGPMPQTREHILLARQVGVPAMVVFMNKVDLVDD----------PELLELVEMEIR
EFTU_PARD8       VAATDGPMPQTREHILLARQVNVPRLVVFMNKCDMVDD----------EEMLELVEMEMR
EFTU_CELLY       VAATDGPMPQTREHILLGRQVGIPRIVVFLNKVDMVDD----------EELLELVEMEVR
EFTU_GRAFK       VAATDGPMPQTREHILLGRQVGIPRIVVFLNKVDLVDD----------EELLELVEMEVR
EFTU_FLAPJ       VAATDGPMPQTREHILLGRQVGIPRMVVFMNKVDMVDD----------EELLELVEMEIR
EFTU_SULMW       VAATDGPMPQTREHILLARQVGVPNLVVFMNKVDQVDD----------KEILELVEIEIR
EFTU_TERFE       VAASDGPMPQTKEHILLAAQVGVPKMVVFLNKVDLVDD----------EELLELVEIEVR
EFTU_SALRD       VGSDDGPMPQTREHILLARQVGVPYLVVFMNKTDLVDD----------AELLELVEMEVR
EFTU_SOLUE       VAATDGPMPQTREHILLARQVGVPYIVVAMNKVDMVDD----------SELLDLVELEVR
EFTU_KORVE       VAATDGPMPQTKEHVLLARQVGVPYVVVFLNKCDAVED----------AELIDLVEMEVR
EFTU_CHLPN       VSATDGAMPQTKEHILLARQVGVPYIVVFLNKVDMISQE--------DAELIDLVEMELS
EFTU_PARUW       VAATDGAMPQTREHILLARQMQVPAIVVFLNKVDMLGES--------DSELLDLVEMELH
EFTU_TRIV2       VAATDGPMPQTREHILLAKQVGVPKLVVFLNKEDMMED----------AELLELVELELR
EFTU_THEEB       VAATDGAMPQTKEHILLARQVGVPSIVVFLNKVDMVDD----------EELLELVELELR
EFTU_MICAN       VSAADGPMPQTREHILLARQVGVPNLVVFLNKKDMVDD----------EELLELVELEVR
EFTU_SYNJA       VSAADGPMPQTREHILLARQVGVPSLVVFLNKVDMVDD----------EELLELVELEIR
EFTU_GLOVI       VSAADGPMPQTREHILLARQVGVPNIVVFLNKKDQLDD----------PELLELVELEVR
EFTU_SYNE7       VSAADGPMPQTREHILLAKQVGVPNIVVFLNKEDMVDD----------AELLELVELEVR
EFTU_ACAM1       VSAADGPMPQTREHILLAKQVGVPNIVVFMNKQDQVDD----------EELLELVELEVR
EFTU_TRIEI       VSAADGPMPQTREHILLAKQVGVPNIVIFLNKQDMVDD----------EELLELVELEVR
EFTU_SYNY3       VSAADGPMPQTREHILLAKQVGVPKLVVFLNKKDMVDD----------EELLELVELEVR
EFTU_ARTPT       VSAADGPMPQTREHILLAKQVGVPSIVVFLNKADMVDD----------EELLELVELEVR
EFTU_CYAM1       VSAADGPMPQTREHILLAKQVGVPSIVVFLNKADMVDD----------PELLELVELEVR
EFTU_CYACA       VSAADGPMPQTREHILLAKQVGVPSIVVFLNKADMIDD----------EELLELVELEVR
EFTU_EMIHU       VSAADGPMPQTREHILLAKQVGVPHLVVFLNKADQVDD----------EELLELVELEVQ
EFTU_GUITH       CSAANGPMPQTREHILLAKQVGVPYIVVFLNKADMVDD----------EELLELVQLEVQ
EFTU_GRATL       VSAADGPMPQTREHILLAKQVGVPNVVVFLNKQDQVDD----------EELLELVELEVR
EFTU_CYAPA       VSAADGPMPQTREHILLAKQVGVPNMVVFLNKEDQIDD----------ADLLELVELEVR
EFTU_CYCME       VSAADGPMPQTREHILLAKQVGVPHIVVFLNKQDQVDD----------DELLELVELEVR
EFTU_PHATC       VSAADGPMPQTREHILLSKQVGVPNIVVFLNKEDQVDD----------EELLELVELEVR
EFTU_TRICV       VSAADGPMPQTREHILLSKQVGVPDIVVFLNKEDQVDD----------AELLELVELEVR
EFTU_PROM1       VAATDGAMAQTKEHILLAKQVGVPALVVALNKCDMVDD----------EEMIELVEMEIR
EFTU_CHACO       VSAADGPMPQTKEHILLAKQVGVPSIVVFLNKEDQVDD----------EEILQLVDLEVR
EFTU_COLOB       VSAVDGPMAQTKEHILLAKLLGISSILVFINKEDELDD----------QEVLPMLIQNMR
EFTU_TOXGO       VSAVDGPMPQTKEHLLLAKQIGISNIIVFLNKIDLIDD----------NEILELVELETR
EFTU_EIMTE       VSATDGPMPQTREHLLLAKQVGVPNIIVFLNKIDMVED----------NELLELVELEVR
EFTU_THEPA       ISLEDGPMPQTIEHLLLAKQIGIKKLVVFLNKEDKVDD----------EEIIFFIKEETK
EFTU_PLAF7       ISIIDGIMPQTYEHLLLIKQIGIKNIIIFLNKEDLCDD----------VELIDFIKLEVN
                      .   ** **::*     :  .:: :** *                    :  :  

EFTU_OLTVI       ETLDNYEFD-------GDDIPIIPGSALLALEALIESPE---AKKGDNEWVDCIYSLMEN
EFTU_TUPAK       ETLDKYEYP-------GDDIPIIAGSALLALEALIENPN---VKPGENEWVDKILKLMQN
EFTU_NEPOL       ETLSNYEFP-------GDEVPVVPGSALLALEAMTENPS---LKRGENEWVDKIFALMDA
EFTU_OSTTA       ETLSSYDFP-------GDEIPVIAGSALLALEALSSNPK---IGDGEDKWVDKIFSLMDN
EFTU_CHLVU       ETLDKYEFP-------GDEIPIISGSALLALEALTENPE---TKPGDNKWVDKIYNLMDQ
EFTU_PLETE       ETLDNYEFP-------GDEIPIVPGSALLALQALSENPE---ITPGQNPWVDKIFKLMDT
EFTU_PROWI       ETLQRYDFP-------GDEVPMIPGSALMALTALTDNPK---IKPGENKWVDKIYNLMDI
EFTU_CHLAT       ETLSDYDFP-------GDEVPVVAGSALLALESLTQNPK---IVKGENKWVDKIYSLMDQ
EFTU_MESVI       ETLNSYDFP-------GDEIPVVAGSALMALEALTQDSK---LARGSNPWVDKIYALMDQ
EFTU_EUGGR       ETLSNYEFP-------GDDIPVIPGSALLSVEALTKNPK---ITKGENKWVDKILNLMDQ
EFTU_EUGLO       ETLNNYEFP-------GDEIPIITGSALLAIEALNKNPK---IIKGENKWVDKILDLMDK
EFTU_BIGNA       EMLDTYDFP-------GDSTPIIKGSALMALQALMETDE---MSRGSNPWVDKILTLMDN
EFTU_HELSJ       DLLTSYKFE-------GEEVPVITGSALLALEAFIKNPK---ILKGENPWVDKIYNLMDS
EFTU_CODFR       ETLTTYEYP-------GEEIPIITGSAITALESLTAKYV---LRIG-NKWVQKIYDLMET
EFTU_TETOB       ETLDKYEFP-------GDEIPIVSGSALLALEALVENPK---IQRGDNKWVDKIFDLMDK
EFTU_CHLRE       ETLDKYEFP-------GDEIPVVPGSALLALEALIENPK---TQRGENKWVDKIYQLMDN
EFTU_STIHE       DILDKYGFA-------SDEVQILSGSALLALEALVENPN---IKPGDSEWVDKIYNLMAT
EFTU1_ECOLI      ELLSQYDFP-------GDDTPIVRGSALKALEG-DAE------------WEAKILELAGF
EFTU1_YERE8      DLLSTYDFP-------GDDTPVVRGSALKALEG-EPE------------WEAKIIELAGY
EFTU_HAEDU       ELLSQYDFP-------GDDTPIVRGSALQALNG-VPE------------WEEKIIELAQH
EFTU_BUCBP       DLLTQYDFP-------GDSTPIVRGSALKALEG-DPQ------------WEQKILDLSNY
EFTU_BUCAI       DLLTQYDFP-------GDDTPIIRGSALKALEG-DPE------------WESKIIDLSKF
EFTU_BUCCC       DLLTQYDFP-------GDNIPIIRGSALKALEG-EKI------------WEDKIIELANS
EFTU_AERS4       ELLTEYDFP-------GDDLPVVRGSALKALEG-DAA------------WEEKIIELANH
EFTU2_PSEHT      ELLSEYDFP-------GDDLPLIQGSALKALEG-EKE------------WEDKIVELANA
EFTU1_PHOPR      ELLSEYDFP-------GDDCPVIMGSALGALNG-EAQ------------WEEKIIELAEA
EFTU_PSEA6       ELLSEYEFP-------GDDLPVIQGSALKALEG-EEQ------------WEAKIIELAEA
EFTU_PSYIN       ELLSEYDFP-------GDDLPVIQGSALKALEG-DPV------------WEAKVMELADA
EFTU_COLP3       ELLSEYDFP-------GDDLPVIQGSALGALQG-DEA------------WEAKIIELADA
EFTU_SHEAM       ELLSEYDFP-------GDDLPVIQGSALKALEG-DAA------------WEGKIIELAEA
EFTU_BLOPB       ELLSQYDFP-------GDNTPIIRGSALKALEN-DEI------------WSNKILELSDA
EFTU_BLOFL       ELLSQYDFP-------GDSAPIIQGSALKALEG-DEK------------WSSKVLELSSI
EFTU_BAUCH       ELLSQYEFP-------GENTPIIRGSALKALEH-DVD------------WTSKIIELAEV
EFTU_WIGBR       ELLSQYDFP-------GDEIPIIRGSALKALEK-DPI------------WIQKIIDLSEH
EFTU_PSYA2       ELLSDYDFP-------GDDTPIIHGSATEALKG-SQEKY----------GQPAVVELLNV
EFTU_ACIAD       ELLSTYDFP-------GDDTPVIRGSALKALEG-DAGQY----------GESSVLALVEA
EFTU_NEIGO       DLLSSYDFP-------GDDCPIVQGSALKALEG-DAA------------YEEKIFELATA
EFTU_CHRVO       DLLSSYDFP-------GDDTPIVTGSARLALEG-DQSEM----------GEPSIFRLADA
EFTU_NITMU       ELLSKYNFP-------GDDTPIVIGSALKALEG-DQSDI----------GEPSIYKLAAA
EFTU1_METFK      ELLSKYDFP-------GDDTPIIKGSAKLALEG-DQSDI----------GEPAIFRLAEA
EFTU_THIDA       ELLSKYDFP-------GDDTPIIVGSALKALEG-DQSDI----------GEPSIIKLAEA
EFTU_DECAR       ELLSKYDFP-------GDDTPIIHGSALKALEG-DQSEI----------GEPSIFRLADA
EFTU_HERAR       ELLSKYEFP-------GDDLPIIKGSAKLALEG-DQGPL----------GEAAILALADA
EFTU_POLAQ       ELLSKYDFP-------GDDTPIIQGSAKLALEG-DEGPM----------GKEAIMKLAEA
EFTU2_RHOFT      ELLDKYEFP-------GDTTPIIHGSAKLAMEG-DKGPM----------GEQAIMKLADA
EFTU_BORA1       ELLSKYDFP-------GDDTPIVKGSAKLALEG-DKGEL----------GEQAILSLAAA
EFTU1_XANCB      ELLSKYDFP-------GDDTPIIHGSARLALEG-DQSDI----------GVPAILKLVEA
EFTU_XYLFT       ELLSKYDFP-------GDDTPIVRGSALKALEG-DQSEI----------GVPAIIRLAEA
EFTU_METCA       ELLSKYDFP-------GDDIPIIKGSALKALEG-DGSEI----------GVPAVEALVQA
EFTU_DICNV       ELLNEYDFP-------GDDTPIVVGSALKALEG-DTSEI----------GIPAIEKLVDA
EFTU_PSEA7       DLLNTYDFP-------GDDTPIIIGSALMALEGKDDNGI----------GVSAVQKLVET
EFTU_PSEF5       DLLSTYDFP-------GDDTPIIIGSALMALNGQDDNEM----------GTTAVKRLVET
EFTU_HAHCH       DLLSQYEFP-------GDDTPIIVGSALLALEGKDDNGM----------GTSAVKKLVET
EFTU_SACD2       ELLDTYEFP-------GDDTPIIAGSALMALNGEDENEL----------GTTAVKKLVEA
EFTU_MARMS       DLLSEYDFP-------GDDTPIIPGSALMALKGEDDNEM----------GTTAVRKLVET
EFTU_CHRSD       ELLNEYDFP-------GDDCPIITGSALMALEGKDDNGM----------GTTAVANLIKA
EFTU_ALCBS       ELLSDYDFP-------GDDTPIIKGSALKALEG-DTSDI----------GMPAVQKLVET
EFTU_LEGPL       DLLSSYDFP-------GDDIPIIVGSALKALEG-EDSDI----------GVKAIEKLVET
EFTU1_HALHL      ELLSDYDFD-------GDNIPVVTGSALKALEG-DDSEM----------GRPAIIKLVEA
EFTU_ALKEH       ELLSDYDFP-------GDDTPVITGSALKALEG-DDSEI----------GKPSIIKLAEA
EFTU_COXBU       DLLNSYDFP-------GDETPIIVGSALKALEG-DKSEV----------GEPSIIKLVET
EFTU_NITOC       ELLDSYQFP-------GDDTPIVVGSALKALEG-DTSEI----------GIPSILKLVEQ
EFTU_VESOH       ELLDEYDFP-------GDDTPVIFGSALKALEG-DISDI----------GVPSILKLVDA
EFTU_HYDCU       ELLDTYDFP-------GDDTPVIMGSALKAIEG-DQSEI----------GEPSIGRLVDA
EFTU_FRAP2       ELLDQYDFP-------GDDTPVIMGSALKAIEG-EEQ------------YVEKIVELVAA
EFTU_FUSNN       ELLTEYGFP-------GDDIPVIRGSSLGALNG-EEK------------WVEKILELMEA
EFTU_CAMJD       ELLSSYDFP-------GDDTPIISGSALKALEEAKAGQD-----GE---WSAKIMDLMAA
EFTU_CAMHC       DLLKEYGFP-------GDEIPIIKGSALKALEEAKAGGD-----GE---WSAKIMELMDA
EFTU_HELAH       ELLSAYEFP-------GDDTPIVAGSALKALEEAKAGSV-----GE---WGEKVLKLMAE
EFTU_WOLSU       ELLSNYDFP-------GDDTPIVAGSALKALEEAKTGNV-----GE---WGEKVLKLMAE
EFTU_NITSB       ELLNEYDFP-------GDDVPVIAGSALKALEEAKEGKL-----GE---WSEKILKLMEA
EFTU_ARCB4       ELLSTYDFP-------GDDTPIIAGSAFQALEEAKAGAV-----GP---WGEKIVALMDA
EFTU_SULNB       ELLSEYDFP-------GDDTPIVAGSAFQALEEAKTGTL-----GE---WSAKIMELMDA
EFTU_SULDN       ELLDMYDFP-------GDDTPIVAGSAKEALDEAKTGTL-----GP---WSAKIQKLMAA
EFTU_RICAH       DLLLQYGFP-------AYEVPIIKGSALQALAGKPE-------------GEKAINELMDA
EFTU_RICBR       ELLSKYDFP-------GDEIPIIRGSALQALEGKPE-------------GEKAIHELMDA
EFTU_MAGSA       ELLSSYDFP-------GDDIPIVRGSALCALEDKQPEI-----------GRDAILKLMAE
EFTU_PARL1       ELLSSYDFP-------GDDIPIVKGSALAALEDSNKEI-----------GHDAILELMKA
EFTU_GLUOX       ELLSSYQFP-------GDDIPIVKGSALVTLEDGDPSI-----------GEDRVLELMTQ
EFTU_AZOC5       ELLSKYDFP-------GDDIPIVRGSALCALENKSPEL-----------GAEAILKLMAE
EFTU1_RHORT      ELLTSYDFP-------GDDIPIVKGSALAALEDSDPKL-----------GHDAILELMKA
EFTU_ACICJ       DLLSKYEFP-------GDDIPIIKGSALCALEDSNAEL-----------GREAILKLMEA
EFTU_NOVAD       ELLSSYDFP-------GDDIPIVKGSALAALEGRDDNI-----------GKDSINALMAA
EFTU_ERYLH       ELLSEYDFD-------GDNIPIVKGSALAALEGRDDNI-----------GKESIVELMKA
EFTU_SPHAL       EELSKRDFD-------GDNIPIIAGSALAALEGRDDNI-----------GKDAILKLMAA
EFTU_ZYMMO       ELLSSYDFP-------GDDIPIVKGSALAALEDKNPEI-----------GKEAILSLMAA
EFTU_SPHWW       ELLSSYEFP-------GDDIPVIKGSAVKALDGTNDEI-----------GRNAVLELMAA
EFTU_RHIL3       ELLSSYDFP-------GDDIPIIKGSALAALEDSDKKI-----------GEDAIRELMAA
EFTU_RHILO       ELLSKNEFP-------GDDIPIVKGSALAALEDSNKTI-----------GEDAIRELMAQ
EFTU_JANSC       ELLSSYEYP-------GDDIPVIPGSALAALEGRDDAI-----------GKDSIDKLMAA
EFTU_ROSDO       ELLSSYDYP-------GDDIPVIPGSALAAMEGRDPEI-----------GEEAIKKLMAA
EFTU_RHOS5       ELLSSYDYP-------GDDIPIIKGSALAAMNGTDKEI-----------GEDSIRALIAA
EFTU_PARDP       ELLSSYDYP-------GDDIPIVKGSALAALEGRDAEI-----------GENSIRELMKA
EFTU_CAUVC       ELLSSYQFP-------GDDIPITKGSALAAVEGRDPQI-----------GEEKILELMAS
EFTU1_HYPNA      ELLSSYNFP-------GDDIPIIKGSALAAVEDRNPEI-----------GQERILELMAA
EFTU_MARMM       ELLSSYEFP-------GDDLPIVAGSALAAVEGRDDHI-----------GKDKILELMAA
EFTU_MAGMM       ELLSSYDFP-------GDDIPVIKGSALKALEGEESEM-----------GVDAINRLMDA
EFTU_ANADF       ELLSEYEFP-------GNEIPIVKGSALKALEGDKSEL-----------GEPAIQQLLDA
EFTU_STIAU       DLLKKYEFP-------GDSIPIIPGSALKALEGDTSDI-----------GEGAILKLMAA
EFTU_BDEBA       ELLSKYEFP-------GDDIPVVKGSALKALEGDTSEI-----------GRPAIMKLMEA
EFTU_PELUB       ELLTSYKYP-------GDKTPIVKGSALAAVEGRDEEI-----------GKNSIIELMKA
EFTU_CHLPD       ELLTEYNFP-------GDDIPIIKGSALKALDGDLE-------------GEKSIMELMDA
EFTU_GEOUR       ELLSSYDFP-------GDDIPIIKGSALKALEGDTGEL-----------GEQAIMKLMEA
EFTU1_PELCD      ELLSSYDFP-------GDDIPIVAGSALKALECGCGKDD-----CD---ACKPIIELMNQ
EFTU2_DESPS      ELLDDYEFP-------GDDVPFIHGSALLALENPEDED-----------KAACIWALMEA
EFTU_FLESI       DLLNTYEFP-------GDDIPIIKGSALQALENAEDEE-----------KTKCIWELLQA
EFTU_DESVH       ELLTSYGFP-------GDDVPVVRGSALKALESDDPNSD----------ACKPIRELLAA
EFTU_DESAG       ELLSSYDFP-------GDDTPVIRGSALKALECDSADDD----------AAKPILELLDA
EFTU_LAWIP       ELLSTYGYP-------GDDVPVIRGSALKALNSDSADSD----------DAKPILELLDA
EFTU_SYNFM       ELLSKYGFP-------GDDVPIIKGSALRALEADDPEHP----------DTKCIFELMEA
EFTU_SYNAS       ELLNEYEFP-------GDDIPIIRGSALKALESENPDDP----------DVKQIYALMDA
EFTU_EHRRG       ELLTKYGYP-------GDDIDVVKGSAVKALEEESADGV-----W-----SEKIMELMNA
EFTU_ANAPZ       ELLSQYGYD-------GDSIDAVRGSAVKALEED-ADGP-----W-----SDKIMELVGA
EFTU2_WOLPM      ELLSKYGFP-------GDEVPVVVGSALKALEDD-SSEY-----G-----KKSIDKLMEK
EFTU1_ORITB      ELLTKYDFP-------GDTVPIIRCSALKAINGD-SD-------A-----KKGILELMDA
EFTU_NEOSM       DLLISHGFDLPEDEEDGSNPAIIRGSALLALNGE-ESEL-----G-----KGSIRKLLAA
EFTU_AYWBP       ELLSQYDFP-------GDDIPVIRGSALKALEGDAHY-------------VAQVNKLIET
EFTU_APPPP       ELLNEYKFD-------GDKTPFVRGSALKALEGTD---------------VEGINKLLEV
EFTU_CARRP       ELLTEYDFD-------GNNTKIIIGSALLALENKDDNQL-----G-----TSSIIKLLEI
EFTU_SORC5       ELLSKYKFD-------GDNAPVVRGASLPALQ--GDPKW-----E------ETIQQLLSA
EFTU_RHOBA       ELLSKYDYP-------GDDVPVVRGSSLPAYNNPSDPEA-----S------KCITELMEA
EFTU_BRAHO       DVLDHYGFD-------GSKTPIIRGSAIKAIQAIEAGKD-----PRTDPDCKCILDLLNA
EFTU_TREDE       ETLTSYGFP-------ED-TPIIKGSAFKALQEGATAED-----T------ACIEELLKT
EFTU_TREPA       DALAGYGFS-------RE-TPIVKGSAFKALQDGASPED-----A------ACIEELLAA
EFTU_BORBU       ELVEKYGFS-------AD-TPIIKGSAFGAMSNPEDPES-----T------KCVKELLES
EFTU_LEPBL       DLLNKYNFP-------GDTTPIVYGSAVKALEGDESEIG-----A------PAILKLMEA
EFTU_RUBXD       ELLSEYEFP-------GDEVPVVVGSALKALEGDEGELG-----E------QSILKLLEA
EFTU2_PELTS      ELLSTYEFP-------GDEIPIITGSALKAMECA-----CGKRE---CEWCKSIWELMDA
EFTU_DESRM       ELLNSYEFP-------GDDTPIVAGSGLKALECG-----CGKRE---CEWCGKIWELMDN
EFTU2_CARHZ      DLLSTYEFP-------GDEVPVVAGSALKALECG-----CGKED---CPWCGKILELMDK
EFTU1_SYNWW      ELLSFYEFP-------GDDIPVLMGSALKALECG-----CGTRE---CEWCKHIWELMDA
EFTU_MOOTA       ELLTEYEFP-------GDEIPIVTGSALKAMECG-----CGKRE---CEWCGKVWELMDA
EFTU2_CALS4      DLLNQYEFP-------GDETPIVVGSALKALECG-----CGKRE---CQWCGKIWELMDV
EFTU_DESHY       ELLSEYEFP-------GDDIPIIPGSGLKALQCG-----CGSRD---CEWCGKIWNLMDA
EFTU_CLOBM       ELLNEYGFP-------GDDTPIVVGSALEVLE--------NQDN---AEKTKCIDELMEA
EFTU_CLOK5       ELLSEYGFP-------GDDVPIIVGSALKVIE--------NPED---AEATKCIYELMEA
EFTU_CLOAB       ELLNEYGFP-------GDDTPIVVGSALKALQ--------NPDD---AEAIKPIKDLMAE
EFTU_CLOTE       ELMNEYGFP-------GDDAPVVVGSALKALE--------NPED---DAATQCIMDLMAA
EFTU_CLONN       ELLSEYGFD-------GDECPVVVGSALKAIE--------EGDD-------QCILDLMKA
EFTU_CLOPS       ELLSEYNFP-------GDDIPVIKGSALVALE--------NPTD---EAATACIRELMDA
EFTU_CLOB8       ELLSEYDFP-------GDDIPVITGSALKALE--------NPTD---EEAIKPIMDLMEA
EFTU_CALS8       ELLSKYGYP-------GDEVPIVKGSALKALESP-----SQDPN---APEYQCILELMDV
EFTU_SYMTH       ELLNQYEFP-------GDEIPFIRGSALKALEG--------DP-----KYVKAIEELMDA
EFTU_HUNT2       ELLNTYEFP-------GDEIPIIRGSALAALEST-----ATSVD---APEYQPILKLMEE
EFTU_ALKOO       DLLNEYEFP-------GDDTPIVRGSALQALN---------DPA---GPWGDKIVELFEH
EFTU_CLOD6       DLLTEYDFP-------GDDTPIVRGSALMALE---------DPK---SEWGDKIVELFEQ
EFTU2_ALKMQ      DLLNMYEFP-------GDDTPVIMGSALKALE---------DPA---GPWGDKIVELFDA
EFTU_LACP7       ELLSEYEFP-------GDDTPIIQGSALRALE---------DPN---SQWGDKILELFDA
EFTU_THEAQ       DLLNQYEFP-------GDEVPVIRGSALLALEEMHKNPKTKRGE---NEWVDKIWELLDA
EFTU_DEIGD       ELLSKYEFP-------GDDLPVIKGSALQALEALQQNPKTARGE---NPWVDKIWELLDA
EFTU_LACBA       ELLSEYDYP-------GDDIPVIRGSALKALE----------GD---EEQEKVILHLMDV
EFTU_PEDPA       ELLSEYDFP-------GDDVPVLRGSALKALE----------GD---AEQEKVIMDLMDT
EFTU_LACP3       ELLSEYDYP-------GDDIPVIRGSALKALE----------GD---PEQEKVIMELMDT
EFTU_LACRD       DLLSEYDFP-------GDDVPVVRGSALKALE----------GD---PEQEKVILHLMDV
EFTU_OENOB       ELLSEYDFP-------GDDIPIIRGSALKALQ----------GD---PEQEKVILHLMDV
EFTU_LACS1       DLLSEYDFP-------GDDIPVIRGSALKALE----------GD---KDAEAQIMELMDT
EFTU_LACSS       ELLSEYDFP-------GDDIPVIRGSALGALN----------GN---PDDVKAVEELMAT
EFTU_LACJO       DLLSEYDYP-------GDDVPVIRGSALKALE----------GD---PEQQDVIRKLMET
EFTU_LACDA       DLLSEYGYP-------GDDVPVVRGSALKALE----------GD---EEAQKKIEELMDV
EFTU_LEUMM       ELLSEYDFP-------GDDIPVLKGSALKALE----------GD---PEQVKVIEELMDT
EFTU_STRMU       DLLSEYDFP-------GDDIPVIQGSALKALE----------GD---TAQEDIIMELMHT
EFTU_LACLS       DLLSEYDFP-------GDDIPVIAGSALGALN----------GE---PQWVAKVEELMDI
EFTU_GEOTN       DLLSEYDFP-------GDEVPVIKGSALKALE----------GD---AQWEEKIVELMNA
EFTU_BACCN       DLLSEYEFP-------GDDIPVVKGSALKALE----------GD---AEWEAKIVELMAE
EFTU_BACSK       DLLSEYDFP-------GDDVPVIQGSALKALQ----------GE---AEWEEKIIELMNA
EFTU_BACLD       DLLSEYEFP-------GDDVPVIKGSALKALE----------GD---AQYEEKIFELMAA
EFTU_OCEIH       DLLTEYDFP-------GDDLPVIKGSALKALE----------GV---AEYEERILELMAA
EFTU_STAS1       DLLSEYDFP-------GDDVPVISGSALKALE----------GD---ADYEQKILDLMQA
EFTU_ENTFA       DLLSEYDFP-------GDDVPVIAGSALKALE----------GD---ESYEEKILELMAA
EFTU_LISIN       DLLTEYEFP-------GDDIPVIKGSALKALQ----------GE---ADWEAKIDELMEA
EFTU_ACHLI       ELLSEYDFP-------GDDIPVIKGSALGALE----------GK---PEWVAKVEELMDA
EFTU_MYCGE       DLLTSYGFD-------GKNTPIIYGSALKALE----------GD---PKWEAKIHDLIKA
EFTU_MYCGA       DLLKSYGFD-------GDNTPVIRGSALGALN----------GE---PAWEEKIHELMKA
EFTU_MYCPE       ELLSSYGFD-------GDNTPVIRGSALKALE----------GD---ATWEAKIDELMAS
EFTU_UREP2       ELLSKYGFD-------GDNTPVIRGSGLKALE----------GD---PVWEAKIDELMDA
EFTU_MYCPU       SLLSEYGFD-------GDKTPIIKGSALKALE----------GN---PQYEKNIEELMDA
EFTU_MYCHJ       ELLSSYDFD-------GDNTPIIRGSARGALE----------GK---PEWEAKVLELMDA
EFTU_MYCMO       DLLSQYEFD-------GENTPVVRGSALKALN----------GE---KAWEDKVMELMSQ
EFTU_MYCS5       DLLSEYGFD-------GDNAPIVRGSALKALE----------GD---AVYEDKILELMNA
EFTU_MYCMS       DLLTEYDFD-------GEGAPVIRGSALGALN----------GD---SKWTGAINELMAA
EFTU_MESFL       DLLSAYDFD-------GDGAPVIRGSALGALN----------GE---AKWVAAIEELMAA
EFTU_THEMA       DLLSQYGYP-------GDEVPVIRGSALKAVEAP-NDPN--------HEAYKPIQELLDA
EFTU_FERIS       DLLSKYEFP-------GDEVPVVRGSALKAIEAP-NDPN--------DPAYKPIKELLDA
EFTU_THEM4       ELLNKYEFP-------GDDLPVIRGSALKAVEAS-NDPN--------DEAYAPIKELLDT
EFTU_PSELT       DLLTKYEFP-------GDEIPVIRGSALLALEA--NDPN--------DAAYKPIQELIDA
EFTU_PETMO       DLLNSYEFP-------GDEVPVIRGSALKALEE--DNPD--------GPWTQKIYELMDA
EFTU_AQUPY       ELLSKYEYP-------GDEVPVIRGSALGALQELEQNSP--------GKWVGSIKELLNA
EFTU2_ROSCS      ELLSNHGFP-------GDEIPIIRGSALAALSSASTDIN--------APEYQCILDLMNA
EFTU_CHLAA       ELLSKYGFP-------GDEIPIVRGSARNALESPSKDIN--------APEYKCILELMNA
EFTU_HERAU       ELLTKYGFP-------GDEIPIVRGSAKGALDSASTDAS--------QPEYQSIQELMQA
EFTU_DEHM1       ELLTKNSFP-------GDEIPIVRVSAIKALECGCGKRE--------CEWCGRIWKLMDA
EFTU_STRCJ       ELLSEYEFD-------GDNCPVVQVSALKALEGD-------------KEWGEKLLGLMKA
EFTU2_STRRA      ELLTEYEFP-------GDDVPVVKVSALRALEGD-------------PRWTRSVLELLDA
EFTU_PLARO       ELLSAQEFP-------GDDLPVVRVSALKALEGD-------------EKWADSIIELMNA
EFTU_THEFY       ELLNEYEFP-------GDEVPVIRVSALKALEGD-------------PEWGKKILELMEA
EFTU_FRACC       ELLSSYEFP-------GDDVPVVRVSALKALEGD-------------KEWGAKLLELMAA
EFTU_KINRD       ELLSSYEFP-------GDDVPVVRVSALKALEGD-------------AEWGDKLMELMDA
EFTU_SALAI       ELLSSQEYP-------GDDLPVVRVSALKALEGD-------------PEWAGKLMELMTA
EFTU_NOCSJ       ELLSEYEFP-------GDDIPVVRVAAFPALNGD-------------AKWGESVLELMNA
EFTU_SACEN       ELLSAQEFP-------GDDVPVVRVSALKALEGD-------------AEWGDKIMELLDA
EFTU_RHOJR       ELLAAQEF--------DEDAPVVKVSALKALEGD-------------PEWTKNILELMAA
EFTU_CORDI       ELLAEQDY--------DEEAPIIHISALKALEGD-------------EKWTQSIIDLMQA
EFTU_CORJK       ELLAEQDF--------DEEAPVVHISALKALEGD-------------EKWANQILELMQA
EFTU_ACIC1       ELLNSYEFP-------GDDVPVVRVSALKALEGD-------------PKWTQSILDLLKA
EFTU_CUTAK       ELLTSQEFD-------GDNCPVVRISAFQALQGD-------------EKWTQSILDLMDA
EFTU_TROW8       ELLSTHGFD-------GENVPVVRVSGLKALEGD-------------QKWGDAVMELMKA
EFTU_LEIXX       ELLSSQDYL-------GDDAPVVRVSGLKALEGD-------------EKWVQSVLDLMEA
EFTU_MICLU       QLLSSRSFD-------VDEAPVIRTSALKALEGD-------------PQWVKSVEDLMDA
EFTU_BRELN       DLLSSQDFD-------GDNAPVIPVSALKALEGD-------------EKWVKSVQDLMAA
EFTU_BIFAA       DLLDENGF--------DRDCPVIHVSAYGALHDDAPDH---------EKWVEQIKKLMDA
EFTU3_STRRA      DLLSEHGYG-------GDGAPVVRVSGLKALEGD-------------PKWTASIEALLDA
EFTU_PAROE       ELLSFYDFD-------GDNIPVVQGSALGGLNGDAK-------------WVGTIEQLMDS
EFTU_CYTH3       ELLSFYNFP-------GDTMSIIKGSALGGLNADPK-------------WVATIEELMNA
EFTU_PARD8       ELLSFYQFD-------GDNTPIIRGSALGALNGDAQ-------------WEDKVMELMEA
EFTU_CELLY       ELLSFYEYD-------GDNGPVVSGSALGALNGEQK-------------WVDTVMELMEA
EFTU_GRAFK       DLLSFYEYD-------GDNGPVISGSALGALEGDEK-------------WSKTVLELMEA
EFTU_FLAPJ       DLLSFYEYD-------GDNGPVVQGSALGGLNNDPA-------------WVPKIIELMEA
EFTU_SULMW       ELLSKYEYD-------GENIPIIQGSALGALNGEKK-------------WEKQIETLMKT
EFTU_TERFE       EELTKRGFD-------GDNTPIIKGSATGALAGEEK-------------WVKEIENLMDA
EFTU_SALRD       ELLTEYEFP-------GDEVPVVRGSALQALESSEE-------------HEEKIMELMEA
EFTU_SOLUE       ELLKSYQFP-------GDDLPVVRVSALGALNGEPQ-------------WEKTVDELMEA
EFTU_KORVE       ELLNKYGFP-------GDDLPVVRGSALGALNGEAQ-------------WEAKIDELMEA
EFTU_CHLPN       ELLEEKGYK---------GCPIIRGSALKALEGDAN-------------YIEKVRELMQA
EFTU_PARUW       ELLESKGYH---------NSPIIRGSALRALEGDPK-------------YVESIKQLMKI
EFTU_TRIV2       ELLTEYEFD-------GDDIPIVRGSGLQALDVMTKNPK---TQRGENPWVDKIYELMDA
EFTU_THEEB       ELLNEYEFP-------GDEVPIIRGSGLKALEAMTANPK---TLRGENEWVDKIYELMDA
EFTU_MICAN       ELLTNYDFA-------GDDIPIIAGSAKEALEYMTKNPK---AQKGDNEWVDAIYELMEA
EFTU_SYNJA       ELLSKYDFP-------GDEIPIIRGSALKALERMQANPK---TQRGEDPWVDKIYELMDA
EFTU_GLOVI       ELLSKYDFP-------GDDVPIVAGSALMALEKMASEPK---LIRGKDDWVDCIYSLMDA
EFTU_SYNE7       ELLSSYDFP-------GDDIPIVAGSALQALEAIQGGAS---GQKGDNPWVDKILKLMEE
EFTU_ACAM1       ELLNDYDFP-------GDDIPIVSGSALMALEALNGADS---MKKGDNEWVDKIYKLMEE
EFTU_TRIEI       ELLSDYDFD-------GDNIPIVAGSALQAVEALTANPG---IGKGENEWVDKILSLMDE
EFTU_SYNY3       ELLSDYDFP-------GDDIPIVAGSALKAIE-------------GEKEYKDAILELMKA
EFTU_ARTPT       ELLSSYDFP-------GDDIPIVSGSALKALDFLTENPK---TTRGENDWVDKIHALMDE
EFTU_CYAM1       ELLSKYDFP-------GDTIPFVTGSALLALEACMKNPK---IGEGKDKWVDKIFELMKI
EFTU_CYACA       ELLSKYDFP-------GEEVPFVAGSALLALEACLKNPT---IGKGKDKWVDKIFELMDM
EFTU_EMIHU       ELLENYDFP-------GDDIPFVSGSALLALQAVEGGPK---AK-GDDKWVDRIFDLMES
EFTU_GUITH       ELLEKYDFP-------GSEIPFVAGSALLALEAVANNPT---IKRGEDKWVDTIYQLMDK
EFTU_GRATL       ELLIQYDFP-------GDDIPFVAGSALLALEKVTENNS---IQRGENEWVDKIHSLMDA
EFTU_CYAPA       ELLSKYDFP-------GDQIPFVSGSALLALESLSSNPK---LMRGEDKWVDKILALMDA
EFTU_CYCME       ELLSTYDFP-------GDDIPICPGSRLQAIEAISSNPT---LKRGDNPWVDKIYALMDA
EFTU_PHATC       ELLSAYDFP-------GDDIPICPGSALQAIEAITANPT---VKRGDNKWVDKIYALMDA
EFTU_TRICV       ELLSAYDFQ-------VMTFRFAPGSALQAIEAISSNPA---IKRGDNPWVDKIFALMDA
EFTU_PROM1       ELLTSYDFP-------GDDIPVVQVSGLKAIE-------------GEADWETKIDDLMTA
EFTU_CHACO       ESLINYEFP-------GDKVPVVSGSALMALQALTEKPN---TSRGENKWVDKIYELMDA
EFTU_COLOB       QILIYYGFP-------GHTSPILCGSALLALEAMNENPN---FNRGKNKWVDKISSLIDH
EFTU_TOXGO       ELLDKYNFS-------SD-TPIITGSALKALD----------NNLTSNIWVDKIYELLTA
EFTU_EIMTE       ELLDIYEYN-------GDSTSIIKGSALKALEYIE-------KNDLNNKWVKNLKNLIEA
EFTU_THEPA       SMLDKYGFD-------STLTPLITGSALKALEEIKLLKE--IDL--NNKWISKVINLIDT
EFTU_PLAF7       ELLIKYNFD-------LNYIHILTGSALNVINIIQKNKD--YELIKSNIWIQKLNNLIQI
                 . :    :                 :                           :  *   

EFTU_OLTVI       VDSYIPTPERDTDKPFLMAV-EDVFSITGRGTVATGRVERGVVKIGDTVELVGLKDT--T
EFTU_TUPAK       VDTYIPTPVRETDKTFLMAV-EDVFSITGRGTVATGLVERGTLKTGATVEIIGLRDT--T
EFTU_NEPOL       VDQYIPTPKRDTDKSFLMAV-EDVFSITGRGTVATGRVERGSVKLGDTIEIVGLKPT--R
EFTU_OSTTA       VDSYIPTPARETDKTFLMAV-EDVFSITGRGTVATGRVERGTVKVGASIEIIGYVDT--R
EFTU_CHLVU       VDSYIPTPERETEKPFLMAV-EDVFSITGRGTVATGRVERGCVKIGDTVELVGLRDT--K
EFTU_PLETE       VDAYIPTPERDTEKPFLMAV-EDVFSITGRGTVATGRVERGSVKVGETIEIVGLRET--R
EFTU_PROWI       VDSYIPTPKRNIEKPFLMAI-EDVFSITGRGTVATGRVERGVVKIGDSVEIVGLGAT--K
EFTU_CHLAT       VDAYIPTPERDTDKPFLMAV-EDVFSITGRGTVATGRVERGTVKVGEAIEIVGLREAP-V
EFTU_MESVI       VDKYIPTPQRDTDKPFLMAI-EDVFSITGRGTVATGRVERGKVVVGENVDIVGLANIP-Q
EFTU_EUGGR       VDSYIPTPTRDTEKDFLMAI-EDVLSITGRGTVATGRVERGTIKVGETVELVGLKDT--R
EFTU_EUGLO       IDSYIPTPIRDTDKDFLLAI-EDVLSITGRGTVATGRIERGKIKVGETVELIGLKNI--K
EFTU_BIGNA       VDEYIPTPERETDKPFLMAV-EDVFSITGRGTVATGRVERGGVKIGDVVEIVGLRET--R
EFTU_HELSJ       VDSYIPTPVREIDKPFLMAI-EDVFSISGRGTVATGRIERGKIKMGDSIEIIGGSLR--K
EFTU_CODFR       VDEYIPTPKRDTEKPFLMAI-ENVVSITGRGTVATGRVERGMIEVGQTVELVGLKNT--K
EFTU_TETOB       VDEYIPTPDRETDKPFLLAV-EDVLSITGRGTVATGRVERGTLKVGENVELIGLKDT--K
EFTU_CHLRE       VDSYIPTPQRETDKPFLLAV-EDVLSITGRGTVATGRVERGALRISDNVEIVGLRPT--Q
EFTU_STIHE       VDEHIPTPKREMDKPFLLAV-EDVFSITGRGTVATGRVERGTLKVNETVEIIGLRDT--K
EFTU1_ECOLI      LDSYIPEPERAIDKPFLLPI-EDVFSISGRGTVVTGRVERGIIKVGEEVEIVGI-KET-Q
EFTU1_YERE8      LDSYIPEPERAIDKPFLLPI-EDVFSISGRGTVVTGRVERGIVKVGEEVEIVGL-KDT-V
EFTU_HAEDU       LDSYIPEPERAIDKPFLLPI-EDVFSISGRGTVVTGRVERGIIKSGEEVEIVGI-KET-T
EFTU_BUCBP       LDTYIPEPKRSIDQPFLLPI-EDVFSISGRGTVVTGRIERGIIKVGEEVEIVGI-KST-V
EFTU_BUCAI       LDSYIPEPKRAVDQPFLLPI-EDVFSISGRGTVVTGRVEKGIIKVGEEVEIVGI-KKT-T
EFTU_BUCCC       LDKYIPIPVRAVDEPFLLPI-EDVFSISGRGTVVTGRIERGILKVGEEVEIVGI-KST-T
EFTU_AERS4       LDTYIPEPERAIDLPFLMPI-EDVFSIAGRGTVVTGRVERGIVKVGETVEIVGI-KDT-V
EFTU2_PSEHT      LDSYIPEPERDIDKAFIMPI-EDVFSIQGRGTVVTGRVEAGIIRINDEIEIVGI-RDT-T
EFTU1_PHOPR      LDNYIPEPERAIDLPFILPI-EDVFSIQGRGTVVTGRVEQGIVRVGEEVAIIGI-KET-T
EFTU_PSEA6       LDSYIPEPERDIDKPFLLPI-EDVFSISGRGTVVTGRVERGIVNTGDAVEIVGM-KDT-T
EFTU_PSYIN       LDTYIPLPERDIDKPFILPI-EDVFSIAGRGTVVTGRVERGIIKVGQEVEIIGL-RPT-V
EFTU_COLP3       LDTYIPEPERAIDGAFIMPI-EDVFSISGRGTVVTGRVERGIIKIGEEVEVVGI-RDT-Q
EFTU_SHEAM       LDSYIPEPERAIDKAFLMPI-EDVFSISGRGTVVTGRVERGIIKVGEEVEIVGI-KDT-T
EFTU_BLOPB       LDNYIPEPKRVVDQPFLLPI-EDVFSISGRGTVVTGRIERGVIRVGEEIEIVGI-KDT-I
EFTU_BLOFL       LDNYIPEPKRSIDKPFLLPI-EDVFSISGRGTVVTGRVESGIIKVGEEVEIVGI-KDT-V
EFTU_BAUCH       LDSYIPEPKRAIDKPFLLPI-EDVFSISGRGTVVTGRVERGILKVGEEVEIIGI-KNT-T
EFTU_WIGBR       LDNYIPEPKRIIDQPFLLPI-EDVFSISGRGTVVTGRIERGTVKVGEEIEIIGI-KNT-V
EFTU_PSYA2       LDTYIPEPERDIDKAFLMPI-EDVFSISGRGTVVTGRVESGIVRVGEEIEIVGI-RDT-Q
EFTU_ACIAD       LDTYIPEPERAIDKAFLMPI-EDVFSISGRGTVVTGRVEAGIVKVGESVEIVGI-RDT-Q
EFTU_NEIGO       LDRYIPTPERAVDKPFLLPI-EDVFSISGRGTVVTGRVERGIIHVGDEIEIVGL-KET-Q
EFTU_CHRVO       LDSYIPTPERAIDKPFLLPI-EDVFSISGRGTVVTGRVERGIVKVGEELEIVGL-KDT-V
EFTU_NITMU       LDSYIPEPQRAVDGAFLMPV-EDVFSISGRGTVVTGRVERGVIKVGEDIEIVGL-KPT-T
EFTU1_METFK      LDTYIPTPERAVDGTFLMPV-EDVFSISGRGTVVTGRVERGIVKVGDEIEIVGL-KPT-I
EFTU_THIDA       LDTYIPEPERAIDKPFLMPV-EDVFSISGRGTVVTGRVERGVIKVGEEIEIVGI-TPT-V
EFTU_DECAR       LDSYIPDPERAIDQPFLMPV-EDVFSISGRGTVVTGRVERGIVKVGEEIEIVGI-RPT-V
EFTU_HERAR       LDSYIPTPERAVDGAFLLPV-EDVFSISGRGTVVTGRIERGIVKVGESLEIVGI-RDT-Q
EFTU_POLAQ       LDTYIPTPERAIDGAFLMPV-EDVFSISGRGTVVTGRIERGIVKVGEEIEIIGI-KPT-L
EFTU2_RHOFT      LDSYIPLPERAIDGAFLMPV-EDVFSISGRGTVVTGRVERGIIKVGEEIEIVGI-HDT-Q
EFTU_BORA1       LDTYIPTPERAVDGSFLMPV-EDVFSISGRGTVVTGRIERGVVKVGEEIEIVGI-KPT-V
EFTU1_XANCB      LDTFIPDPTRDVDRPFLMPV-EDVFSISGRGTVVTGRIERGIIRVGDEIEIVGI-RDT-H
EFTU_XYLFT       LDTHIPNPERAIDRPFLMPV-EDVFSISGRGTVVTGRIECGVIKVGDEVEIVGI-RPT-S
EFTU_METCA       LDDYIPEPERAIDRPFLMPI-EDVFSISGRGTVVTGRVERGIIKVGEEIEIVGI-RPT-A
EFTU_DICNV       LDASIPEPKRDIDKPFLMPI-EDVFSISGRGTVVTGRVERGVVKVGDELEIVGL-RDT-A
EFTU_PSEA7       LDSYIPEPVRAIDQPFLMPI-EDVFSISGRGTVVTGRVERGIIKVQEEVEIVGI-KAT-T
EFTU_PSEF5       LDTYIPEPERAIDKPFLMPI-EDVFSISGRGTVVTGRVERGIVRIQEEVEIVGL-RDT-Q
EFTU_HAHCH       LDAYIPEPERAIDKPFLMPI-EDVFSISGRGTVVTGRVERGIVRVGEEVEIVGI-KDT-T
EFTU_SACD2       LDSYIPEPERAIDQPFLMPV-EDVFSISGRGTVVTGRVERGIVKVGEELEIVGI-RDT-T
EFTU_MARMS       LDTYIPDPERAIDGAFLMPI-EDVFSIQGRGTVVTGRVERGIIKIQEEVEIVGI-VDT-T
EFTU_CHRSD       LDAYIPEPERAIDQPFLMPI-EDVFSISGRGTVVTGRVERGIVKSGEEVEIVGL-KDT-A
EFTU_ALCBS       LDEYIPEPERAVDQPFLMPI-EDVFSISGRGTVVTGRVERGIVKVGEEIEIVGI-HDT-T
EFTU_LEGPL       MDSYIPEPVRNIDKPFLLPI-EDVFSISGRGTVVTGRVESGIVKVGEEVEIVGI-RDT-Q
EFTU1_HALHL      MDAHIPQPERPVDGDFLMPI-EDVFSISGRGTVVTGRVERGVIKVGEEVEIVGI-TDT-R
EFTU_ALKEH       MDEYIPTPERPVDQPFLMPI-EDVFSISGRGTVVTGRVERGVIKTGEEVEIVGL-KET-Q
EFTU_COXBU       MDTYFPQPERAIDKPFLMPI-EDVFSISGRGTVVTGRVERGIIKVGDEIEIVGI-KDT-T
EFTU_NITOC       MDAYIPEPQRAVDQPFLMPI-EDVFSISGRGTVVTGRVERGIVKVGEEIEIVGM-RET-Q
EFTU_VESOH       LDSYIPTPKRDTDKSFIMPI-EDVFSISGRGTVVTGRIEAGVVNIGDELEIVGI-KDT-K
EFTU_HYDCU       LDSYIPEPTRETDKPFLMPV-EDIFSIQGRGTVATGRVETGVVKVGEEIEIVGI-RPT-T
EFTU_FRAP2       MDDYIPAPERDTAKPFILPI-EDVFSISGRGTVVTGRIERGVINVGDEVEVVGI-RPT-Q
EFTU_FUSNN       VDNYIPTPERAVDQPFLMPI-EDVFTITGRGTVVTGRVERGVIKVGEEIEIVGI-KPT-T
EFTU_CAMJD       VDSYIPTPTRDTEKDFLMPI-EDVFSISGRGTVVTGRIEKGVVKVGDTIEIVGI-KDT-Q
EFTU_CAMHC       VDSYIPTPKRDTDKDFLMPI-EDIFSISGRGTVVTGRVEKGIVKVGDTVELVGI-KPT-Q
EFTU_HELAH       VDAYIPTPVRDTEKSFLMPV-EDVFSIAGRGTVVTGRIERGMVKVGDEVEIVGI-RAT-Q
EFTU_WOLSU       VDRYIPTPERDVDKPFLMPV-EDVFSIAGRGTVVTGRIERGVVKVGDEVEIVGI-RNT-Q
EFTU_NITSB       VDEYIPTPERDIDKPFLMPI-EDVFSISGRGTVVTGRIERGVVKVGDEIEIVGL-RPT-Q
EFTU_ARCB4       VDEYIPTPERDIDQAFLMPV-EDVFSISGRGTVVTGRIEKGTIKVGEEIEIVGF-GDT-R
EFTU_SULNB       VDEYIPEPKRETDKDFLMAI-EDIFTIQGRGTVVTGKVDRGQVCVGDEVEIVGL-KDT-Q
EFTU_SULDN       VDEYIPEPTREVDRDFLMPV-EDVFSISGRGTVVTGRIERGTVKIGDAIEIVGI-RDT-Q
EFTU_RICAH       VDNYIPHPVRATDKPFLMPI-EDVFSISGRGTVVTGRVESGIIKVGEEVEIVGL-KET-Q
EFTU_RICBR       VDSYIPQPIRETEKPFLMPI-EDVFSISGRGTVVTGRIEAGKVKVGEAVEIVGI-KAT-Q
EFTU_MAGSA       VDAYIPQPERPKDKPFLMPI-EDVFSISGRGTVVTGRVERGVVKVGEEVEIVGI-KNT-V
EFTU_PARL1       VDAYIPQPERPKNLPFLMPI-EDVFSISGRGTVVTGRIERGVVKVGEEIEIVGI-KPT-V
EFTU_GLUOX       VDAYIPQPERPVDRPFLMPI-EDVFSISGRGTVVTGRVERGVVNVGDEVEIVGL-KDT-V
EFTU_AZOC5       VDKYIPQPERPVDQPFLMPI-EDVFSISGRGTVVTGRVERGIVKVGDEVEIVGI-RPT-V
EFTU1_RHORT      VDDYIPQPERPKDKPFLMPI-EDVFSISGRGTVVTGRVERGIVKVGEEIEIIGI-RDT-Q
EFTU_ACICJ       VDSYIPQPERPKDKPFLMPV-EDVFSISGRGTVVTGRVERGIIKVGDEVEIVGL-KAT-V
EFTU_NOVAD       VDAYIPQPPRPTDKPFLMPV-EDVFSISGRGTVVTGRIETGIIKVGEEVEIIGL-KDT-Q
EFTU_ERYLH       VDEHIPQPERPVDQDFLMPI-EDVFSISGRGTVVTGRVETGVVNVGDEVEIVGI-KDT-T
EFTU_SPHAL       VDEWIPQPERPLDKPFLMPI-EDVFSISGRGTVVTGRVETGVVKVGEEVEIVGI-KDT-K
EFTU_ZYMMO       VDEYIPQPERPLDKSFLMPI-EDVFSISGRGTVVTGRVETGIVKVGEEVEIVGL-RDT-K
EFTU_SPHWW       VDSYIPQPERPLDKPFLMPI-EDVFSISGRGTVVTGRVETGMVKVGEEVEIVGI-KDT-R
EFTU_RHIL3       VDAYIPTPERPINLPFLLPI-EDVFSISGRGTVVTGRVERGIVKVGEEVEIVGI-RPT-T
EFTU_RHILO       VDAYIPTPVRPLDKPFLMPI-EDVFSISGRGTVVTGRVERGVVKVGEELEIIGI-RPT-T
EFTU_JANSC       VDEYIPTPARAVDQPFLMPI-EDVFSISGRGTVVTGRVERGVINVGDEISIVGI-RDT-T
EFTU_ROSDO       VDEFIPTPERAIDQPFLMPV-EDVFSISGRGTVVTGRVERGVINVGDNIEIVGI-KDT-Q
EFTU_RHOS5       VDEYIPTPARAVDQPFLMPV-EDVFSISGRGTVATGRIERGVVKVGEELEIVGI-RPS-K
EFTU_PARDP       VDDYIPTPERAVDLPFLMPI-EDVFSISGRGTVVTGRVERGAVNVGDELEIVGI-RPT-K
EFTU_CAUVC       VDAYIPQPERPVDMPFLMPV-EDVFSISGRGTVVTGRVERGIVKVGEEVEIVGI-RPV-Q
EFTU1_HYPNA      VDEYIPTPERPLDKPFLMPV-EDVFSISGRGTVVTGRVEQGIVKVGEEIEIVGI-RPT-V
EFTU_MARMM       VDEYIPTPERPIDQPFLMPI-EDVFSISGRGTVVTGRIERGVVKVGEEIEIVGV-RDT-T
EFTU_MAGMM       VDAYIPEPERPLDQAFLMPI-EDVFTISGRGTVVTGRIERGIVKVGEQVAIIGI-KDT-V
EFTU_ANADF       VDSYIPTPKRATDKPFLMPV-EDVFSISGRGTVATGRVERGIIKVGEEVEVVGL-KPT-A
EFTU_STIAU       VDEYIPTPQRATDKPFLMPV-EDVFSIAGRGTVATGRVERGKIKVGEEVEIVGI-RPT-Q
EFTU_BDEBA       CDTYIPAPVRAVDKTFLMPV-EDVFSISGRGTVVTGRVERGIVKVGDEIEIVGI-RPT-Q
EFTU_PELUB       VDEFIPQPTRDIDKPFLMPV-EDVFSISGRGTVATGRIESGVIKTGEEVEIVGV-TAT-K
EFTU_CHLPD       VDEFIPEPLRDIDKPFLMPV-EDVFSISGRGTVGTGRIERGRIKINEEVEIVGI-KPT-R
EFTU_GEOUR       VDSYIPEPVRAIDKPFLMPV-EDVFSISGRGTVATGRVERGIVKVGEEVEIVGM-KAT-A
EFTU1_PELCD      VDTYIPEPERDIDKPFLMPV-EDVFSISGRGTVATGRVESGIVCVQDEIEIVGM-KET-T
EFTU2_DESPS      IDSYIPEPERDVDQPFLMPV-EDVFSISGRGTVATGRVERGIIKVGEEVAIVGV-KDT-V
EFTU_FLESI       MDDYIPAPERDIDKPFLMPI-EDVFSISGRGTVVTGRVERGKVRVQDEIEIVGL-TDT-R
EFTU_DESVH       CDSYIPEPQRDIDKPFLMPI-EDVFSISGRGTVVTGRVERGVIKVGEEVEIVGI-KDT-T
EFTU_DESAG       CDSYIPEPERDTDKPFLMPI-EDVFSISGRGTVVTGRVERGIIKVGEQIEIVGI-KDT-M
EFTU_LAWIP       CDSYIPDPQRDIDKPFLMPI-EDVFSISGRGTVVTGRVERGVIKVGEEIEIVGI-KPT-I
EFTU_SYNFM       IDAYVPDPVRDIDKPFLMPI-EDVFSISGRGTVVTGRVERGVIRVSEDVEIVGF-RPT-F
EFTU_SYNAS       VDAYIPEPERDLDKPFLMPV-GDVFTISGRGTVVTGRIDRGIIKTGDEVEIVGV-RPT-Q
EFTU_EHRRG       LEK-IDLPIREKDKPFLMSI-EDVFSIPGRGTVVTGRIERGVIKVGDKIDIVGL-RDI-Q
EFTU_ANAPZ       LEK-IELPMREKDKPFLMSV-EDVFSIPGRGTVVTGRIERGVVRVGDKIDIVGL-REL-Q
EFTU2_WOLPM      LDEYVAVPPRPVDLPFLLPI-EDVFSISGRGTVVTGRIEKGEIKTGEEIEIIGL-KAT-Q
EFTU1_ORITB      IDDYIPQPTRVLDQPFLMPI-EDVFSILGRGTVVTGRIERGVIKVGDEVEIVGL-RST-Q
EFTU_NEOSM       CDKYIALPERAVDGDFLMSI-EDVFSISGRGTVVTGKIERGCIKVGDGVEIVGI-RDT-Q
EFTU_AYWBP       LDTYIEDPVREVDKPFLMPV-EDVFTITGRGTVVTGRVERGQVKAGDEVEIVGL-KET-R
EFTU_APPPP       LDEYIEDPIRDVEKPFLMPV-EGVHTITGRGTVATGRVERGKIKISEEVEIIGL-KET-K
EFTU_CARRP       LDKNIPVPNRIIDKPFLMPI-EDVFSISGRGTVVTGKIERGIIKTGEEIEIVGF-KET-I
EFTU_SORC5       LDSYIPEPVRDIDKPFLMAI-EDVFSIKGRGTVATGRIERGVIKVGDEVQIIGF-KDT-K
EFTU_RHOBA       LDSHIPEPTREDDKPFLMAI-EDVFSIEGRGTVATGRIERGVVKVGEEVEIIGLGPNS-T
EFTU_BRAHO       LDTYIPDPVREVDKDFLMSI-EDVYSIPGRGTVVTGRIERGKIEKGNEVEIVGI-RPT-Q
EFTU_TREDE       MDEYFKDPVRDSDKPFLLPI-EDIFTIQGRGTVVTGRIERGVIKMNEEVEIVGI-KPT-K
EFTU_TREPA       MDSYFEDPVRDDARPFLLSI-EDVYTISGRGTVVTGRIECGVISLNEEVEIVGI-KPT-K
EFTU_BORBU       MDNYFDLPERDIDKPFLLAV-EDVFSISGRGTVATGRIERGIIKVGQEVEIVGI-KET-R
EFTU_LEPBL       LDTFVPNPKRVTDKPFLMPV-EDVFSITGRGTVATGRVEQGVLKVNDEVEIIGI-RPT-T
EFTU_RUBXD       LDEYIPEPKRDIDKPFLLAV-EDVFSIQGRGTVATGRVEQGKLRLNEEVEIVGI-RPT-R
EFTU2_PELTS      VDEYIPTPQRAVDKPFLMPV-EDVFSITGRGTVATGRIERGQVKVGDEVEIVGLQDKP-R
EFTU_DESRM       VDAYIPTPERAVDKPFLMPV-EDVFSITGRGTVATGRVERGQVKVQDEVEIVGLNEKP-R
EFTU2_CARHZ      VDEYIPTPQRDVDKPFLMPV-EDVFTITGRGTVATGRVERGRITIGEEVEIVGLMDAP-R
EFTU1_SYNWW      VDSYIPLPQRAVDKPFLMPI-EDVFTITGRGTVTTGRVERGQVKVGDEVEIVGMREAT-R
EFTU_MOOTA       VDSYIPTPERDTDKPFLMPI-EDVFTITGRGTVTTGRVERGKVKVGDEVEIIGLRDEI-R
EFTU2_CALS4      VDEYIPTPERDIDKPFLMPV-EDVFSITGRGTVATGRVERGKVKVGDEVEIIGLTTES-R
EFTU_DESHY       VDSYIPTPERATDKPFLMPV-EDVFTITGRGTVATGRVERGVIKVGDEIEIVGLTEAP-R
EFTU_CLOBM       IDSYIPTPERATDQPFLMPV-EDVFTITGRGTVATGRVERGVLHTGDEVELIGMKEEI-T
EFTU_CLOK5       VDTYIPTPERPVDKPFLMPI-EDVFTITGRGTVATGRVESGVLKIGDEVEIVGLKEEK-K
EFTU_CLOAB       VDAYIPTPERPTDKAFLMPI-EDVFTITGRGTVATGRVETGTLKVGDEVEIVGMKDEI-T
EFTU_CLOTE       VDEYIPTPERATDKPFLMPV-EDIFTITGRGTVATGRVERGILKVGDEIEIVGLSDES-K
EFTU_CLONN       VDEYIPTPERATDQPFLMPV-EDVFTITGRGTVATGRVERGVLHVGDEVQIVGMKEEI-G
EFTU_CLOPS       VDSYIPTPERATDKPFLMPV-EDVFTITGRGTVATGRVERGVLHVGDEVEVIGLTEER-R
EFTU_CLOB8       VDSYIPTPERATDKPFLMPI-EDVFTITGRGTVATGRVEAGVLHVGDEVEIVGLTEEK-K
EFTU_CALS8       VDKYIPTPQRDVDKPFLMPI-EDVFSITGRGTVVTGRVERGTLKTGEEVEIVGFAPEP-R
EFTU_SYMTH       VDSYIPTPQRDADKPFLMPI-EDVFTITGRGTVVTGRVERGKCKVGDQVEIVGLREES-K
EFTU_HUNT2       VDKYIPTPQRDIDKPFAMPV-EDVFTITGRGTVATGRVERGTLKMGDEVEIVGLSDSP-K
EFTU_ALKOO       IDTYIPEPTRAIDKSFLMPV-EDVFSITGRGTVATGRVERGIIKVQDEVELVGLQEDS-R
EFTU_CLOD6       IDEYIPAPERDTDKPFLMPV-EDVFSITGRGTVATGRVERGVLKVQDEVELVGLTEAP-R
EFTU2_ALKMQ      IDTWIPEPVRDTDKPFLMPV-EDVFSITGRGTVATGRIERGIVKVQEEISLVGLSEAP-R
EFTU_LACP7       VDTWIPDPQRATDKPFLMPI-EDVFSITGRGTVATGRVERGVLHVSEEVEIVGVKEET-R
EFTU_THEAQ       IDEYIPTPVRDVDKPFLMPV-EDVFTITGRGTVATGRIERGKVKVGDEVEIVGLAPET-R
EFTU_DEIGD       IDAYIPTPERATDKTFLMPV-EDVFTITGRGTVATGRVERGVCKVGDEVEIVGLR-DT-K
EFTU_LACBA       VDDYIPTPERENDKPFLMPV-EDVFTITGRGTVASGRIDRGTVKVGDEVEVVGLHEDV-L
EFTU_PEDPA       IDEYIPTPERSTDKPFLMPV-EDVFTITGRGTVASGRIDRGEIKVGDEVEIVGLKEDV-T
EFTU_LACP3       IDEYIPTPVRETDKPFLMPV-EDVFTITGRGTVASGRIDRGTVKIGDEVEIIGLKPDV-I
EFTU_LACRD       IDDYIPTPKRPTDKPFMMPV-EDVFTITGRGTVASGRIDRGTVKVGDEVEIVGLTEDV-L
EFTU_OENOB       IDEYIPTPVRDVDKPFLMPV-EDVFTITGRGTVASGRIDRGTVKINDPVEIVGLKDEV-K
EFTU_LACS1       VDEYIPTPQRPTDKPFLMPV-EDVFTITGRGTVASGRIDRGTVKVGDEVEIVGLKDDV-V
EFTU_LACSS       VDEYVPTPERDTDKPFLMPV-EDVFTITGRGTVASGRIDRGQVTVGDEVEIIGLKEEI-A
EFTU_LACJO       VDEYIPTPERDTDKPFLMPV-EDVFTITGRGTVASGRIDRGTVKVGDEVEIVGLTDKI-E
EFTU_LACDA       VDEYIPTPERETDKPFLMPV-EDVFTITGRGTVASGRIDRGTVKVGDSVEIVGLVEKV-L
EFTU_LEUMM       VDSYIPEPARETDKPFLMPV-EDVFTITGRGTVASGRVDRGVLTTGTEIEIVGLKDEV-Q
EFTU_STRMU       VDDYIPDPERDTDKPLLLPV-EDVFSITGRGTVASGRIDRGTVKVNDEVEIVGIRDDI-Q
EFTU_LACLS       VDEYIPTPERDTDKPLLLPV-EDVFSITGRGTVASGRIERGTVKVGDEVEIVGIKEET-K
EFTU_GEOTN       VDEYIPTPQREVDKPFMMPV-EDVFSITGRGTVATGRVERGTLKVGDPVEIIGLSDEP-K
EFTU_BACCN       VDAYIPTPERETDKPFLMPV-EDVFSITGRGTVATGRVERGVVKVGDVVEIIGLAEET-A
EFTU_BACSK       VDEYIPTPERDKDKPFMMPV-EDVFSITGRGTVATGRVERGQLNVGDTVEILGINEEK-K
EFTU_BACLD       VDEYIPTPERETDKPFMMPV-EDVFSITGRGTVATGRVERGQVKVGDEVEIIGLQEEN-K
EFTU_OCEIH       VDEYIPTPERDKEKPFMMPV-EDVFSITGRGTVATGRVERGEVKVGDEVEIIGLAEDA-S
EFTU_STAS1       VDDFIPTPERDSDKPFMMPV-EDVFSITGRGTVATGRVERGQIKVGEEIEIIGMQEES-S
EFTU_ENTFA       VDEYIPTPERDTDKPFMMPV-EDVFSITGRGTVATGRVERGEVRVGDEVEIVGIKDET-S
EFTU_LISIN       VDSYIPTPERDTDKPFMMPV-EDVFSITGRGTVATGRVERGQVKVGDEVEVIGIEEES-K
EFTU_ACHLI       VDAYIDTPLRATDKPFMMPV-EDVFTITGRGTVATGRVDRGIVKVGDQVEIVGITD-T-K
EFTU_MYCGE       VDEWIPTPTREVDKPFLLAI-EDTMTITGRGTVVTGRVERGELKVGQEVEIVGLKPI--R
EFTU_MYCGA       VDEYIPTPDREVDKPFLLPI-EDTMTITGRGTVVTGRVERGQLKVGEEVEIVGITDT--R
EFTU_MYCPE       VDSYIPTPTRDTDKPFLLAV-EDVMTITGRGTVVTGRVERGTLKLNDEVEIVGIHDT--R
EFTU_UREP2       VDSWIPLPERSTDKPFLLAI-EDVFTISGRGTVVTGRVERGVLKVNDEVEIVGLKDT--Q
EFTU_MYCPU       VDNYIETPVKELDKPFLLAV-EDVFTITGRGTVATGKVERGQLNINSEVEIVGFTEKP-K
EFTU_MYCHJ       VDSYIDSPVREMDKPFLMAV-EDVFTITGRGTVATGKVERGQVKLNEEVEIVGYREEP-K
EFTU_MYCMO       VDNWIDAPLREVDKPFLMAV-EDVFTITGRGTVATGKVERGELKINEEVDIVGYTEKP-K
EFTU_MYCS5       VDTYIENPVKELDKPFLMAV-EDVFTITGRGTVATGRVERGRLTLNEEVEIVGLKPT--K
EFTU_MYCMS       VDEYIPTPQRDADKTFLMPV-EDVFTITGRGTVATGRVERGTVKVNEEVEIIGLKEEP-T
EFTU_MESFL       VDEYIPTPTRDSDKTFLMPV-EDVFTITGRGTVATGRVERGTIKVNEEVEIVGLVEEA-K
EFTU_THEMA       MDNYIPDPQRDVDKPFLMPI-EDVFSITGRGTVVTGRIERGRIRPGDEVEIIGLSYEI-K
EFTU_FERIS       MDTYFPDPVREVDKPFLMPI-EDVFSITGRGTVVTGRIERGVIKPGVEAEIIGMSYEI-K
EFTU_THEM4       MDEYFPEPQRETDKPFLMPV-EDVFSITGRGTVVTGRIERGVIRPGDEVEIVGMSYEV-N
EFTU_PSELT       LDSYIPEPVREVDKPFLMAV-EDVFSITGRGTVATGRIERGKIRPGDEVEIVGLSYET-R
EFTU_PETMO       VDSYFPDPVREIDKPFLMPI-EDIFSITGRGTVVTGRIERGVVHTGDQVEIIGLSYET-K
EFTU_AQUPY       MDEYIPTPEREVDKPFLMPI-EDVFSISGRGTVVTGRVERGVLRPGDEVEIVGLREEP-L
EFTU2_ROSCS      VDEYIPTPVREVDKPFLMPI-EDVFGIKGRGTVVTGRIERGKVKMGDTVEIVGMSHEAPK
EFTU_CHLAA       VDEYIPTPQRAVDQPFLMPI-EDVFGIKGRGTVVTGRIERGKVKVGDTVEIVGMTNDAPR
EFTU_HERAU       VDDYIPTPERAIDKPFLMPI-EDVFSIKGRGTVVTGRIERGIVKVGDTIEIIGMGPDV-R
EFTU_DEHM1       VDSYIPIPPRPVDKPFLMKV-EDVFSIKGRGTVATGRVERGIIKGGDEVDLVGLHHEP-R
EFTU_STRCJ       VDENIPQPERDVDKPFLMPI-EDVFTITGRGTVVTGRIERGVLKVNETVDIIGIKTEK-T
EFTU2_STRRA      VDEFVPEPVRDVDRPFLMPI-EDVFTITGRGTVVTGRIERGTLNVNTEVEIIGIHEQR-T
EFTU_PLARO       VDENIPEPPRDTDKPFLMPI-EDVFSITGRGTVVTGRIERGVVKVNEQVDIIGIKSEK-T
EFTU_THEFY       VDQNIPEPQRDIDKPFLMPI-EDVFSITGRGTVVTGRIERGVINVNDTVEIVGLKDDK-I
EFTU_FRACC       VDESIPEPQRDIDRPFLMPI-EDVFTITGRGTVVTGRVERGIVKVNETVEIVGIKPET-T
EFTU_KINRD       VDTAIPEPERAIDQPFLMPI-EDVFTITGRGTVVTGRIERGVLNVNQEVEVVGIKPTS-T
EFTU_SALAI       VDTSIPQPERETEKPFLMPI-EDVFTITGRGTVVTGRAERGILKPNEEVELVGIREKS-T
EFTU_NOCSJ       VDEYIPTPERDTEKPFLMPV-EDVFTITGRGTVITGRIERGIVKVGEEVEILGIREAS-Q
EFTU_SACEN       VDENVPDPERETDKPFLMPI-EDVFSITGRGTVVTGRIERGVINVNEEVEMVGIKEKP-L
EFTU_RHOJR       VDESIPDPVRETEKPFLMPV-EDVFTITGRGTVVTGRIERGVINVNEDVEIVGIKETK-T
EFTU_CORDI       CDDSIPDPERETDKPFLMPI-EDIFTITGRGTVVTGRVERGSLKVNEDVEIIGIREKA-T
EFTU_CORJK       CDESIPDPERETDKPFLMPV-EDIFTITGRGTVVTGRVERGILNLNDEVEILGIREKS-Q
EFTU_ACIC1       CDDYIPEPVREIDKPFLMPI-EDVFTITGRGTVVTGRVERGVVKVGDEVEIVGIHPKT-L
EFTU_CUTAK       VDEYIPQPERDLDKPFLMPI-EDVFTITGRGTVVTGRVERGVVKTGEEVEIVGIHEKT-Q
EFTU_TROW8       VDESIPDPVRDRDKPFLMPI-EDVFTITGRGTVVTGRAERGVLAVNSEVEIVGIRP-T-Q
EFTU_LEIXX       VDNNIPDPVRDKDKPFLMPV-EDVFTITGRGTVVTGRAERGTLAVNSEVEIVGIRP-T-Q
EFTU_MICLU       VDEYIPDPVRDKDKPFLMPI-EDVFTITGRGTVVTGRAERGTLKINSEVEIVGIRD-V-Q
EFTU_BRELN       VDDNVPEPERDVDKPFLMPV-EDVFTITGRGTVVTGRVERGVLLPNDEIEIVGIKEKS-S
EFTU_BIFAA       VDDYIPTPVHDLDKPFLMPI-EDVFTISGRGTVVTGRVERGKLPVNSNVEIVGIRP-T-Q
EFTU3_STRRA      VDTYVPMPERYVDAPFLLPV-ENVLTITGRGTVVTGAVERGTVRVGNRVEVLGAGL----
EFTU_PAROE       VDNWIPIPPRLTDQPFLMPV-EDVFSITGRGTVATGRIERGVINSGEPVEILGM-GAENL
EFTU_CYTH3       VDNDIPIPPRLTDQPFLMPV-EDVFSITGRGTVATGRIERGVINSGEGVDIIGF-GAENL
EFTU_PARD8       CDTWIPLPPREIDKPFLMPV-EDVFSITGRGTVATGRIETGIVKVGEEVQIIGL-GAAGK
EFTU_CELLY       VDNWIELPKRDVDKDFLMPV-EDVFTITGRGTVATGRIETGVANTGDAVDIIGM-GADKL
EFTU_GRAFK       VDTWIELPERDVDKAFLMPI-EDVFSITGRGTVATGRIETGVANTGDPIEIIGM-GAGKL
EFTU_FLAPJ       CDSWIQEPIRDTEKPFLMPV-EDVFTITGRGTVATGRIETGICNTGDPVEIIGM-GAEKL
EFTU_SULMW       VDNYIKEPIRNIDKPFLMPI-EDVFTITGRGTVATGRIETGTINTGDSIDIIGM-GIDKL
EFTU_TERFE       VDSYIPLPPRPVDLPFLMSV-EDVFSITGRGTVATGRIERGRIKVGEPVEIVGL-QESPL
EFTU_SALRD       VDEYIPTPERDVEKPFLMPV-EDIFSITGRGTVVTGRIERGRVQLQDEIEIVGM-QEEKM
EFTU_SOLUE       VDSYIPMPERAIDKPFIMPI-EDIFSIQGRGTVVTGRIERGICKVGEEMEIVGF-RDTR-
EFTU_KORVE       VDKNIPLPARDIDKPFLMPI-EDIFSISGRGTVVTGRIERGKVKVGEEVEIVGF-RETR-
EFTU_CHLPN       VDDNIPTPEREIDKPFLMPI-EDVFSISGRGTVVTGRIERGIVKVSDKVQLVGLGETK--
EFTU_PARUW       VDEAVPTPQRETDKPFLMPV-EDVFSISGRGTVATGRVERGVVKINDKLQLIGLGDTR--
EFTU_TRIV2       VDSYIPDPERDIDKPFLMAV-EDVFSITGRGTVATGRIERGKVKVGDVVELVGIRDTR--
EFTU_THEEB       VDNYIPTPERDVDKPFLMAV-EDVFSITGRGTVATGRIERGRIKLNETVELVGLRETR--
EFTU_MICAN       VDSYIPTPERDIDKPFLMAV-EDVFSITGRGTVATGRIERGIVKVGDNVELVGIRETR--
EFTU_SYNJA       VDSYIPTPERDVDKPFLMAV-EDVFSITGRGTVATGRIERGRIKVGETVELVGLRETR--
EFTU_GLOVI       VDAYIPTPERAIDKPFLMAV-EDVFSITGRGTVATGRIERGKVKVGETIELVGIRGTR--
EFTU_SYNE7       VDAYIPTPEREVDRPFLMAV-EDVFTITGRGTVATGRIERGSVKVGETIEIVGLRDTR--
EFTU_ACAM1       VDAYIPTPERDVDKPFLMAV-EDVFSITGRGTVATGRIERGKVVVGETVELVGIRDTR--
EFTU_TRIEI       VDGYIPQPERDVDKPFLMAV-EDVFSITGRGTVATGRIERGKIKVGETVELVGIKDTR--
EFTU_SYNY3       VDDYIDTPEREVDKPFLMAV-EDVFSITGRGTVATGRIERGKVKVGEEISIVGIKDTR--
EFTU_ARTPT       VDAYIPTPERDIDKGLLDGLWEDVFSITGRGTVSTAGIERGKVKVGDTVELIGIKDTR--
EFTU_CYAM1       VDEYIPTPQRDVDKSFLMAV-EDVFSITGRGTVATGRIERGRVKVGETIEIVGLKNTK--
EFTU_CYACA       VDKYFPTPERDIDKTFLMAV-EDVFSITGRGTVATGRIERGAIKVGETVEIVGLKSTA--
EFTU_EMIHU       VDNYIPAPERDTEKTFLMAV-EDVFSITGRGTVATGRIERGILKIGDTIEIVGLKDTQ--
EFTU_GUITH       VDEYIPTPERETDKAFLMAV-EDVFSITGRGTVATGRIERGKVKVGDTIEIVGLRETR--
EFTU_GRATL       VDEYIPTPVRDVEKTFLMAV-EDVFSITGRGTVATGRIERGIIKVGDTIEIVGLRETT--
EFTU_CYAPA       VDEYIPTPERPIDKSFLMAI-EDVFSITGRGTVATGRIERGAIKVGETVELVGLKDTK--
EFTU_CYCME       VDAYIPTPERDVEKTFLMAI-EDVFSITGRGTVATGRIERGVIKVVDNVEIVGIGDTK--
EFTU_PHATC       VDEYIPTPERDVEKTFLMAI-EDVFSITGRGTVATGRIERGVVKVGENVEIVGVTDTQ--
EFTU_TRICV       VDEYIPTPERDIEKTFLMAI-EDVFSITGRGTVATGRIERGVVKVGDTVEIVGVGDTQ--
EFTU_PROM1       VDASIPEPEREIDKPFLMAV-EDVFSITGRGTVATGRIERGKVTVGEEVEIVGIRDTR--
EFTU_CHACO       VDSYIPTPKRDIEKPFLMPI-EDVFSIQGRGTVATGRIERGILKLGDIVELIGLNEKI-R
EFTU_COLOB       LDLYLPTPRRKLNKPFLMPI-ERVILIPSFGLVGTGTIEKGHINIGESVEIVGFKDTQ--
EFTU_TOXGO       LDSYIPLPKRDLDKPFLLAI-EDIFSITGRGTVVTGKIERGSIKLGDTVTMLGFNIS--K
EFTU_EIMTE       LDKSIPEPKRDINKPFLLSI-EDIFSITGRGTVVTGKIERGKVKLNDTVDILGFNLL--K
EFTU_THEPA       VDSYIEKPERNLNKPFLMPI-EDSFYITGRGTVVTGRIENGIVKLNDKVELYGYDKS--K
EFTU_PLAF7       IDNII-IPTRKINDYFLMSI-EDVFSITGRGTVVTGKIEQGCINLNDEIEILKFEKSSPN
                  :  .  * :     :   :      * . * * :.  : *         :         

EFTU_OLTVI       ETTVTGLEMFQKTLDESVAGDNVGILLRGVQKENIQRGMVLAKPGSISPHTKFEAQVYVL
EFTU_TUPAK       TTTVTGLEMFQKTLDETVAGDNVGVLLRGVQKDNIQRGMVLAAPGTIKPHTKFEAQVYIL
EFTU_NEPOL       ETTVTGLEMFQKTLDQSVAGDNVGILLRGIQKEDIQRGMVLAAPRTITPHTKFESQVYVL
EFTU_OSTTA       VATVTGLEMFQKTLEESVAGDNVGVLLRGIQKEDIERGMVLAQPGTITPHTKFEAQVYVL
EFTU_CHLVU       TTTVTGLEMFQKTLDESVAGDNVGILLRGVQKIDIERGMVLAKPGSILPHTKFEAQVYVL
EFTU_PLETE       TTTVTGLEMFQKTLEESVAGDNVGVLLRGIQKIDIQRGMVLAKPGSITPHTKFTAQVYIL
EFTU_PROWI       ITTVTGLEMFQKTLDESIAGDNVGILLRGIQKTEIQRGMVLAKPKSITPHTNFEAQVYVL
EFTU_CHLAT       TSIVTGLEMFQKTLEESVAGDNVGILLRGIQKKDIERGMVLAKPGTIKPHKSFEAQVYIL
EFTU_MESVI       NTTVTGLEMFQKTLEESVAGDNVGVLLRGIQKDQVERGMVLAKPNTIKPHIRFESEVYVL
EFTU_EUGGR       STTITGLEMFQKSLDEALAGDNVGVLLRGIQKNDVERGMVLAKPRTINPHTKFDSQVYIL
EFTU_EUGLO       STTITGLEMFQKSLDEAIAGDNVGVLLRGIQKNEVERGMVIAKPGTIQPHIKFNSQVYIL
EFTU_BIGNA       STTVTGLEMFQKMLQESIAGDNVGMLLRGIQKADIQRGMVVAQPGSITPHVSFDAQVYIL
EFTU_HELSJ       TTTVTGIEMFQKTLTDGVAGDNVGILMRGIQKKEIDRGMVLTKPKSIDPLTSFEAQVYLL
EFTU_CODFR       EAIITGLEMFHKTLEKSVAGDNVGILLRRIQKEEIQRGMVLAKPSSILPHQHFKAQVYIL
EFTU_TETOB       ATVVTGLEMFKKTLDETMAGDNVGVLLRGIQKKDVERGMVLAKPGSITPHTKFEAQVYVL
EFTU_CHLRE       TAVVTGLEMFKKTLDETLAGDNVGVLLRGVQKKDIERGMVIAKPGTITPHTKFEAQVYVL
EFTU_STIHE       TTTVTAIEMFQKTLDETIAGDNVGILLRGVQKKDIERGMVIAKPGTILPHTLFEGQVYVL
EFTU1_ECOLI      KSTCTGVEMFRKLLDEGRAGENVGVLLRGIKREEIERGQVLAKPGTIKPHTKFESEVYIL
EFTU1_YERE8      KSTCTGVEMFRKLLDEGRAGENVGVLLRGIKREDIERGQVLAKPGSIKPHTKFESEVYIL
EFTU_HAEDU       KTTVTGVEMFRKLLDEGRAGENVGALLRGTKREEIERGQVLAKPGTITPHTDFESEVYVL
EFTU_BUCBP       KTICTGVEMFRKLLDEGRAGENVGVLLRGTKRDDIERGQVLAKPGTITPHIKFESEVYVL
EFTU_BUCAI       KTTCTGVEMFRKLLDEGRAGENVGVLLRGTKRDEIERGQVLAKPGSIHPHTTFESEVYVL
EFTU_BUCCC       KTICTGVEMFRKLLDEGRAGENVGILLRGTKREDIERGQVLAKPGTINPHVKFESEVYVL
EFTU_AERS4       STTCTGVEMFRKLLDEGRAGENIGALLRGVKREDVERGQVLAKPGSIKPHTKFESEVYVL
EFTU2_PSEHT      KSICTGVEMFRKLLDEGRAGENIGALLRGTKREDVERGQVLAKPGSIKPHTTFESEVYVL
EFTU1_PHOPR      TTTCTGVEMFRKLLDEGRAGENVGVLLRGTKRDDVERGQVLAKPGSITPHTTFTSEIYVL
EFTU_PSEA6       TSTVTGVEMFRKLLDEGRAGENIGALLRGTKREDVERGQVLAKPGSINPHTQFEAEVYVL
EFTU_PSYIN       KTTCTGVEMFRKLLDEGRAGENVGILLRGTKRDDVERGQVLAKPGSIKPHTKFEGEVYIL
EFTU_COLP3       KSTCTGVEMFRKLLDEGRAGENCGVLLRGLKREDVERGQVLCAPGSILPHTKFESEVYVL
EFTU_SHEAM       KTTCTGVEMFRKLLDEGRAGENCGILLRGTKRDEVERGQVLSKPGTIKPHTKFESEVYVL
EFTU_BLOPB       KTTCTGVEMFRKLLDEGRAGENVGVLLRGTKRDEVERGQVLSKPGYIKPHSHFESEVYIL
EFTU_BLOFL       KTTCTGIEMFRKLLDEGRAGENVGVLLRGTKRDEVERGQVLSKPGCIKPHSNFESEVYIL
EFTU_BAUCH       KTTCTGVEMFRKLLDEGRAGENIGVLLRGVKRDDVERGQVLAKPGSIKPHTKFASEVYIL
EFTU_WIGBR       KTTCTGVEMFRKLLDEGRAGENVGILLRGTKREDVERGQVLAKPGSIKPHTQFESEVYVL
EFTU_PSYA2       KTTCTGVEMFRKLLDEGRAGENCGVLLRGTKREDVQRGQVLAKPGSITPHTKFDAEVYVL
EFTU_ACIAD       TTTVTGVEMFRKLLDEGRAGENCGVLLRGTKREDVQRGQVLAKPGTIKPHTKFDAEVYVL
EFTU_NEIGO       KTTCTGVEMFRKLLDEGQAGDNVGVLLRGTKREDVERGQVLAKRGTITPHTKFKAEVYVL
EFTU_CHRVO       KTTCTGVEMFRKLLDQGQAGDNVGVLLRGTKREDVERGQVLAKPGTITPHTKFEASVYVL
EFTU_NITMU       KTVCTGVEMFRKLLDQGQAGDNVGVLLRGTKREEVERGQVLAKPGTITPHTKFTAEIYVL
EFTU1_METFK      KTTCTGVEMFRKLLDQGQAGDNVGVLLRGTKREEVERGQVLAKVGSIKPHTKFTAEIYVL
EFTU_THIDA       KTTCTGVEMFRKLLDQGQAGDNVGVLLRGTKREEVQRGQVLAKPGSIKPHTKFSAEIYVL
EFTU_DECAR       KTICTGVEMFRKLLDQGQAGDNIGALLRGTKREDVERGQVLCKPGSVKPHTHFTSEVYIL
EFTU_HERAR       VTTCTGVEMFRKLLDQGQAGDNVGVLLRGTKREDVERGQVLAKPGSIKPHKHFTGEIYVL
EFTU_POLAQ       KTTCTGVEMFRKLLDQGQAGDNVGILLRGTKREEVERGQVLAKPGSITPHTHFTAEVYIL
EFTU2_RHOFT      KTTCTGVEMFRKLLDQGQAGDNVGILLRGTKREDVQRGQVLCKPGSIKPHTHFTGEIYVL
EFTU_BORA1       KTTCTGVEMFRKLLDQGQAGDNVGILLRGTKREDVERGQVLAKPGSINPHTDFTAEVYIL
EFTU1_XANCB      KTTVTGVEMFRKLLDQGQAGDNAGLLLRGTKRDDVERGQVLCKPGSIKPHTEFEAEVYVL
EFTU_XYLFT       KTIVTGVEMFRKLLDQGQAGDNAGLLLRGTKRDEVERGQVLAKPGCIKAHKEFEAEVYVL
EFTU_METCA       KTTCTGVEMFRKLLDQGQAGDNIGVLLRGTKREDVERGQVLAKPGSITPHTHFEAEIYVL
EFTU_DICNV       KTTCTGVEMFRKLLDQGQAGDNVGVLLRGTKREEVERGQVLAKPGTITPHTKFESEVYVL
EFTU_PSEA7       KTTCTGVEMFRKLLDEGRAGENVGILLRGTKREDVERGQVLAKPGTIKPHTKFECEVYVL
EFTU_PSEF5       KTTCTGVEMFRKLLDEGRAGENCGVLLRGTKRDDVERGQVLVKPGTVKPHTKFTAEVYVL
EFTU_HAHCH       KTTCTGVEMFRKLLDEGRAGENVGVLLRGTKRDDVERGQVLAKPGTITPHTVFESEVYVL
EFTU_SACD2       KTTCTGVEMFRKLLDEGRAGENVGVLLRGTKRDDVERGQVLSKPGSVTPHTTFQSEIYVL
EFTU_MARMS       KTTCTGVEMFRKLLDEGRAGENCGILLRGTKREDVQRGQVLAKPGSITPHTQFEAEVYVL
EFTU_CHRSD       KTTVTGVEMFRKLLDEGRAGENIGALLRGTKRDDVERGQVLAKPGTITPHTVFEAEVYVL
EFTU_ALCBS       KTTCTGVEMFRKLLDEGRAGENVGVLLRGTKRDEVERGQVLAKPGSINPHTKFVAEVYVL
EFTU_LEGPL       KTTCTGVEMFRKLLDEGRAGDNVGVLLRGTKRDEVERGQVLAKPGTIKPHTKFEAEVYVL
EFTU1_HALHL      KTTCTGVEMFRKLLDQGEAGDNIGALLRGIKRDDVERGQVLCKPKSITPHTHFEAEVYVL
EFTU_ALKEH       KTTCTGVEMFRKMLDQGEAGDNIGALLRGTKRDEVERGQVLCKPGSITPHTKFECEVYVL
EFTU_COXBU       KTTCTGVEMFRKLLDEGQAGDNVGILLRGTKREEVERGQVLAKPGSITPHKKFEAEIYVL
EFTU_NITOC       KTICTGVEMFRKLLDEGRAGDNVGVLLRGTKREDVERGQVLAKPKSITPHTKFYAEVYVL
EFTU_VESOH       TTTCTGVEMFRKLLSSGEAGDNVGVLLRGTKREEVERGQVLSKPGSIKPHAKFEAEIYIL
EFTU_HYDCU       TTTVTGVEMFRKLLDQGEAGDNVGILLRGTKREDIERGQVLAHKGTVTPHTKFEAEVYVL
EFTU_FRAP2       KTTVTGVEMFRKLLDKGEAGDNVGILVRGLKRDDVERGQVLCKPGSIKPHTKFEAEVYVL
EFTU_FUSNN       KTTCTGVEMFRKLLDQGQAGDNIGVLLRGTKKEEVERGQVLAKPGSIHPHTNFKGEVYVL
EFTU_CAMJD       TTTVTGVEMFRKEMDQGEAGDNVGVLLRGTKKEEVIRGMVLAKPKSITPHTDFEAEVYIL
EFTU_CAMHC       TTTVTGVEMFRKELDEGEAGDNVGVLLRGTAKEDVERGMVLAKPKSITPHTKFEAEVYIL
EFTU_HELAH       KTTVTGVEMFRKELDKGEAGDNVGVLLRGTKKEEVERGMVLCKPGSITPHKKFEGEIYVL
EFTU_WOLSU       KTTVTGVEMFRKELDKGEAGDNVGVLLRGTKKEDVERGMVLCKIGSITPHTNFEGEVYVL
EFTU_NITSB       KTTVTGVEMFRKELDQGEAGDNVGVLLRGTKKEEVERGQVLAQPGTITPHTKFEAEIYVL
EFTU_ARCB4       KTTVTGVEMFRKEMDQGQAGDNCGILLRGIKKEDVERGQVLVKPGTITPHTKFRCEVYIL
EFTU_SULNB       KTTVTGVEMFRKEMDCGIAGDNCGVLIRGIDKEAVQRGMVLCKPGSITPHTQFEAEVYVL
EFTU_SULDN       KTTVTGIEMFRKEMDQGLAGDNCGVLVRGIGKDDVERGQVLCKPGTINPHTKFTAEIYVL
EFTU_RICAH       KTTCTGVEMFRKLLDEGQAGDNVGILLRGTKREEVERGQVLAKPGSIKPHDQFEAEVYVL
EFTU_RICBR       TSTCTGVEMFRKLLDSGEAGDNVGILLRGIDREAVQRGQVLAKPGSITPHDEFEAEVYVL
EFTU_MAGSA       KTTCTGVEMFRKLLDQGEAGDNIGALLRGTKREDVERGQVLAAPGSITPHTDFEAEAYIL
EFTU_PARL1       KTTCTGVEMFRKLLDQGEAGDNVGVLLRGTKREDVERGQVLCAPGSITPHTEFEAEAYIL
EFTU_GLUOX       KTTVTGVEMFRKLLDRGEAGDNIGALVRGTKREDVERGQVLAKPGSITPHKKFKAEAYIL
EFTU_AZOC5       KTTVTGIEMFRKLLDQGQAGDNVGVLLRGTKREDVERGQVVCKPGSVKPHTKFKAEAYIL
EFTU1_RHORT      KTTCTGVEMFRKLLDQGEAGDNIGALLRGTKRDDVERGQVLAKPGSITPHTKFKCEAYIL
EFTU_ACICJ       KTTVTGVEMFRKLLDQGEAGDNIGALLRGTKREDVERGQVLAAPGSITPHTNFSGSVYIL
EFTU_NOVAD       KTTVTGVEMFRKLLDQGEAGDNIGALIRGIKREEVERGQVLAKPGSVTPHTEFSAEVYVL
EFTU_ERYLH       KTTVTGVEMFRKLLDRGEAGDNIGALIRGVGREDVERGQVLAKPGSVTPHTEFSAEVYVL
EFTU_SPHAL       KTVVTGVEMFRKLLDQGQAGDNIGALIRGVGREEVERGQVLAKPGSITPHTEFTSEVYVL
EFTU_ZYMMO       KTTVTGVEMFRKLLDQGQAGDNIGALLRGTARTEVERGQVLAKPGSITPHTEFKAEVYVL
EFTU_SPHWW       KTTVTGVEMFRKLLDQGQAGDNIGALIRGVGREEVERGQVLAKPGSIKPHTDFSSEVYVL
EFTU_RHIL3       KTTVTGVEMFRKLLDQGQAGDNIGALIRGVTRDGVERGQILCKPGSVKPHKKFMAEAYIL
EFTU_RHILO       KTTCTGVEMFRKLLDQGQAGDNIGALLRGVDREGVERGQVLAKPGTVKPHKKFVAEAYIL
EFTU_JANSC       KTTCTGVEMFRKLLDRGEAGDNIGALLRGVDREGVERGQVLCKPGSVDPHTKFEAEAYIL
EFTU_ROSDO       STTCTGVEMFRKLLDRGEAGDNIGALLRGIDREAVERGQVLCKPGSVKPHTKFEAEAYIL
EFTU_RHOS5       KTVCTGVEMFRKLLDQGEAGDNVGLLLRGVDRDGIERGQVLCKPGSVKPHTKFEAEAYIL
EFTU_PARDP       KTTCTGVEMFRKLLDRGEAGDNIGALLRGVERDGVERGQVLAKPGSVTPHTEFEAEAYIL
EFTU_CAUVC       KTTCTGVEMFRKLLDQGQAGDNVGVLLRGTKREDVERGQVLCKPGSITPHTKFVAEAYIL
EFTU1_HYPNA      KTTCTGVEMFRKLLDQGQAGDNIGALLRGVDREGVERGQVLCKPGSITPHTLFEAEAYIL
EFTU_MARMM       KTTCTGVEMFRKLLDQGQAGDNVGVLLRGVDREGVERGQVLAKPGSITPHHKFVAEAYIL
EFTU_MAGMM       VTTCTGVEMFRKLLDQGQAGDNVGVLLRGTKREDVQRGQVLAAPNSIKPHTKFNAESYIL
EFTU_ANADF       KTVVTGVEMFRKLLDEGQAGDNIGALLRGLKREEVERGQVLAKPGSITPHTKFKAEVYVL
EFTU_STIAU       KTVITGVEMFRKLLDEGMAGDNIGALLRGLKREDLERGQVLANWGSINPHTKFKAQVYVL
EFTU_BDEBA       KTTVTGIEMFRKLLDEGQAGDNCGVLLRGTKKEDVERGQVLVKPGTVKPHKKFKAEAYIL
EFTU_PELUB       KSVCTGVEMFRKLLDSGEAGDNVGILLRGVERDDIQRGQVLCKPASITPHTKFEAQAYVL
EFTU_CHLPD       KSVVTGIEMFQKLLDEGQAGDNAGLLLRGVDKTELERGMVIAKPGTIKPHTKFKAEVYIL
EFTU_GEOUR       KTTVTGVEMFRKLLDEGRAGDNIGALLRGVKREDIERGQVLAKPGSITPHTKFKAEAYIL
EFTU1_PELCD      KTVVTGVEMFRKLLDQGQAGDNIGVLLRGVKREDIERGQVLAKPGSITPHTKFKAEAYIL
EFTU2_DESPS      KTTCTGVEMFRKLLDEGRAGDNIGALLRGVKREDIERGQVLAKPGTITPHTKFKAECYIL
EFTU_FLESI       KTVVTGVEMFRKILDEGEAGDNVGVLLRGIKKDDVERGQVLAKPGSITPHRKFKCEAYIL
EFTU_DESVH       KSTCTGVEMFRKLLDQGQAGDNIGALLRGVKRDDVERGQVLAAPKSITPHRKFKAEVYVL
EFTU_DESAG       TTTCTGVEMFRKLLDQGQAGDNVGVLLRGVKRDDVERGQVLAAPKSITPHKKFKAEVYVL
EFTU_LAWIP       KTTCTGVEMFRKLLDQGEAGDNIGVLLRSVKRDEVERGQVLSALKSITPHRKFKAEVYVL
EFTU_SYNFM       KTVCTGVEMFRKTLDQGQAGDNVGVLLRGTKRDEVERGQVVAKPGSITPHTKFKAEVYVL
EFTU_SYNAS       KTVCTGVEMFRKTLDEGRAGDDVGLLLRGIKREDVERGQVVAKPGSITPHTKFMAQVYVL
EFTU_EHRRG       STVCTGVEMFHKALDAGEAGDNAGILLRGIKKEDVERGQVLSAPGQIHSYKGFKAEVYVL
EFTU_ANAPZ       STVCTGVEMFHKALEAGEAGDNAGILLRGIKKEDVERGQVLSAPGQMKSYKKFKAEVYVL
EFTU2_WOLPM      KTICTGVEMFKKLLDKGSAGLNVGILLRGTKREEVERGQVLAKPGTITPHRKFKAEVYIL
EFTU1_ORITB      KTICTGVEMFKKELDQGQAGDNVGILLRGIKREDVERGQVLAKPGTITPHCSFEAEVYVL
EFTU_NEOSM       KTTCTGVEMFNKLVEQGEAGFNVGILLRGSKREDVCRGQVLCKPGSITPHRKLRARIVTL
EFTU_AYWBP       KTIVTAVEMFKKDLEFAQAGDNVGALLRGINREDVQRGQVLAKPGSVKPHSKFIAQVYVL
EFTU_APPPP       KAIITGLEMFKKELDFAQAGDNVGILLRGITRDQIERGQVLAKPGSLNAYHKFLSQVYIL
EFTU_CARRP       KTIVIGIEMFKKTLDEGFAGENVGILLRSIKREEVERGQVLIKSGTIKPHTNFICEVYIL
EFTU_SORC5       KSVVTGVEMFRKLLDQGQAGDNVGCLLRGVEKEEIERGQVLAKPGSITPHTKFTGEVYVL
EFTU_RHOBA       KTTCTGVEMFRKEMNEGRSGDNVGCLLRGVKREDIQRGQVLAKPGSITPHTKFEAEVYCL
EFTU_BRAHO       KTTCTGVEMFKKEV-VGIAGYNVGCLLRGIERKAVERGQVLAKPGTITPHKKFEAEVYIL
EFTU_TREDE       KTVVTGIEMFNKLLDEGEAGDNVGLLLRGIEKKEVERGQVLAKPGSIHPHTKFEAQIYVL
EFTU_TREPA       KTVVTGIEMFNKLLDQGIAGDNVGLLLRGVDKKEVERGQVLSKPGSIKPHTKFEAQIYVL
EFTU_BORBU       KTTVTGVEMFQKILEQGQAGDNVGLLLRGVDKKDIERGQVLSAPGTITPHKKFKASIYCL
EFTU_LEPBL       KTVVTGIEMFRKLLDQAEAGDNIGALLRGTKKEDIERGQVLAKPGSITPHKKFAAEVYVL
EFTU_RUBXD       KTVVTGIEMFNKSMQEAQAGDNIGVLLRGIKRDEIERGQVLAAPGSITPHTRFKAEVYVL
EFTU2_PELTS      KTVVTGVEMFRKILDVGVAGDNVGCLLRGVDRKEIERGQVLAKPGSIKPHKSFSAEVYVL
EFTU_DESRM       KTVVTGVEMFRKLLDFAQAGDNIGALLRGVDRKEIERGQVLAKPGSINPHTKYSAEVYVL
EFTU2_CARHZ      KTVVTGLEMFRKVLDEAVAGDNIGALLRGVDRKEIERGQVLAKPGTIKPHRKFFAEVYVL
EFTU1_SYNWW      KTVCTGVEMFRKLLDYAEAGDNIGTLLRGVDRKEVERGMVLAKPGSIKPLTAFNAEVYVL
EFTU_MOOTA       KTVVTGVEMFRKILDEAVAGDNIGTLLRGVDRKEVERGMVLAKPGSIKPHTKFNAEVYVL
EFTU2_CALS4      KTVVTGVEMFRKTLDEAQAGDNIGVLLRGIQKDEVERGQVLAKPGTIKPHTKFEAQVYVL
EFTU_DESHY       KTVCTGVEMFRKLLDQAQAGDNIGALLRGVDRKDIERGQVLAKTGSIKPHTKFTGEVFVL
EFTU_CLOBM       KTVCTGIEMFRKILDEAMAGDNIGALLRGIQRDEIQRGQVLAKPGSITPHKKFVGQVYVL
EFTU_CLOK5       KTVCTGVEMFRKLLDQAMAGDNIGALLRGIQREEIERGQVLSKPGSVKPHKKFVGQVYVL
EFTU_CLOAB       KVVVTGVEMFRKILDSALAGDNIGALLRGVQREDIERGQVLAKPGSITPHNKFVGQVYVL
EFTU_CLOTE       KSVITGIEMFRKLLDEAQAGDNIGALLRGVQRDEIQRGQVLAATGSVKPHKSFTGQVYVL
EFTU_CLONN       KTTITGVEMFRKMLDEAMAGDNIGALLRGVQRDEIERGQVLAKPGSVTPHKKFVGQVYVL
EFTU_CLOPS       KTVVTGIEMFRKLLDEAQAGDNIGALLRGIQRTDIERGQVLAQVGTINPHKKFVGQVYVL
EFTU_CLOB8       KVVVTGIEMFRKLLDEAQAGDNIGALLRGVQRTDIERGQVLSKPNSVHPHTKFVGQVYVL
EFTU_CALS8       KTVVTGIEMFRKVLDEAVAGDNVGCLLRGIQKNEVERGQVLAKPGTIKPHTKFKAQVYVL
EFTU_SYMTH       TTVVTGLEMFRKILDEVQAGDNVGALLRGIEKKEVERGQVLAKPGSIKPHTKFSGAIYVL
EFTU_HUNT2       KTVVTGIEMFRKLLDQAVAGDNIGALLRGIQRNEVERGQVLAKPGSIKPHTYFEAQVYVL
EFTU_ALKOO       KIVVTGVEMFRKLLDQAQAGDNVGLLLRGIQRTEIQRGQVLCKPGTIKPHTKFKAEVYVL
EFTU_CLOD6       KVVVTGVEMFRKLLDQAQAGDNIGALLRGVQRNEIERGQVLAKTGSVKAHTKFTAEVYVL
EFTU2_ALKMQ      KLVVTGVEMFRKLLDQGQAGDNVGILLRGIQRDEIERGQVLAKTGSIQPHTKFMAEVYVL
EFTU_LACP7       KVVVTGIEMFRKLLDEAQAGDNIGALLRGVQRTDIERGQVLCKPGTIKCYKKFTAQVYVL
EFTU_THEAQ       KTVVTGVEMHRKTLQEGIAGDNVGLLLRGVSREEVERGQVLAKPGSITPHTKFEASVYIL
EFTU_DEIGD       KTTITGVEMHRKLLDQGMAGDNVGVLLRGVARDDVERGQVLAKPGSITPHTKFEASVYVL
EFTU_LACBA       KTTVTGLEMFRKTLDLGEAGDNVGALLRGVNREQVVRGQVLAQPGSIQTHEKFKGEVYIL
EFTU_PEDPA       KTTVTGIEMFRKTLDVGEAGDNIGALLRGVNREDVVRGQVLAAPGSIQTHKKFKGEVYIL
EFTU_LACP3       KSTVTGLEMFRKTLDLGEAGDNVGVLLRGVNREQVERGQVLAKPGSIQLHNKFKGEVYIL
EFTU_LACRD       KSTVTGLEMFHKTLDLGEAGDNVGVLLRGISHDQIQRGQVLAEPGSIQTHKNFKGEVYVM
EFTU_OENOB       NTVVTGVEMFRKTLDLGEAGDNIGALLRGIDRDGVERGQVLAKPGSIQTHKKFKGEVYIL
EFTU_LACS1       KTTVTGVEMFRKTLDEGEAGDNIGALLRGVDRTQVERGQVLAKPGSIQTHKKFKGEVYVL
EFTU_LACSS       KTTVTGLEMFRKTLDQGQAGDNIGALLRGIDRESIERGQVLAKPGSIQTHKNFKGEVYIL
EFTU_LACJO       KSTVTGLEMFHKTLDLGEAGDNVGVLLRGIDRDQVERGQVLAAPGSIQTHKNFKGQVYIL
EFTU_LACDA       TSVVTGLEMFHKTLDLGEAGDNVGVLLRGVDRDQIVRGQVLAAPGSIKTHKTFKGQVYIL
EFTU_LEUMM       KTTVTGIEMFRKTLEEAQAGDNIGALLRGVDRSNIERGQVLAKPGSIKTHKKFKAEVYVL
EFTU_STRMU       KAVVTGVEMFRKQLDEGIAGDNVGVLLRGIQRDEIERGQVLAKPGSIHPHTKFKGEVYIL
EFTU_LACLS       KAVVTGIEMFRKTLTEGLAGDNVGALLRGIQRDEIERGQVIAKPGSITPHKLFEGEVYVL
EFTU_GEOTN       STTVTGVEMFRKLLDQAEAGDNIGALLRGVSRDEVERGQVLAKPGSITPHTKFKAQVYVL
EFTU_BACCN       STTVTGVEMFRKLLDQAEAGDNIGALLRGVAREDIQRGQVLAKPGSVKAHAKFKAEVYVL
EFTU_BACSK       STTVTGVEMFRKLLDYAEAGDNIGALLRGVSREEIQRGQVLAKPGTITPHTKFTAEVYVL
EFTU_BACLD       KTTVTGVEMFRKLLDYAEAGDNIGALLRGVSREEIQRGQVLAQPGTITPHKKFKAEVYVL
EFTU_OCEIH       KTTVTGVEMFRKLLDYAEAGDNIGALLRGVSREDINRGQVLAKPGSITPHTNFKAEVYVL
EFTU_STAS1       KTTVTGVEMFRKLLDYAEAGDNIGALLRGVSRDDVQRGQVLAAPGTITPHTKFKADVYVL
EFTU_ENTFA       KTTVTGVEMFRKLLDYAEAGDNIGALLRGVAREDIERGQVLAKPATITPHTKFKAEVYVL
EFTU_LISIN       KVVVTGVEMFRKLLDYAEAGDNIGALLRGVAREDIQRGQVLAKPGSITPHTNFKAETYVL
EFTU_ACHLI       TTTVTGVEMFRKLLDQAEAGDNIGALLRGVDREGVERGQVLSKPGTVKPHAKFTAQIYVL
EFTU_MYCGE       KAVVTGIEMFKKELDSAMAGDNAGVLLRGVERKEVERGQVLAKPGSIKPHKKFKAEIYAL
EFTU_MYCGA       KVVVTGIEMFRKELDAAMAGDNAGILLRGVDRKDVQRGQVLAKPGSITPHKKFRAEIYAL
EFTU_MYCPE       KAVVTGMEMLRKTLDEVKAGDNAGILLRGIDRKDVERGQVLAKPGSIKPHKQFEAEIYAL
EFTU_UREP2       KTVVTGIEMFRKSLDQAEAGDNAGILLRGIKKEDVERGQVLVKPGSIKPHRTFTAKVYIL
EFTU_MYCPU       KTTVTGIEMFRKNLKEAQAGDNAGLLLRGVDRNDVERGQVLAKPGSIVPHSKFEAAIYAL
EFTU_MYCHJ       KTVITGIEMFNKNLQTAMAGDNAGVLLRGVDRKDIERGQVIAKPKTIIPHTKFKAAIYAL
EFTU_MYCMO       RTTVTGIEMFRKNLKTALAGDNAGLLLRGINREQIERGQVLAKPGTIVPHTKFKAAIYAL
EFTU_MYCS5       KTVVTGIEMFRKNLKEALAGDNAGLLLRGVNRDDVERGQVLAKPGSIVPHTEFEAAIYVL
EFTU_MYCMS       KTVVTGLEMFRKLLDFAVAGDNVGALLRGVDRHSVERGQVLAKPGTIKPHTVLKASVYAL
EFTU_MESFL       KTVVTGLEMFRKLLDFAEAGDNVGALLRGVDRESIERGQVLAKPGTIKPHTKLQASVYAL
EFTU_THEMA       KTVVTSVEMFRKELDEGIAGDNVGCLLRGIDKDEVERGQVLAAPGSIKPHKRFKAQIYVL
EFTU_FERIS       KTVITSVEMFRKELDEAIAGDNVGCLLRGSSKDEVERGQVLAKPGSITPLKKFKANIYVL
EFTU_THEM4       KTVVTSVEMFRKILDEGLAGDNVGCLLRGIDKDEVERGQVLAKPGSITPHTTFKAQVYVL
EFTU_PSELT       KTVVTSVEMFRKELDEGLAGDNVGCLLRGIDKDEIERGQVLAAPGSITPHTTFKANVYVL
EFTU_PETMO       KTVVTGVEMFRKILDEGEAGDNVGCLLRGIEKDEVKRGQVLAAPGSITPHKKFKAEVYVL
EFTU_AQUPY       KTVATSIEMFRKVLDEALPGDNIGVLLRGVGKDDVERGQVLAQPGSVKAHRKFRAQVYVL
EFTU2_ROSCS      KTVVTGVEMFQKTLDEGIAGDNVGVLLRGIERTEVERGQVLAAPGSIKPHAKFKANVYVL
EFTU_CHLAA       RTVVTGVEMFQKTLDEGIAGDNVGCLLRGIERTDVERGQVLCAPGSIKPHKKFEAQVYVL
EFTU_HERAU       TTAVTGVEMFKKLLDEGRAGDNVGALLRGIERTDVERGQVLAKPGSIKPHTKFKAEVYVL
EFTU_DEHM1       KIVVTSLEMFHKILDSAEPGDAVGLLLRGVEREDIERGMVLAKPGSIKPHINAEAEVYVL
EFTU_STRCJ       TTTVTGIEMFRKLLDEGQAGENVGLLLRGIKREDVERGQCIIKPGTVTPHTEFEATAYIL
EFTU2_STRRA      RTTVTGIEMFRKLLDEGRAGENVGLLLRGVKREQVERGQVVIRPGSVTPHTQFEAQAYIL
EFTU_PLARO       TTTVTSIEMFNKMLDEGHAGDNAALLLRGIKREQVERGQCIIKPGTTTPHTEFEAQVYIL
EFTU_THEFY       TTTVTGVEMFRKLLDQGQAGDNVGLLLRGVKREEVERGQVVIKPGTTTPHTEFEAQVVIL
EFTU_FRACC       STTVTGVEMFRKLLDEGRAGDNVGLLLRGIKREDVERGQVIVKPKSITPHTVFEARVYIL
EFTU_KINRD       KTTVTSIEMFNKMLDTGQAGDNAALLLRGLKRDDVERGQVVVKPGSITPHTEFEGQAYIL
EFTU_SALAI       KTTCTGIEMFRKLLDEARAGENVGLLLRGVKREDVERGMVVIKPGTATPHTEFEATVYIL
EFTU_NOCSJ       KSTVTGVEMFRKLLDEGQAGENVGLLLRGTKREDVERGMVVAKPGTTTPHTNFEASVYIL
EFTU_SACEN       KTTVTGVEMFRKLLDQGQAGDNVGLLIRGIKREEVERGMVVVKPGTTTPHTEFEAQVYIL
EFTU_RHOJR       KTTVTGIEMFRKLLDSGQAGDNVGLLVRGIKREDVERGQVVVKPGTTTPHTEFEGQAYIL
EFTU_CORDI       TTTVTGIEMFRKLLDYTEAGDNCGLLLRGVKREDVERGQVVVKPGAYTPHTEFEGSVYVL
EFTU_CORJK       KTTVTSIEMFNKLLDTAEAGDNAALLLRGLKREDVERGQIIAKPGEYTPHTEFEGSVYVL
EFTU_ACIC1       KTTVTGVEMFRKLLDEGRAGDNIGVLLRGIKREEVERGQVVCKPGSITPHTEFEAQVYVL
EFTU_CUTAK       KTTVTGVEMFRKILDEGRAGENVGVLLRGTKKEDVVRGMVLSKPGSTTPHTDFEGQVYVL
EFTU_TROW8       KTTVTGIEMFRKQLDEAWAGENCGLLLRGTKREDVERGQVVVKPGSVTPHTKFEGKAYIL
EFTU_LEIXX       KTTVTGIEMFHKQLDEAWAGENCGLLLRGTKREDVERGQVVVKPGSVTPHTSFEGTAYIL
EFTU_MICLU       KTTVTGIEMFHKQLDEAWAGENCGLLVRGLKRDDVERGQVLVEPGSITPHTNFEANVYIL
EFTU_BRELN       KTTVTAIEMFRKTLPDARAGENVGLLLRGTKREDVERGQVIVKPGSITPHTKFEAQVYIL
EFTU_BIFAA       TTTVTSIETFHKQMDECEAGDNTGLLLRGINRDQVERGQVLAAPGSVTPHTKFEGEVYVL
EFTU3_STRRA      ETVVTGLETFGKPMDEAQAGDNVALLLRGVPRDAVRRGHVVAAPGSVVPRSRFSAQVYVL
EFTU_PAROE       KSTVTGVEMFRKILDRGEAGDNVGLLLRGIEKEAIRRGMVICKPGSVTPHKKFKAEVYVL
EFTU_CYTH3       KSTVTGVEMFRKILDRGEAGDNVGLLLRGIEKESIKRGMVICKPGSVKPHSEFKGEIYVL
EFTU_PARD8       KSVVTGVEMFRKLLDQGEAGDNVGLLLRGIDKNEIKRGMVICHPGQVKEHSKFKAEVYIL
EFTU_CELLY       ASTITGVEMFRKILDRGEAGDNVGILLRGIEKSQISRGMVICKPGSVKPHSKFEAEVYIL
EFTU_GRAFK       TSTITGVEMFRKILDRGEAGDNVGILLRGIEKSQISRGMVITKPGSVTPHAKFKAEVYIL
EFTU_FLAPJ       TSTVTGIEMFRQILDRGEAGDNAGILLRGVAKEDIKRGMVIIKPGSVKPHAKFKAEVYIL
EFTU_SULMW       NSIVTGVEMFRKILDKGQAGDNVGLLLRGIEKKDIRRGMVISKPGYITPHKKFNAQIYIL
EFTU_TERFE       NSTVTGVEMFRKLLDEGEAGDNAGLLLRGVEKTQIRRGMVIVKPGSITPHTDFKGEVYVL
EFTU_SALRD       DSVVTGIEMFNKTLEEGEAGDNAGILLRGIEKEEVKRGMVLAEPGTVTPHKEFECEVYVL
EFTU_SOLUE       KTVVTGVEMFKKLLDEGRAGDNVGLLLRGVEKDMVERGQVIAKPGSITPHTKFKGEVYVL
EFTU_KORVE       KTVVTGVEMFKKQLDEGLAGDNAGLLLRGIGKDDVERGMVLAKGGSITPHTKFKGEVYVL
EFTU_CHLPN       ETIVTGVEMFRKELPEGRAGENVGLLLRGIGKNDVERGMVVCQPNSVKPHTKFKSAVYVL
EFTU_PARUW       DTVATGLEMFNKILEEARAGENVGILLRGLTKTDIERGMCLVAPGTCTPHTEFKGPVYVL
EFTU_TRIV2       NTTVTGIEMFKKSLDEGMAGDNAGVLLRGIQKTDIERGMVLAKPGSITPHTQFEGEVYVL
EFTU_THEEB       TTTVTGIEMFKKSLEEGIAGDNAGLLLRGLKKEDVERGMVIAKPGSITPHTKFEGEVYVL
EFTU_MICAN       PTTVTGIEMFKKSLDQGMAGDNAGILLRGIQKTDIERGMVIAKPGTIKPHTQFEGEVYVL
EFTU_SYNJA       STTVTGLEMFQKTLDEGIAGDNVGVLLRGIQKNEVERGMVLAKPKTITPHTQFESEVYVL
EFTU_GLOVI       STTVTGLEMFQKSLDEGLAGDNIGVLLRGIKKEDVERGMVLAKPGSITPHTQFEGEVYIL
EFTU_SYNE7       STTVTGVEMFQKTLDEGLAGDNVGLLLRGIQKTDIERGMVLAKPGSITPHTKFESEVYVL
EFTU_ACAM1       STTVTGVEMFQKTLDEGMAGDNVGLLLRGVQKEDIERGMVLAKPGSITPHTQFESEVYIL
EFTU_TRIEI       NSTVTGVEMFQKILDEGMAGDNVGLLLRGMQKDDIQRGMVLAKSGSITPHKKFESEVYVL
EFTU_SYNY3       KATVTGVEMFQKTLEEGMAGDNVGLLLRGIQKEDIERGMVLAKPGSITPHTEFEGEVYVL
EFTU_ARTPT       TTTVTGAEMFQKTLEEGMAGDNVGLLLRGIQKNDVQRGMVIAKPKSITPHTKFEAEVYIL
EFTU_CYAM1       TTTVTGLEMFQKTLDEGIAGDNVGVLLRGVQKTDIERGMVLAKPGSITPHTKFEAEVYVL
EFTU_CYACA       STTVTGLEMFQKTLDEGLAGDNVGVLLRGVQKQDIERGMVLAKPGSITPHDKFEAEVYVL
EFTU_EMIHU       TTTVTGIEMFQKTLDEGMAGDNVGILIRGVQKTDIERGMVLAQPGTISPHKKFEAEVYVL
EFTU_GUITH       NTTITGLEMFQKSLDEALAGDNVGILVRGIQKTDIERGMVLAAPGSITPHTKFEGEVYVL
EFTU_GRATL       TTTITGLEMFQKTLDEGMAGDNIGILLRGVQKKDIERGMVLAQPGTITPHTQFEAEVYIL
EFTU_CYAPA       STTVTGLEMFQKTLEEGMAGDNIGILLRGVQKTDIERGMVLAKPGSITPHTQFESEVYVL
EFTU_CYCME       TTTITGIEMFQKTLEEGFAGDNVGILLRGVTRENIERGMVLAKPGTITPHTNFESEVYVL
EFTU_PHATC       TTTITGIEMFQKTLEEGFAGDNVGILLRGVTRENIERGMVLAKPGTITPHTSFESEVYVL
EFTU_TRICV       TTTITGIEMFQKTLDEGFAGDNVGILLRGVTREDIEAGMVLSEPGTITPHTNFESEVYVL
EFTU_PROM1       LTTVTGVEMFRKLLDEGMAGDNVGLLLRGIQKEDIERGMVLVKKGSITPHTKFEGEVYVL
EFTU_CHACO       STVVTGLEMFRRLLEQGFAGENIGVLLRGIEKKDIERGMVIAQPGTIEPHTRFEAQVYIL
EFTU_COLOB       HSKVISLKMFNKTLEQAIAGDDIGIFLEGTNKNNFQKGMVIAKPNTIQSWNHFEAQIYIL
EFTU_TOXGO       NVVVIGLEMFQKTLEIGEAGDNVGILLRGIQKTEVKRGMILSKPLTMTLHSIFQADVYIL
EFTU_EIMTE       TTTVTGIEMFQKILNTAEAGDNVGILLRGIQKNEVRRGMVLAKPLSILTYSKFDAEVYIL
EFTU_THEPA       LTSVIGIEMFNKGLSQGESGDNVGLLLRGIIKEDVKRGHVVAKPKSLKFYSEFKATLYIL
EFTU_PLAF7       LTTVIGLEMFKKQLTQAQSGDNVGILLRNIQKKDIKRGMILATPNKLKVYKSFIAETYIL
                      . :   : :    .*   . ::.   :  .  *  :                  :

EFTU_OLTVI       TKEEGGRHTPFFPGYRPQFYVRTTDVTGKIESFVAD---------DGSASQMVMPGDR-V
EFTU_TUPAK       TKEEGGRHTPFFPGYRPQFYVRTTDVTGKIESFTAD---------DGSEALMATSGDR-L
EFTU_NEPOL       TKEEGGRHTPFFPGYRPQFYVRTTDVTGKIDSFRAD---------DGGEATMVMPGDR-V
EFTU_OSTTA       KKEEGGRHTPFFPGYRPQFYVRTTDVTGKIESFISD---------EGDEATMVMPGDR-V
EFTU_CHLVU       NKEEGGRHTPFFPGYRPQFYVRTTDVTGKIESFRAD---------DNTATQMVMPGDR-I
EFTU_PLETE       TRDEGGRHTPFFAGYRPQFYVRTTDVTGKIETFRTD---------DDQPTQMVMPGDR-I
EFTU_PROWI       NKEEGGRDTPFFSGYRPQFYVRTTDVTGKIESFCTD---------AGEPIKMVLPGDR-I
EFTU_CHLAT       NKEEGGRHTPFFQGYRPQFYVRTTDVTGKIESFQAD---------DGSETQMVMPGDR-I
EFTU_MESVI       AKEEGGRHTPFFPGYRPQFYVRTTDVTGKIDSFKAD---------DGSDTQMVMPGDR-V
EFTU_EUGGR       TKEEGGRHTPFFEGYRPQFYVRTTDVTGKIESFRSD---------NDNPAQMVMPGDR-I
EFTU_EUGLO       TKEEGGRHTPFFEGYKPQFYVRTTDVTGKIESFKSD---------DGTTVQMVMPGDK-I
EFTU_BIGNA       TKEEGGRHTPFFKGYRPQFYVRTTDVTGKIESLKSDE--------DNTEMRMVVPGDR-V
EFTU_HELSJ       TKEEGGRSKGFTIGYRPQFYVRTTDVTGAILNMLSD---------DNTPLKIASPGDR-I
EFTU_CODFR       KKEEGGRHTSFFAGYRPQFYVRTTDVTGHIKTFQGKI--------DNTQIQMVMPGDR-I
EFTU_TETOB       TKEEGGRHSPFLVGYQPQFFIRTTDVTGKIVSFTHIQMKNPSSVAEEHSNKMAMPGDR-I
EFTU_CHLRE       TKEEGGRHSAFMIGYQPQFYVRTTDVTGKVVGFNHIQMRNPSSVAEEHSNKMAMPGDR-I
EFTU_STIHE       TAEEGGRKSGFFKGYQPQFYVRTTDVTGKILDFSYIKQRNPSELSTMHSNPMVCPGDY-V
EFTU1_ECOLI      SKDEGGRHTPFFKGYRPQFYFRTTDVTGTI-ELPEG-------------VEMVMPGDN-I
EFTU1_YERE8      SKDEGGRHTPFFKGYRPQFYFRTTDVTGTI-ELPEG-------------VEMVMPGDN-I
EFTU_HAEDU       SKEEGGRHTPFFKGYRPQFYFRTTDVTGTI-ELPEG-------------VEMVMPGDN-I
EFTU_BUCBP       SKEEGGRHTPFFKGYRPQFYFRTTDVTGSV-ELPED-------------MEMVMPGDN-V
EFTU_BUCAI       SKEEGGRHTPFFKGYRPQFYFRTTDVTGSI-ELPEG-------------IEMVMPGDN-I
EFTU_BUCCC       SKEEGGRHTPFFKGYRPQFYFRTTDVTGSI-ELPEN-------------IEMVMPGDN-I
EFTU_AERS4       SKEEGGRHTPFFKGYRPQFYFRTTDVTGTI-ELPEG-------------VEMVMPGDN-I
EFTU2_PSEHT      SKDEGGRHTPFFKGYRPQFYFRTTDVTGDV-QLPEG-------------VEMVMPGDN-V
EFTU1_PHOPR      SKDEGGRHTPFFKGYRPQFYFRTTDVTGTI-ELPEG-------------VEMVMPGDN-I
EFTU_PSEA6       SKDEGGRHTPFFKGYRPQFYFRTTDVTGAV-ELPEG-------------VEMVMPGDN-L
EFTU_PSYIN       SKDEGGRHTPFFKGYRPQFFFRTTDITGAV-ELPEG-------------VEMVMPGDN-L
EFTU_COLP3       SKDEGGRHTPFFKGYRPQFYFRTTDITGAV-ELPEG-------------VEMVMPGDN-L
EFTU_SHEAM       SKEEGGRHTPFFKGYRPQFYFRTTDVTGTI-ELPEG-------------VEMVMPGDN-I
EFTU_BLOPB       NKDEGGRHTPFFKGYRPQFYFRTTDITGTI-ELPEG-------------ADMVMPGDN-I
EFTU_BLOFL       NKDEGGRHTPFFKGYRPQFYFRTTDVTGTI-ELPKE-------------VEMVMPGDN-I
EFTU_BAUCH       NKDEGGRHTPFFKGYRPQFYFRTTDVTGTI-ELPID-------------VEMVMPGDN-I
EFTU_WIGBR       KKEEGGRHTPFFNGYKPQFYFRTTDVTGSV-ELQKG-------------TEMVMPGDN-V
EFTU_PSYA2       SKEEGGRHTPFLNGYRPQFYFRTTDVTGAI-QLQDG-------------TEMVMPGDN-V
EFTU_ACIAD       SKEEGGRHTPFLNGYRPQFYFRTTDVTGAI-QLKEG-------------VEMVMPGDN-V
EFTU_NEIGO       SKEEGGPHTPFFANYRPQFYFRTTDVTGTI-TLEKG-------------VEMVMPGEN-V
EFTU_CHRVO       SKDEGGRHTPFFANYRPQFYFRTTDVTGAI-SLAEG-------------VEMVMPGDN-V
EFTU_NITMU       SKEEGGRHTPFFQGYRPQFYFRTTDVTGAI-ELPAG-------------TEMVMPGDN-V
EFTU1_METFK      GKDEGGRHTPFFNGYRPQFYFRTTDVTGAV-ELPAG-------------TEMVMPGDN-V
EFTU_THIDA       SKDEGGRHTPFFNGYRPQFYFRTTDVTGSI-ELPAG-------------TEMVMPGDN-V
EFTU_DECAR       SKDEGGRHTPFFNGYRPQFYFRTTDVTGSI-ELPEG-------------TEMVMPGDN-I
EFTU_HERAR       SKDEGGRHTPFFNNYRPQFYFRTTDVTGSI-ELPKD-------------KEMVMPGDN-V
EFTU_POLAQ       GKDEGGRHTPFFNNYRPQFYFRTTDVTGSI-ELPKD-------------KEMVMPGDN-V
EFTU2_RHOFT      SKDEGGRHTPFFNNYRPQFYFRTTDVTGAI-ELPEG-------------KEMVMPGDN-V
EFTU_BORA1       SKEEGGRHTPFFNGYRPQFYFRTTDVTGTI-DLPQD-------------KEMVLPGDN-V
EFTU1_XANCB      SKDEGGRHTPFFKGYRPQFYFRTTDITGAC-QLPEG-------------VEMVMPGDN-V
EFTU_XYLFT       SKEEGGRHTPFFNGYTPQFYMRTTDITGKV-CLPEG-------------VEMVMPGDN-V
EFTU_METCA       SKEEGGRHTPFFNGYRPQFYFRTTDVTGAV-TLPEG-------------VEMVMPGDN-V
EFTU_DICNV       SKEEGGRHTPFFKGYRPQFYFRTTDVTGEC-VLPEG-------------VEMVMPGDN-V
EFTU_PSEA7       SKEEGGRHTPFFKGYRPQFYFRTTDVTGNC-ELPEG-------------VEMVMPGDN-I
EFTU_PSEF5       SKEEGGRHTPFFKGYRPQFYFRTTDVTGNC-ELPEG-------------VEMVMPGDN-I
EFTU_HAHCH       SKDEGGRHTPFFKGYRPQFYFRTTDVTGAC-ELPEG-------------VEMVMPGDN-V
EFTU_SACD2       SKDEGGRHTPFFKGYRPQFYFRTTDVTGAC-ELPEG-------------VEMVMPGDN-V
EFTU_MARMS       GKDEGGRHTPFFKGYRPQFYFRTTDVTGAC-SLPEG-------------VEMVMPGDN-I
EFTU_CHRSD       SKEEGGRHTPFFKGYRPQFYFRTTDVTGTC-ELPEG-------------VEMVMPGDN-V
EFTU_ALCBS       SKDEGGRHTPFFNGYRPQFYFRTTDVTGAC-TLPEG-------------TEMVMPGDN-V
EFTU_LEGPL       SKEEGGRHTPFFNGYRPQFYFRTTDVTGTC-DLPSG-------------VEMVMPGDN-V
EFTU1_HALHL      SKDEGGRHTPFFNGYRPQFYFRTTDVTGTV-TLPEG-------------TEMVMPGDN-V
EFTU_ALKEH       SKDEGGRHTPFFNGYRPQFYFRTTDVTGSC-ELPEG-------------VEMVMPGDN-V
EFTU_COXBU       SKEEGGRHTPFLQGYRPQFYFRTTDVTGQLLSLPEG-------------IEMVMPGDN-V
EFTU_NITOC       SKDEGGRHTPFFTGYRPQFYFRTTDVTGAI-DLPDG-------------VEMVMPGDN-I
EFTU_VESOH       SKDEGGRHTPFFNNYRPQFYFRTTDVTGAC-QLPDG-------------IEMVMPGDN-V
EFTU_HYDCU       SKDEGGRHTPFFQGYRPQFYFRTTDVTGAC-ELPAG-------------TEMVMPGDN-V
EFTU_FRAP2       SKEEGGRHTPFFKGYRPQFYFRTTDITGAV-ELPEG-------------VEMVMPGDN-I
EFTU_FUSNN       TKDEGGRHTPFFTGYRPQFYFRTTDITGAV-TLPDG-------------VEMVMPGDN-I
EFTU_CAMJD       NKDEGGRHTPFFNNYRPQFYVRTTDVTGSI-KLADG-------------VEMVMPGEN-V
EFTU_CAMHC       TKEEGGRHTPFFNNYRPQFYVRTTDVTGSI-QLPEG-------------TEMVMPGDN-V
EFTU_HELAH       SKEEGGRHTPFFTNYRPQFYVRTTDVTGSI-TLPEG-------------VEMVMPGDN-V
EFTU_WOLSU       SKEEGGRHTPFFNGYRPQFYVRTTDVTGSI-SLPEG-------------VEMVMPGDN-V
EFTU_NITSB       TKEEGGRHTPFFSGYRPQFYVRTTDVTGTI-TLPEG-------------VEMVMPGDN-V
EFTU_ARCB4       SKEEGGRHTPFFSGYRPQFYVRTTDVTGSC-TLPEG-------------TEMVMPGDN-V
EFTU_SULNB       TKEEGGRHTPFFDNYRPQFYVRTTDVTGSV-KLQEG-------------TEMVMPGDN-V
EFTU_SULDN       SKEEGGRHTPFFTNYRPQFYVRTTDVTGAI-YLPEG-------------TEMVMPGDN-V
EFTU_RICAH       SKEEGGRHTPFTNDYRPQFYFRTTDVTGTI-KLPAD-------------KQMVMPGDNAT
EFTU_RICBR       SKDEGGRHTPFTNNYRPQFYFRTTDVTGTI-ELPAD-------------KQMVMPGDN-A
EFTU_MAGSA       NKEEGGRHTPFFTNYRPQFYFRTTDVTGVV-ALPEG-------------TEMVMPGDN-V
EFTU_PARL1       TKEEGGRHTPFFTNYRPQFYFRTTDVTGVV-TLPEG-------------TEMVMPGDN-V
EFTU_GLUOX       TKEEGGRHTPFFTNYRPQFYFRTTDVTGVV-TLPEG-------------TEMVMPGDN-V
EFTU_AZOC5       TKEEGGRHTPFFTNYRPQFYFRTTDVTGVV-TLPEG-------------TEMVMPGDN-I
EFTU1_RHORT      TKEEGGRHTPFFSNYRPQFYFRTTDVTGTI-ELPEG-------------TEMVMPGDN-I
EFTU_ACICJ       NKEEGGRHTPFFTNYRPQFYFRTTDVTGVV-TLPEG-------------VEMVMPGDN-V
EFTU_NOVAD       SKDEGGRHTPFFANYRPQFYFRTTDVTGEV-VLPEG-------------TEMVMPGDN-V
EFTU_ERYLH       SKDEGGRHTPFFANYRPQFYFRTTDVTGEV-ILPEG-------------TEMVMPGDN-V
EFTU_SPHAL       SKDEGGRHTPFFANYRPQFYFRTTDVTGEV-ILPEG-------------TEMVMPGDN-V
EFTU_ZYMMO       SKDEGGRHTPFFANYRPQFYFRTTDVTGEI-TLPED-------------VEMVMPGDN-I
EFTU_SPHWW       SKEEGGRHTPFFANYRPQFYFRTTDVTGTV-ELPEG-------------TEMVMPGDN-V
EFTU_RHIL3       TKEEGGRHTPFFTNYRPQFYFRTTDVTGIV-TLPEG-------------TEMVMPGDN-V
EFTU_RHILO       TKDEGGRHTPFFTNYRPQFYFRTTDVTGIV-SLPAG-------------TEMVMPGDN-I
EFTU_JANSC       TKEEGGRHTPFFANYRPQFYFRTTDVTGTV-NLPAG-------------TEMVMPGDN-L
EFTU_ROSDO       TKDEGGRHTPFFANYRPQFYFRTTDVTGTV-QLAEG-------------TEMVMPGDN-V
EFTU_RHOS5       TKEEGGRHTPFFANYRPQFYFRTTDVTGTV-ELPEG-------------TEMVMPGDN-L
EFTU_PARDP       TKEEGGRHTPFFANYRPQFYFRTTDVTGTV-KLPEG-------------TEMVMPGDN-L
EFTU_CAUVC       TKEEGGRHTPFFTNYRPQFYFRTTDVTGII-KLREG-------------VEMIMPGDN-A
EFTU1_HYPNA      TKEEGGRHTPFFTNYRPQFYFRTTDVTGIV-KLPED-------------KEMVLPGDN-V
EFTU_MARMM       TKEEGGRHTPFFTNYRPQFYFRTTDVTGVV-TLNEG-------------TEMVMPGDN-I
EFTU_MAGMM       TKEEGGRHTPFFSNYRPQFYFRTTDVTGVL-KLPEG-------------VEMVMPGDN-I
EFTU_ANADF       TKEEGGRHTPFFNGYRPQFYFRTTDVTGSV-QLPAG-------------VEMVMPGDN-I
EFTU_STIAU       SKEEGGRHTPFFKGYRPQFYFRTTDVTGTV-KLPDN-------------VEMVMPGDN-I
EFTU_BDEBA       TKEEGGRHTPFFNGYRPQFYFRTTDVTGVC-TLKAG-------------TEMVMPGDK-I
EFTU_PELUB       KKDEGGRHTPFFTKYRPQFYFRTTDVTGEV-TLPAG-------------TEMVMPGDD-A
EFTU_CHLPD       RKEEGGRHTPFFNGYRPQFYFRTTDVTGSV-TLPEG-------------VEMVMPGDN-L
EFTU_GEOUR       TKEEGGRHTPFFNGYRPQFYFRTTDVTGIV-ELAAG-------------TEMVMPGDN-V
EFTU1_PELCD      TKEEGGRHTPFFNGYRPQFYFRTTDVTGIC-ELAEG-------------TEMVMPGDN-A
EFTU2_DESPS      GKDEGGRHTPFFNGYRPQFYFRTTDVTGVV-SLPEG-------------IEMVMPGDN-V
EFTU_FLESI       TKEEGGRHTPFFSGYRPQFYFRTTDVTGVI-TLAEG-------------VEMVMPGDN-I
EFTU_DESVH       SKEEGGRHTPFFSGYRPQFYFRTTDITGVI-TLEEG-------------VEMVMPGDN-A
EFTU_DESAG       SKEEGGRHTPFFSGYRPQFYFRTTDITGII-GLEEG-------------VEMVMPGDN-A
EFTU_LAWIP       SKEEGGRHTPFFSGYRPQFYCRTTDVTGVI-TLNEG-------------VEMVMPGDN-A
EFTU_SYNFM       KKEEGGRHTPFFPGYRPQFYFRTTDVTGIM-TLPEG-------------VEMVMPGDN-I
EFTU_SYNAS       TKEEGGRHTPFFTGYRPQFYFRTTDVTGVA-KLAEG-------------VEMVMPGDN-V
EFTU_EHRRG       KKEEGGRHTPFFSNYQPQFYVRTTDVTGNIKL-PDG-------------VEMVMPGDN-I
EFTU_ANAPZ       KKEEGGRHTPFFANYQPQFYVRTTDVTGSISL-PAG-------------VEMVMPGDN-L
EFTU2_WOLPM      KKEEGGRHTPFFANYQPQFYLRTTDVTGSIKL-LDG-------------KEMVMPGDN-V
EFTU1_ORITB      TKEEGGRHTPFFQNYRPQFYCRTTDVTGEIAL-LSG-------------KEMVMPGDH-A
EFTU_NEOSM       TKEEGGRRTGFVSGYKPQFYFRTTDVTGTAYLPVDG-------------AEIVMPGDD-L
EFTU_AYWBP       TKEEGGRHTAFFSQYRPQFYFRTTDITGVVEL-QGD-------------VKMVMPGDN-A
EFTU_APPPP       TQQEGGRHTAFFSNYRPQFYFRTTDVTGFIKL-KKD-------------VKMVLPGDR-T
EFTU_CARRP       SKEEGGRHTPFFKGYKPQFYFRTTDITGICDL-PKN-------------IEMVMPGDN-V
EFTU_SORC5       KKEEGGRHTPFFTNYRPQFYIRTTDVTGTVNLPEGV-------------K-MVMPGDN-I
EFTU_RHOBA       SKDEGGRHTPFFSGYRPQFYFRTTDVTGTANL-VGA-------------D-MCMPGDN-V
EFTU_BRAHO       KKEEGGRHSGFVSGYRPQMYFRTTDVTGVINLQGDA-------------Q-MIMPGDN-A
EFTU_TREDE       SKEEGGRHSPFFSGYRPQFYFRTTDITGTVNLPEGT-------------D-MVKPGDN-T
EFTU_TREPA       SKEEGGRHSPFFQGYRPQFYFRTTDITGTISLPEGV-------------D-MVKPGDN-T
EFTU_BORBU       TKEEGGRHKPFFPGYRPQFFFRTTDVTGVVAL-EGK-------------E-MVMPGDN-V
EFTU_LEPBL       TKDEGGRHTPFINNYRPQFYFRTTDVTGVCNL-PNG-------------VEMVMPGDN-V
EFTU_RUBXD       SKEEGGRHTPFFSHYRPQFYFRTTDVTGEIFL-EEG-------------VEMVMPGDN-T
EFTU2_PELTS      TKEEGGRHTPFFNGYRPQFYFRTTDVTGVV-KLPEG-------------VEMVMPGDN-V
EFTU_DESRM       TKEEGGRHTPFFNGYRPQFYFRTTDVTGIV-QLPEG-------------VEMVMPGDN-I
EFTU2_CARHZ      TKEEGGRHTPFFNGYRPQFYFRTTDVTGVI-HLPEG-------------VEMVMPGDN-V
EFTU1_SYNWW      TKEEGGRHTPFFGGYRPQFYFRTTDVTGII-QLPEG-------------VEMVMPGDN-V
EFTU_MOOTA       TKEEGGRHTPFFNGYRPQFYFRTTDVTGVV-NLPEG-------------VEMVMPGDN-I
EFTU2_CALS4      TKEEGGRHTPFFNGYRPQFYFRTTDVTGTI-QLPEG-------------VEMVMPGDH-V
EFTU_DESHY       SKEEGGRHTPFFNNYRPQFYFRTTDVTGVV-TLPEG-------------TEMVMPGDR-V
EFTU_CLOBM       KKEEGGRHTPFFNGYRPQFYFRTTDVTGSI-NLPEG-------------VEMVMPGDH-I
EFTU_CLOK5       KKEEGGRHTPFFNGYRPQFYFRTTDVTGSI-SLPEG-------------VEMVMPGDH-I
EFTU_CLOAB       KKEEGGRHTPFFNGYRPQFYFRTTDVTGSI-QLPDG-------------VEMVMPGDH-I
EFTU_CLOTE       KKEEGGRHTPFFNGYRPQFYFRTTDVTGSI-ALPEG-------------VEMVMPGDH-I
EFTU_CLONN       KKEEGGRHTPFFNGYRPQFYFRTTDVTGSI-ALPEG-------------VEMVMPGDH-I
EFTU_CLOPS       KKEEGGRHTPFFDGYRPQFYFRTTDVTGSI-KLPEG-------------MEMVMPGDH-I
EFTU_CLOB8       KKEEGGRHTPFFDGYRPQFYFRTTDVTGSI-KLPDG-------------MEMVMPGDH-I
EFTU_CALS8       TKEEGGRHTPFFNGYRPQFYFRTTDVTGTI-TLPEG-------------VEMCMPGDN-V
EFTU_SYMTH       TKEEGGRHSPFFNGYRPQFYFRTTDVTGTI-KLPEG-------------VEMVMPGDN-V
EFTU_HUNT2       TKEEGGRHTPFFNNYRPQFYFRTTDVTGVV-ELPQG-------------TEMVMPGDH-I
EFTU_ALKOO       KKEEGGRHTPFFDGYRPQFYFRTTDVTGAT-KLPDG-------------MEMVMPGDN-V
EFTU_CLOD6       KKEEGGRHTPFFDGYRPQFYFRTTDVTGAC-KLPEG-------------IEMVMPGDN-V
EFTU2_ALKMQ      KKEEGGRHTPFFDGYRPQFYFRTTDVTGSI-KLPEG-------------VEMVMPGDN-I
EFTU_LACP7       TKDEGGRHTPFFNNYRPQFYFRTTDVTGVC-NLPEG-------------VEMCMPGDN-I
EFTU_THEAQ       KKEEGGRHTGFFTGYRPQFYFRTTDVTGVV-RLPQG-------------VEMVMPGDN-V
EFTU_DEIGD       SKDEGGRHSAFFGGYRPQFYFRTTDVTGVV-ELPAG-------------VEMVMPGDN-V
EFTU_LACBA       SKEEGGRHTPFFSNYRPQFYFHTTDITGVI-ELPDG-------------VEMVMPGDN-V
EFTU_PEDPA       SKDEGGRHTPFFSNYRPQFYFHTTDVTGVI-ELPDN-------------VEMVMPGDN-V
EFTU_LACP3       TKEEGGRHTPFFSNYRPQFYFHTTDVTGVI-ELPDG-------------VEMVMPGDN-V
EFTU_LACRD       TKEEGGRHTPFFSNYRPQFYFHTTDVTGTI-ELPDG-------------VEMVMPGDN-V
EFTU_OENOB       TKEEGGRHTPFFTNYRPQFYFHTTDVTGVV-ELPEG-------------VEMVMPGDH-V
EFTU_LACS1       TKDEGGRHTPFFSNYRPQFYFHTTDVTGVI-ELPEG-------------VEMVMPGDN-V
EFTU_LACSS       SKDEGGRHTPFFSNYRPQFFFHTTDVTGVI-ELPEG-------------VEMVMPGDN-V
EFTU_LACJO       NKDEGGRHTPFFSDYRPQFYFHTTDVTGKI-ELPEG-------------TEMVMPGDN-V
EFTU_LACDA       SKDEGGRHTPFFSDYRPQFYFHTTDITGEI-ELPEG-------------TEMVMPGDN-T
EFTU_LEUMM       TKEEGGRHTPFFTNYRPQFYFHTTDVTGVV-ELPAG-------------VEMVMPGDQ-V
EFTU_STRMU       TKEEGGRHTPFFNNYRPQFYFRTTDVTGSI-ELPAG-------------TEMVMPGDN-V
EFTU_LACLS       SKEEGGRHTPFFDNYRPQFYFHTTDVTGSV-KLPEG-------------TEMVMPGDN-V
EFTU_GEOTN       TKEEGGRHTPFFSNYRPQFYFRTTDVTGII-TLPEG-------------VEMVMPGDN-V
EFTU_BACCN       SKEEGGRHTPFFANYRPQFYFRTTDVTGII-QLPEG-------------TEMVMPGDN-V
EFTU_BACSK       SKDEGGRHTPFFSNYRPQFYFRTTDVTGVV-HLPEG-------------TEMVMPGDN-T
EFTU_BACLD       SKEEGGRHTPFFSNYRPQFYFRTTDVTGII-QLPEG-------------VEMVMPGDN-I
EFTU_OCEIH       SKEEGGRHTPFFSNYRPQFYFRTTDVTGVI-ELPEG-------------TEMVMPGDN-I
EFTU_STAS1       SKDEGGRHTPFFTNYRPQFYFRTTDVTGVV-NLPEG-------------TEMVMPGDN-V
EFTU_ENTFA       SKEEGGRHTPFFTNYRPQFYFRTTDVTGVV-ELPEG-------------TEMVMPGDN-V
EFTU_LISIN       TKEEGGRHTPFFNNYRPQFYFRTTDVTGIV-TLPEG-------------TEMVMPGDN-I
EFTU_ACHLI       SKEEGGRHTAFFSNYRPQFYFRTTDITGII-TLGEG-------------TEMVMPGDN-A
EFTU_MYCGE       KKEEGGRHTGFLNGYRPQFYFRTTDVTGSI-ALAEN-------------TEMVLPGDN-A
EFTU_MYCGA       KKDEGGRHTAFLNGYRPQFYFRTTDVTGSI-QLKEG-------------TEMVMPGDN-T
EFTU_MYCPE       KKEEGGRHTPVLNGYRPQFYFRTTDVTGQI-TLDKG-------------VEMINPGDN-T
EFTU_UREP2       KKEEGGRHTPIVSGYRPQFYFRTTDVTGAI-SLPAG-------------VDLVMPGDD-V
EFTU_MYCPU       KKEEGGRHTPFFSNYKPQFYFRTTDVTGGV-VFPAG-------------REMVMPGDN-V
EFTU_MYCHJ       KKEEGGRHTPFFKNYKPQFYFRTTDVTGGI-EFEPG-------------REMVIPGDN-V
EFTU_MYCMO       KKEEGGRHTPFFKNYKPQFYFRTTDVTGGI-ELPNN-------------IEMVTPGDN-V
EFTU_MYCS5       KKEEGGRHTPFFKNYKPQFYFRTTDVTGGV-EFEAG-------------REMVMPGEN-V
EFTU_MYCMS       TQEEGGRHKPFFNKYRPQFYFRTTDVTGEV-TLPEG-------------TDMVMPGDN-V
EFTU_MESFL       TTEEGGRQKPFFNKYRPQFYFRTTDVTGEV-ILPAG-------------TDMVMPGDN-V
EFTU_THEMA       KKEEGGRHTPFTKGYKPQFYIRTADVTGEIVGLPEG-------------VEMVMPGDH-V
EFTU_FERIS       KKEEGGRHTPFTKGYKPQFYIRTADVTGEIVDLPAG-------------VEMVMPGDN-V
EFTU_THEM4       KKEEGGRHTPFQKGYKPQFFIRTADVTGELIEFPAG-------------VEMVMPGDN-V
EFTU_PSELT       KKEEGGRHTPFMKGYRPQFFIRTADVTGEITELGNN-------------AEMVMPGDN-A
EFTU_PETMO       KKEEGGRHTPFTKGYRPQFYIRTADVTGTLVEFSSG-------------AEMVMPGDN-I
EFTU_AQUPY       SKEEGGRHTPFFVNYRPQFYFRTADVTGTVVKLPEG-------------VEMVMPGDN-V
EFTU2_ROSCS      KKEEGGRHTPFFPGYRPQFYIRTTDVTGAI-SLPAG-------------VEMVMPGDN-I
EFTU_CHLAA       KKEEGGRHTPFFSGYRPQFYIRTTDVTGAI-GLPAG-------------MEMVMPGDN-V
EFTU_HERAU       KKEEGGRHSPFFSGYRPQFYVRTTDVTGAI-GLPEG-------------VEMVMPGDN-I
EFTU_DEHM1       SKDEGGRHTPFFNGYKPQFFFGTTDVTGEI-HLPEG-------------VEMVVPGDH-V
EFTU_STRCJ       SKDEGGRHTPFFNNYRPQFYFRTTDVTGVV-TLKEG-------------TEMVMPGDN-A
EFTU2_STRRA      SKDEGGRHTPFFENYRPQFYFRTTDVTGVV-TLPKG-------------TEMVMPGDN-T
EFTU_PLARO       SKDEGGRHTPFFNNYRPQFYFRTTDVTGVV-NLPEG-------------TEMVMPGDN-T
EFTU_THEFY       SKDEGGRHTPFFNNYRPQFYFRTTDVTGVV-TLPEG-------------TEMVMPGDN-T
EFTU_FRACC       NKDEGGRHTPFFKNYRPQFYFRTTDVTGVV-TLPEG-------------TEMVMPGDN-T
EFTU_KINRD       SKDEGGRHTPFYNNYRPQFYFRTTDVTGVV-SLPEG-------------TEMVMPGDN-T
EFTU_SALAI       SKEEGGRHTPFFQNYRPQFYFRTTDVTGVV-TLPEG-------------TEMVMPGDN-T
EFTU_NOCSJ       SKEEGGRHTPFFNNYRPQFYFRTTDVTGVV-TLPEG-------------TEMVMPGDN-T
EFTU_SACEN       SKDEGGRHTPFFNNYRPQFYFRTTDVTGVV-TLPEG-------------TEMVMPGDN-T
EFTU_RHOJR       SKDEGGRHTPFFNNYRPQFYFRTTDVTGVV-TLPEG-------------TEMVMPGDN-T
EFTU_CORDI       SKDEGGRHTPFFDNYRPQFYFRTTDVTGVV-KLPEG-------------TEMVMPGDN-V
EFTU_CORJK       SKDEGGRHTPFFDNYRPQFYFRTTDVTGVV-KLPEG-------------TEMVMPGDN-V
EFTU_ACIC1       SKDEGGRHTPFFNNYRPQFYFRTTDVTGVV-HLPEG-------------TEMVMPGDN-T
EFTU_CUTAK       KKDEGGRHKPFFSHYSPQFYFRTTDVTGTV-ELPEG-------------TEMVMPGDN-T
EFTU_TROW8       SKDEGGRHNPFYSNYRPQFYFRTTDVTGVI-TLPEG-------------TEMVMPGDT-I
EFTU_LEIXX       SKDEGGRNNPIYTNYRPQFYFRTTDVTGVI-SLTEG-------------TEMVMPGDT-T
EFTU_MICLU       SKDEGGRHTPFYSNYRAQFYFRTTDVTGVI-TLPEG-------------TEMVMPGDT-T
EFTU_BRELN       SKDEGGRHNPFYSNYRPQFYFRTTDVTGVI-TLPEG-------------TEMVMPGDN-T
EFTU_BIFAA       TKDEGGRHSPFFSNYRPQFYFRTTDVTGVI-TLPEG-------------VEMVQPGDH-A
EFTU3_STRRA      SAREGGRTTPVTSGYRPQFYIRTADVVGDV-DLGE--------------VGVARPGET-V
EFTU_PAROE       SKEEGGRHTPFFNNYRPQFYFRTTDVTGII-SLAEG-------------VEMVMPGDN-V
EFTU_CYTH3       SKEEGGRHTPFFNKYRPQFYMRTTDVTGEI-ELPAG-------------TEMVMPGDN-I
EFTU_PARD8       KKEEGGRHTPFHNKYRPQFYIRTLDVTGEI-TLPEG-------------TEMVMPGDN-V
EFTU_CELLY       KKEEGGRHTPFHNNYRPQFYVRTTDVTGTI-SLPSG-------------VEMVMPGDN-L
EFTU_GRAFK       KKEEGGRHTPFHNNYRPQFYVRTTDVTGTI-SLPDG-------------VEMVMPGDN-L
EFTU_FLAPJ       KKEEGGRHTPFHNNYRPQFYVRTTDVTGVI-MLPTG-------------VEMVMPGDN-L
EFTU_SULMW       KKEEGGRHTPFHNKYKPQFYLRTTDVTGTI-YLLNN-------------LEMVMPGDN-I
EFTU_TERFE       SKDEGGRHTPFFNKYRPQFYFRTTDVTGEV-ELNAG-------------TEMVMPGDN-T
EFTU_SALRD       SKEEGGRHTPFFDGYQPQFYFRTTDVTGSI-ELPEG-------------VEMVMPGDN-A
EFTU_SOLUE       SKEEGGRHTPFFKGYRPQFYFRTTDVTGVA-QLPEG-------------TEMVMPGDN-V
EFTU_KORVE       SKEEGGRHTPFFKGYRPQFYFRTTDVTGVA-TLPAG-------------TEMVMPGDN-V
EFTU_CHLPN       QKEEGGRHKPFFSGYRPQFFFRTTDVTGVV-TLPEG-------------TEMVMPGDN-V
EFTU_PARUW       TKEEGGRHKPFFSGYRPQLYFRTTDVTGTI-ELPAG-------------VEMVMPGDN-V
EFTU_TRIV2       TEKEGGRKTPFFAGYRPQFYVRTTDVTGTIKAFTSDE---------GEAVEMVMPGDR-I
EFTU_THEEB       TEKEGGRKTPFFAGYRPQFYVRTTDVTGTITSFTSDD---------GSAAEMVMPGDR-I
EFTU_MICAN       SKEEGGRHTPFFKNYRPQFYVRTTDVTGTIQDYTADD---------GSTVEMVMPGDR-I
EFTU_SYNJA       KKEEGGRHTPFFAGYRPQFYVRTTDVTGTITSFTADD---------GSKPEMVMPGDR-V
EFTU_GLOVI       SKEEGGRHTPFFAGYRPQFYVRTTDVTGTIVTFTDDE---------GKSAEMVMPGDR-I
EFTU_SYNE7       KKEEGGRHTPFFPGYRPQFYVRTTDVTGAISDFTADD---------GSAAEMVIPGDR-I
EFTU_ACAM1       KKDEGGRHTPFFPGYRPQFYVRTTDVTGTISAFTADD---------GSAAEMVMPGDR-I
EFTU_TRIEI       KKEEGGRHTPFFPNYRPQFYIRTTDVTGAIESFTADD---------GSVAEMVMPGDR-I
EFTU_SYNY3       KKEEGGRHTPFFANYRPQFYVRTTDVTGTIKSYTADD---------GSAVEMVMPGDR-I
EFTU_ARTPT       KKEEGGRHTPFFKGYRPQFYVRTTDVTGTIDEFTADD---------GSTPEMVIPGDR-I
EFTU_CYAM1       TKEEGGRHTPFFPGYRPQFYVRTTDVTGTIEDFTADD---------GSKAEMVMPGDR-I
EFTU_CYACA       NKEEGGRHTPFFPGYRPQFYVRTTDVTGNISQFTTDD---------GGSAEMVLPGDR-I
EFTU_EMIHU       GKDEGGRHTPFFTGYRPQFYVRTIDVTGTIVQFTGDD---------GSAAEMVMPGDR-I
EFTU_GUITH       TKEEGGRHTPFFSGYRPQFYVRTTDVTGTIAQFTSDD---------GSTAEMVMPGDR-I
EFTU_GRATL       TKEEGGRHTPFFSGYRPQFYVRTTDVTGTITQFTADD---------GSAAEMVMPGDR-I
EFTU_CYAPA       TKDEGGRHTPFFSGYRPQFYVRTTDVTGSIDAFTADD---------GSNAEMVMPGDR-I
EFTU_CYCME       TKEEGGRHTPFFTGYSPIFYVITTDVTGSIDQFTADD---------GSIVEMVMPGDR-I
EFTU_PHATC       TKDEGGRHTPFFTGYRPQFYVRTTDVTGSITQFTADD---------GSVVEMVMPGDR-I
EFTU_TRICV       TKDEGGRHTPFFTGYRPQFYVRTTDVTGAITQFTADD---------GSIVEMVMPGDR-I
EFTU_PROM1       KKEEGGRHTPFFAGYRPQFYIRTTDVTGQITAFTSDD---------GSNVEMVMPGDR-I
EFTU_CHACO       RKEEGGRHSPFFAGYRPQFFVRTADVTGVIEAFEYDN---------GDKTRMVMPGDR-V
EFTU_COLOB       RREEGGRRSPFFQGYCPQFYFRTIQITGRMESFEYEI---------GGKTWMVMPGEK-I
EFTU_TOXGO       TVAEGGREKPIFEGYCPQFYLYTINITGSIK--FSSET-------KETGTKMILPGDR-V
EFTU_EIMTE       SSSEGGRKKPFFEGYKPQFYFYTTDVTGTIE--FLRNP-------EKP--EMILPGDK-V
EFTU_THEPA       TSKEGGRTNPFKIGYKPQFFIRTLDITGEIKKLYSTTN-------ENNTLELAIPGDN-I
EFTU_PLAF7       TKEEGGRHKPFNIGYKPQFFIRTVDVTGEIKNIYLNE----------NVQKVAIPGDK-I
                    ***  . .   * . ::  * ::.*                       :  .*:   

EFTU_OLTVI       KMLVELINPIAVEKGMRFAIREGGRTVGAGVVSEILA-------------------
EFTU_TUPAK       KMVVELIQPIAVENGMRFAIREGGRTVGAGVVSTILK-------------------
EFTU_NEPOL       KMVVELIQPIAIEKGMRFAIREGGRTVGAGVVSNIIA-------------------
EFTU_OSTTA       KMVVELIQPIAIENGMRFAIREGGRTVGAGVVSSILK-------------------
EFTU_CHLVU       KMIVELIQPIAIEKGMRFAIREGGRTVGAGVVSTIVI-------------------
EFTU_PLETE       KMEVELIQPIAIEKGMRFAIREGGRTVGAGVVSAIVL-------------------
EFTU_PROWI       KMKAELIQPIAIERNMRFAIREGGKTVGAGVVGKILK-------------------
EFTU_CHLAT       KMVVQLIQPIAIEKGMRFAIREGGRTVGAGVVFNILE-------------------
EFTU_MESVI       KMVVSLIQPIAIEKGMRFAIREGGRTVGAGIVSEILE-------------------
EFTU_EUGGR       KMKVELIQPIAIEKGMRFAIREGGRTVGAGVVLSIIQ-------------------
EFTU_EUGLO       KMIVELVQPIAIEKGMRFAIREGGKTVGAGVIINIID-------------------
EFTU_BIGNA       TMSVELVQPIAIEKGMRFAIREGGRTVGAGVVSNVVS-------------------
EFTU_HELSJ       TMSVKLIQPIALEKNMRFAIREGGKTVGAGVVSKLIN-------------------
EFTU_CODFR       QMEVELIRPIAIETRMRFAIREGGKTVGAGVVTTIVQA------------------
EFTU_TETOB       EVTVQLIYPVAVEKGMRFAIREGGRTVGAGVVTNILEE------------------
EFTU_CHLRE       SMTVELINPIAIEKGMRFAIREGGRTVGAGVVTNIVQ-------------------
EFTU_STIHE       NMKIQLITPIAIEKGMRFAIREGGRTVGAGMVLEILES------------------
EFTU1_ECOLI      KMVVTLIHPIAMDDGLRFAIREGGRTVGAGVVAKVLG-------------------
EFTU1_YERE8      QMIVNLIAPIAMDDGLRFAIREGGRTVGAGVVAKVIE-------------------
EFTU_HAEDU       KMTVSLIHPIAMDEGLRFAIREGGRTVGAGVVAKIIK-------------------
EFTU_BUCBP       KMVITLIHPIAMSDGLRFAIREGGKTVGAGIVVKVLQ-------------------
EFTU_BUCAI       KMTVTLINPIAMADGLRFAIREGGRTVGAGVVSKVLL-------------------
EFTU_BUCCC       NMVVTLIHPIAMAEGLRFAIREGGRTVGAGVVTKVIA-------------------
EFTU_AERS4       KMVVTLIAPIAMDDGLRFAIREGGRTVGAGVVASVIA-------------------
EFTU2_PSEHT      KMTVTLIAPIAMDEGLRFAIREGGRTVGAGVVANIVA-------------------
EFTU1_PHOPR      AMTVTLIAPIAMDEGLRFAIREGGRTVGAGVVATIIA-------------------
EFTU_PSEA6       KFVVELIAPIAMDEGLRFAIREGGRTVGAGVVAKIIA-------------------
EFTU_PSYIN       KFVVDLIGPVAMDEGLRFAIREGGRTVGAGVVSKIIE-------------------
EFTU_COLP3       KFVVELINPVAMDEGLRFAIREGGRTVGAGVVSKIMA-------------------
EFTU_SHEAM       KMVVTLICPIAMDEGLRFAIREGGRTVGAGVVAKIHE-------------------
EFTU_BLOPB       RMIVHLIAPIAMDDGLRFAIREGGRTIGAGIVSKIIS-------------------
EFTU_BLOFL       KMVVHLISPIAMDDGLRFAIREGGRTVGAGVVSRVIS-------------------
EFTU_BAUCH       KMIVNLIAPIAMDQGLRFAIREGGRTVGAGIVTDIIE-------------------
EFTU_WIGBR       KMLVKLISPIAMDDGLRFAIREGGKTVGAGIVSKIIV-------------------
EFTU_PSYA2       EMGVELIHPIAMDKGLRFAIREGGRTVGAGVVANVHV-------------------
EFTU_ACIAD       EMSVELIHPIAMDPGLRFAIREGGRTVGAGVVAKVTA-------------------
EFTU_NEIGO       TITVELIAPIAMEEGLRFAIREGGRTVGAGVVSSVIA-------------------
EFTU_CHRVO       EIKVELIAPIAMEEGLRFAIREGGRTVGAGVVAKIIA-------------------
EFTU_NITMU       SVTVNLIAPIAMEEGLRFAIREGGRTVGAGVVAKIIE-------------------
EFTU1_METFK      SISVSLIAPIAMEEGLRFAIREGGRTVGAGVVAKIIE-------------------
EFTU_THIDA       SIKVSLIQPIAMDEGLRFAIREGGRTVGAGVVAKIEE-------------------
EFTU_DECAR       AMTIKLIAPIAMEEGLRFAIREGGRTVGAGVVAKIIE-------------------
EFTU_HERAR       SITVMLINPIAMEEGLRFAIREGGRTVGAGVVAKIIE-------------------
EFTU_POLAQ       TITVKLIAPIAMEEGLRFAIREGGRTVGAGVVAKILA-------------------
EFTU2_RHOFT      SIIVKLINPIAMEEGLRFAIREGGKTVGAGVVAKVIA-------------------
EFTU_BORA1       TMTVKLLAPIAMEEGLRFAIREGGRTVGAGVVAKILK-------------------
EFTU1_XANCB      KMVVTLINPVAMDEGLRFAIREGGRTVGAGVVAKIVK-------------------
EFTU_XYLFT       KVTVSLINPVAMGEGQRFAIREGGRTVGAGVVSKVIG-------------------
EFTU_METCA       KIEVKLIAPIAMDEGLRFAVREGGRTVGAGVVSKIIE-------------------
EFTU_DICNV       KMIVQLIHPIAMDEGLRFAIREGGRTVGAGVVAKIIE-------------------
EFTU_PSEA7       KMVVTLIAPIAMEDGLRFAIREGGRTVGAGVVAKIIE-------------------
EFTU_PSEF5       QMTVTLIKTIAMEDGLRFAIREGGRTVGAGVVAKVIE-------------------
EFTU_HAHCH       KMKVSLIAPIAMEEGLRFAIREGGRTVGAGVVAKIFE-------------------
EFTU_SACD2       QMTVTLIAPIAMEEGLRFAIREGGRTVGAGVVAKIIA-------------------
EFTU_MARMS       QMTVELIHPIAMDEGLRFAIREGGRTVGAGVVAKILK-------------------
EFTU_CHRSD       KMTVTLIAPIAMEDGLRFAVREGGRTVGAGVVAKIVQ-------------------
EFTU_ALCBS       QMDVELIAPIAMEDGLRFAIREGGRTVGAGVVAKITE-------------------
EFTU_LEGPL       QLVVSLHAPIAMDEGLRFAIREGGRTVGAGVVAKIIE-------------------
EFTU1_HALHL      KMTVQLIAPIAMEDGLRFAIREGGRTVGAGVVSKIIE-------------------
EFTU_ALKEH       KMTVSLIAPIAMEDGLRFAVREGGRTVGAGVVSKIIE-------------------
EFTU_COXBU       KVTVELIAPVAMDEGLRFAVREGGRTVGAGVVTKIIE-------------------
EFTU_NITOC       QMTVSLIAPIAMEEGLRFAVREGGRTVGAGVVSKVIE-------------------
EFTU_VESOH       KMRVELLSPIAMEDGLRFAIREGGRTVGAGVVSKVTD-------------------
EFTU_HYDCU       QMTVELINPIAMNEGLRFAIREGGRTVGAGVVAKIID-------------------
EFTU_FRAP2       KMTITLINPIAMDEGLRFAIREGGRTVGAGVVAKIIE-------------------
EFTU_FUSNN       TMTVELIHPIAMEQGLRFAIREGGRTVASGVVSEITK-------------------
EFTU_CAMJD       RITVSLIAPVALEEGTRFAIREGGKTVGSGVVSKIIK-------------------
EFTU_CAMHC       KITVELIHPIALEQGTRFAIREGGHTVGSGVVSKILG-------------------
EFTU_HELAH       KITVELINSIALELGTKFAIREGGRTVGAGVVSNIIE-------------------
EFTU_WOLSU       KINVELIAPVALEEGTRFAIREGGRTVGAGVVTKITK-------------------
EFTU_NITSB       KINAELIAPIALEEGTRFAIREGGRTVGAGVVSKIIE-------------------
EFTU_ARCB4       EMTVELVAPIALDKGTKFAIREGGRTVGAGVVAEIIA-------------------
EFTU_SULNB       KINVELIAPIALDEGTRFAIREGGRTVGAGVVSKIIA-------------------
EFTU_SULDN       SITVELIHPIAMEKGTKFAIREGGRTVGAGVVAEILA-------------------
EFTU_RICAH       TFTVELIKPIAMQQGSKFSIREGGKTVGAGVVTKINN-------------------
EFTU_RICBR       TFKVKLISPIAMQQGLKFSIREGGRTVGAGVVSKVIN-------------------
EFTU_MAGSA       KMIVTLIAPIAMDQGLRFAIREGGRTVGAGVVAKIIK-------------------
EFTU_PARL1       KMNVTLIAPIAMEEKLRFAIREGGRTVGAGVVSKVLK-------------------
EFTU_GLUOX       AMDVELIAPIAMDEGLRFAIREGGRTVGAGVVSSITA-------------------
EFTU_AZOC5       SVDVQLIVPIAMEEKLRFAIREGGRTVGAGVVASIIE-------------------
EFTU1_RHORT      GMTVQLIAPIAMDEGLRFAIREGGRTVGAGVVASIVQ-------------------
EFTU_ACICJ       TVSVELIAPIAMDEGLRFAIREGGRTVGSGVVASITK-------------------
EFTU_NOVAD       TLAVKLIAPIAMDEGLRFAIREGGRTVGSGVVSKITK-------------------
EFTU_ERYLH       TINVKLIAPIAMDEGLRFAIREGGRTVGSGVVSKITV-------------------
EFTU_SPHAL       QLSVKLIAPIAMDPGLRFAIREGGRTVGAGVVATVTK-------------------
EFTU_ZYMMO       AFGVKLIAPIAMDPGLRFAIREGGRTVGAGVVSSIIK-------------------
EFTU_SPHWW       KLGVKLIAPIAMEEGLRFSIREGGRTVGAGVVSSISK-------------------
EFTU_RHIL3       TVSVELIVPIAMEEKLRFAIREGGRTVGAGIVASIVE-------------------
EFTU_RHILO       TVDVELIVPIAMEEKLRFAIREGGRTVGAGIVVTIKE-------------------
EFTU_JANSC       KFEVELIAPIAMEDGLRFAIREGGRTVGAGVVAKIIE-------------------
EFTU_ROSDO       SFGVELIAPIAMEQGLRFAIREGGRTVGAGVVSKITE-------------------
EFTU_RHOS5       KFNVELIAPIAMEEKLRFAIREGGRTVGAGVVSKIIA-------------------
EFTU_PARDP       KFEVELIAPIAMEEKLRFAIREGGRTVGAGVVSKILK-------------------
EFTU_CAUVC       ELDVELITPIAMEEKLRFAIREGGRTVGAGVVAKIVE-------------------
EFTU1_HYPNA      KMDVELINPIAMDKGLRFAIREGGRTVGAGVVSEIKK-------------------
EFTU_MARMM       EMNVELIVPIAMEEKLRFAIREGGRTVGAGVVSKIIE-------------------
EFTU_MAGMM       TMEVELIAPIAMEKGLRFAIREGGRTVGAGVVAEVID-------------------
EFTU_ANADF       GMEVELITPIAMEKELRFAIREGGRTVGAGVVAEVIQ-------------------
EFTU_STIAU       AIEVELITPVAMEKELPFAIREGGRTVGAGVVADIIA-------------------
EFTU_BDEBA       EVSVELIAPIAMEKELRFAIREGGRTVGAGVVTEILE-------------------
EFTU_PELUB       KFTVTLITPIAMSEKLNFAIREGGRTVGAGVVTKIIE-------------------
EFTU_CHLPD       SVDVELIVPIAMDENLRFAIREGGRTVGAGSVTKIIE-------------------
EFTU_GEOUR       AVTVNLITPIAMDEGLRFAIREGGRTVGAGVVSSIIE-------------------
EFTU1_PELCD      SMTVNLITPIAMDKELRFAIREGGRTVGAGVVSEVIE-------------------
EFTU2_DESPS      SVDATLITPIAMDAGLRFAIREGGRTVGAGVISEIIE-------------------
EFTU_FLESI       SCDVDLIQPIAMEQGLRFAIREGGRTVGAGVVTEIVE-------------------
EFTU_DESVH       TFNVELIAPIAMELGLRFAIREGGRTVGAGVVSEIVE-------------------
EFTU_DESAG       TFIVELIHPVAMEQGLRFAIREGGRTVGAGVVSEILE-------------------
EFTU_LAWIP       TFNVELIYPIAMEQGLRFAIREGGRTVGAGVVTEIVE-------------------
EFTU_SYNFM       STEVHLITPVALEKELRFAIREGGRTVGAGVITEIIE-------------------
EFTU_SYNAS       EMEVTLITPIAMEEQLRFAIREGGRTVGAGVVSKVIE-------------------
EFTU_EHRRG       SIEVNLDKPVAIDKGLRFAIREGGRTIGSGIITEILE-------------------
EFTU_ANAPZ       SIEVALDKPVAIDKGLRFAVREGGRTVGSGIITEILE-------------------
EFTU2_WOLPM      SVEVELQVPIAMDKGLRFAIREGGRTVGSGVVSEILE-------------------
EFTU1_ORITB      TLSVNLVAPIAMDQGLSFAIREGGKTIGAGKVSKIIK-------------------
EFTU_NEOSM       EIFVELLNPIAMEKGSRFAIREGGVTVGAGQVLEIMDSKTDAEIAKMFKIVRAVKN
EFTU_AYWBP       ELVVTLNNPIAIEEGTKFSIREGGKTVGAGSVSKLLN-------------------
EFTU_APPPP       ELIVELNHPIAIEAGTKFSIREGGRTIGAGTVTEIIE-------------------
EFTU_CARRP       KLIVKLLSSIAIEKGLRFAIREGGKTVGAGIITEVLND------------------
EFTU_SORC5       TMTIELIAPVALEEQMRFAIREGGKTVGAGVVTKILA-------------------
EFTU_RHOBA       KVEVELHKPIAMDDGVRFAIREGGRTVGSGVVTKILE-------------------
EFTU_BRAHO       NLTIELITPIAMEEKQRFAIREGGKTVGNGVVTKNIRII-----------------
EFTU_TREDE       KIIGELIHPIAMDQGLKLAIREGGRTIASGQVTNIIE-------------------
EFTU_TREPA       KIIGELIHPIAMDKGLKLAIREGGRTIASGQVTEILL-------------------
EFTU_BORBU       DIIVELISSIAMDKNVEFAVREGGRTVASGRILEILE-------------------
EFTU_LEPBL       SLTVELISPIAMDKGLKFAIREGGRTIGSGVVVDIIE-------------------
EFTU_RUBXD       VMEVQLISPIAMDEGLNFAIREGGRTVGAGVVTQIIE-------------------
EFTU2_PELTS      RIDIDLITPIAIEEGLRFAIREGGRTVGAGVVTGIRE-------------------
EFTU_DESRM       KVDVDLITPIAIEEGLRFAIREGGRTVGAGVVTGIRE-------------------
EFTU2_CARHZ      KIHIELITPIAIEEGLRFAIREGGRTVGAGVVTAIEE-------------------
EFTU1_SYNWW      QMAIELITPIAIEEGLRFAIREGGRTVGAGVVTSLNE-------------------
EFTU_MOOTA       RMTIELITPIAIEEGLRFAIREGGRTVGAGVVTGIIE-------------------
EFTU2_CALS4      TLRVELITPIAMEEGLKFAIREGGRTVGAGVVSAIIE-------------------
EFTU_DESHY       TITCEIISPIAMEEGLRFAIREGGRTVGAGVVVSIIE-------------------
EFTU_CLOBM       DMAVELITPVAMHENLRFAIREGGRTVGSGVVTTISE-------------------
EFTU_CLOK5       DMNVELITPVAMHEGLRFAIREGGRTVGSGVVTTVSE-------------------
EFTU_CLOAB       DMTVELITKVAMGDNLRFAIREGGRTVGSGVVTSIIE-------------------
EFTU_CLOTE       DMKVELITRVAMDEGLRFAIREGGRTVGSGVVSEITE-------------------
EFTU_CLONN       DMNVELITPVAMENNLRFAIREGGRTVGSGVVTSIVE-------------------
EFTU_CLOPS       DMEVELITEIAMDEGLRFAIREGGRTVGSGVVTSIIE-------------------
EFTU_CLOB8       DMNVELITPIAMDEGLRFAIREGGRTVGSGVVTKIVE-------------------
EFTU_CALS8       EMTVELISPIAIESGLRFAIREGGRTVGAGSVTTIIE-------------------
EFTU_SYMTH       EIAVELIHPIAIEEGLRFAVREGGRTVASGRVTKVSE-------------------
EFTU_HUNT2       TMKVKLITPVAMEEGLKFAIREGGRTVGAGNVSKIIE-------------------
EFTU_ALKOO       TMEIDLIHPIAIEEGLRFAIREGGRTVGSGVVASIIE-------------------
EFTU_CLOD6       TMEVDLINSIVVEEGLRFSIREGGRTVASGVVATIIE-------------------
EFTU2_ALKMQ      TMEIELISPIATEEGLRFAIREGGRTVGAGVVASIIE-------------------
EFTU_LACP7       EMNIELIHPIAMEQGLGFAIREGGRTVGSGKVATIIG-------------------
EFTU_THEAQ       TFTVELIKPVALEEGLRFAIREGGRTVGAGVVTKILE-------------------
EFTU_DEIGD       SFTVELIKPIAMEEGLRFAIREGGRTVGAGVVTKVLE-------------------
EFTU_LACBA       TFTVELIQPAAIEKGTKFTVREGGHTVGAGTVTEIDD-------------------
EFTU_PEDPA       TFTVELIEPVAIEKGTKFTVREGGHTVGAGVVSEIDD-------------------
EFTU_LACP3       TFEVDLIAPVAIEKGTKFTVREGGRTVGAGVVSEILD-------------------
EFTU_LACRD       TFTVNLQKPVALEKGLKFTIREGGHTVGAGVVSDILD-------------------
EFTU_OENOB       TFTVELMKPVAIEKGLKFTIREGGHTVGAGTVSEIDD-------------------
EFTU_LACS1       TFTVELIAPVAIEKGLKFTVREGGRTVGAGVVSEIDD-------------------
EFTU_LACSS       TFTVELISPVAIEKGLKFTVREGGRTVGAGVVSEIID-------------------
EFTU_LACJO       EFTVELIKPVAIEKGTKFTIREGGKTVGAGQVTEILD-------------------
EFTU_LACDA       EFSVTLIKPAAIEVGTKFTIREGGRTVGAGQVTEIDD-------------------
EFTU_LEUMM       TFEIELISPVAIEQGLKFTVREGGHTVGAGTVTDIED-------------------
EFTU_STRMU       TIDVELIHPIAVEQGTTFSIREGGRTVGSGIVSEIEA-------------------
EFTU_LACLS       HIDVELIHPVAIEQGTTFSIREGGRTVGSGIVAEIKA-------------------
EFTU_GEOTN       EMTVELIAPIAIEEGTKFSIREGGRTVGAGSVSEIIE-------------------
EFTU_BACCN       EMTVELIAPVAVEEGTKFSIREGGRTVGAGVVASIIE-------------------
EFTU_BACSK       EMTVELIAPIAIEEGTRFSIREGGRTVGSGVVSTITE-------------------
EFTU_BACLD       EMTVELISTIAIEDGTRFSIREGGRTVGSGVVSSIIE-------------------
EFTU_OCEIH       EMTVELISPIAIEDGTRFSIREGGRTVGSGVVSSIQK-------------------
EFTU_STAS1       EMDVELISPIAIEDGTRFSIREGGRTVGSGVVTVINE-------------------
EFTU_ENTFA       AMDVELIHPIAIEDGTRFSIREGGRTVGSGVVTEIVK-------------------
EFTU_LISIN       ELAVELIAPIAIEDGTKFSIREGGRTVGAGVVSNISK-------------------
EFTU_ACHLI       EVTVELIHPIALEEGTKFSIREGGRTVASGSVVKILAD------------------
EFTU_MYCGE       SITVELIAPIACEKGSKFSIREGGRTVGAGTVTEVLE-------------------
EFTU_MYCGA       EIIVELISSIACEKGSKFSIREGGRTVGAGTVVEVLE-------------------
EFTU_MYCPE       KITVELISPIAVEEGSKFSIREGGRTVGAGTVTKVIK-------------------
EFTU_UREP2       EMTVELIAPVAIEDGSKFSIREGGKTVGHGSVIKTSN-------------------
EFTU_MYCPU       DLVVELISPIAVEEGTKFSIREGGRTVGAGSVTKILK-------------------
EFTU_MYCHJ       DLTVELIAPIAVEQGTKFSIREGGRTVGAGTVTEIIK-------------------
EFTU_MYCMO       DLIVDLISPIAVEVGTKFSIREGGRTVGAGSVTEIVK-------------------
EFTU_MYCS5       NLKVKLISPIAVEEGTKFSIREGGRTVGAGSVTKIVK-------------------
EFTU_MYCMS       EMEIQLIKPVAVEEGTKFSIREGGRTIGAGTVISIEK-------------------
EFTU_MESFL       EMTVELIKPIAVEDGTKFSIREGGRTIGAGTVISVQ--------------------
EFTU_THEMA       EMEIELIYPVAIEKGQRFAVREGGRTVGAGVVTEVIE-------------------
EFTU_FERIS       EMTIELIYPVAIEKGMRFAVREGGRTVGAGVVSEIIE-------------------
EFTU_THEM4       EMTIKLIYPVAIEEGMRFAIREGGRTVGAGVVTAIVE-------------------
EFTU_PSELT       ILTIKLIYPVAIEKGMRFAIREGGRTVGAGVVAEIVE-------------------
EFTU_PETMO       NMTVELIYPVALEEGMRFAIREGGRTVGAGVVTEIIE-------------------
EFTU_AQUPY       ELEVELIAPVALEEGLRFAIREGGRTVGAGVVTKILD-------------------
EFTU2_ROSCS      EMLVELIVPVAIEEGLRFAIREGGRTVGAGVVSAIVD-------------------
EFTU_CHLAA       VMTIELIVPVAIEEGLRFAIREGGRTVGAGVVTKILD-------------------
EFTU_HERAU       QMTVELIVPVAIEQGLKFAIREGGRTVGAGIVPEIIA-------------------
EFTU_DEHM1       KMKISTIYPVAMEKGMRFAIREGGKTVGAGAISQVLS-------------------
EFTU_STRCJ       EMTVNLIQPVAMEEGLRFTIREGGRTVGAGQVVKINK-------------------
EFTU2_STRRA      AMHVQLIQPIAMEEGLKFAIREGGRTVGAGQVTRIVK-------------------
EFTU_PLARO       EMTVQLIQPIAMEEGLKFAIREGGRTVGAGRVTKILK-------------------
EFTU_THEFY       SMTVKLIQPVAMEEGLKFAIREGGRTVGAGRVTKIIK-------------------
EFTU_FRACC       EMTVELIQPIAMEEGLRFAIREGGRTVGAGQVTKVLK-------------------
EFTU_KINRD       EMKVDLIQPIAMEEGLKFAIREGGRTVGAGRVVKILK-------------------
EFTU_SALAI       TMTVKLIQPIAMEENLKFAIREGGRTVGAGRVTKIIK-------------------
EFTU_NOCSJ       EMAVELIQPIAMDEGLRFAIREGGRTVGAGRVTKITK-------------------
EFTU_SACEN       EMSVQLIQPIAMDEGLRFAIREGGRTVGAGRVTKIHK-------------------
EFTU_RHOJR       EMSVKLIQPVAMDEGLRFAIREGGRTVGAGKVTKINK-------------------
EFTU_CORDI       DMSVTLIQPVAMDEGLRFAIREGSRTVGAGRVTKIIK-------------------
EFTU_CORJK       DMSVTLIQPVAMDEGLRFAIREGGRTVGAGRVTKINK-------------------
EFTU_ACIC1       EMRVELIQPIAMEEGLRFAIREGGRTVGAGRVTKILK-------------------
EFTU_CUTAK       DMTVHLIHPVAMEDQLKFAIREGGRTVGAGRVTKIIK-------------------
EFTU_TROW8       SITVDLIQPIAMEEGLGFAIREGGRTVGAGTVVKILE-------------------
EFTU_LEIXX       DMTVELIQPIAMEEGLGFAIREGGRTVGAGKVTKIIN-------------------
EFTU_MICLU       EMSVELIQPIAMEEGLGFAIREGGRTVGSGRVTKITK-------------------
EFTU_BRELN       DMSVELIQPIAMEDRLRFAIREGGRTVGAGRVTKITA-------------------
EFTU_BIFAA       TFGVELIQPIAMEEGLTFAVREGGHTVGSGRVTKIIE-------------------
EFTU3_STRRA      SMIVELGREVPLEPGLGFAIREGGRTVGAGTVTALV--------------------
EFTU_PAROE       TISVELINAVAMEKGLRFAIREGGRTVGAGQVTEILD-------------------
EFTU_CYTH3       TITVKLIAAIALEKGLRFAIREGGRTVGAGQVTEILK-------------------
EFTU_PARD8       TIEVELIYPVACSVGLRFAIREGGRTVGAGQITELEN-------------------
EFTU_CELLY       TITVELLSPIALSEGLRFAIREGGRTVGAGQVTKIIE-------------------
EFTU_GRAFK       TITVELIQAIAMNQGLRFAIREGGRTVGAGQVTEILD-------------------
EFTU_FLAPJ       TIDVTLLSPIAMSVGLRFAIREGGRTVGAGQVTEITE-------------------
EFTU_SULMW       SVEVELLQPVAISEGLRFAIREGGRTVGAGQVIKIIE-------------------
EFTU_TERFE       NLTVKLIQPIAMEKGLKFAIREGGRTVGAGQVTEILK-------------------
EFTU_SALRD       TFEGSLIEPVALEEGLRFAIREGGHTVGAGVVTDILD-------------------
EFTU_SOLUE       SLEVELITPVAMDKGLRFAIREGGRTVGAGTVTEILK-------------------
EFTU_KORVE       ALEIELITPVAMEKGLRFAIREGGRTVGAGTISEIIA-------------------
EFTU_CHLPN       ELDVELIGTVALEEGMRFAIREGGRTIGAGTISKINA-------------------
EFTU_PARUW       EITVKLIAPIAMEKGMRFAIREGGRTIGAGTVSEILK-------------------
EFTU_TRIV2       KVTVELINPIAIEQGMRFAIREGGRTIGAGVVSKIVK-------------------
EFTU_THEEB       KMTVELIQPIAIEQGMRFAIREGGRTIGAGVVSKIIE-------------------
EFTU_MICAN       KMTVELINPIAIEQGMRFAIREGGRTIGSGVISKIIK-------------------
EFTU_SYNJA       RMTVELIQPIAIEQGMRFAIREGGRTVGAGVVSKILK-------------------
EFTU_GLOVI       KMTVELINPIAIEDGMRFAIREGGRTVGAGVVSKILK-------------------
EFTU_SYNE7       KMTVELINPIAIEQGMRFAIREGGRTIGAGVVSKILQ-------------------
EFTU_ACAM1       KMTVELINPIAIEQGMRFAIREGGRTVGAGVVSKILK-------------------
EFTU_TRIEI       KMTVQLINPVAIEQGMRFAIREGGRTIGAGVVSKIVE-------------------
EFTU_SYNY3       KMTVELINPIAIEQGMRFAIREGGRTIGAGVVSKILK-------------------
EFTU_ARTPT       NMTVQLICPIAIEQGMRFAIREGGRTVGAGVVAKILA-------------------
EFTU_CYAM1       KMCVNLIYPVAIEQGMRFAIREGGRTVGAGVVTKILE-------------------
EFTU_CYACA       KMTVELIHPVAIEQGMRFAIREGGRTVGAGIVSKILD-------------------
EFTU_EMIHU       KMTAELINPIAIEQGMRFAIREGGRTVGAGVVSKILE-------------------
EFTU_GUITH       KMTAQLIHPIAIEKGMRFAIREGGRTVGAGVVSKIIE-------------------
EFTU_GRATL       KMSAELINPIAIEQGMRFAIREGGRTVGAGVVSKILE-------------------
EFTU_CYAPA       KMTVSLVHPIAIEQGMRFAIREGGRTIGAGVVSKILK-------------------
EFTU_CYCME       KMTAELIYPVAIEEGMRFVIREGGRTIGAGVVSKIVK-------------------
EFTU_PHATC       KMTAEFIYPVAIEAGMRFAIREGGRTIGAGVVSKIVK-------------------
EFTU_TRICV       KMTAELIYPVAIEEGMRFAIREGGRTIGAGVVSKIIQ-------------------
EFTU_PROM1       KMTGELIAPVAIEQGMRFAIREGGRTIGAGVVSKIIE-------------------
EFTU_CHACO       KMIVNLICPIAIEKKMRFAIREGGRTIGAGVVYKY---------------------
EFTU_COLOB       KAIIQLIFPIALKKKMRFVIREGGFTIGVGIILELIKIKN----------------
EFTU_TOXGO       KLNVTLIYSIAMEKGMRFAIREGGRTIGAGIITDIIK-------------------
EFTU_EIMTE       KLRISLMYSIALEKGMRFAIREGGKTIGAGIIIDLIN-------------------
EFTU_THEPA       NANISLSKSIVLEKELRFSVREGGKTIGHGIIIDLIK-------------------
EFTU_PLAF7       TLHIELKHYIVLTLNMKFSIREGGKTIGAGIITEIKN-------------------
                                  : :***. *:. * :