CLUSTAL format seed alignment for MF_00120

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

GATA_AJECG       ------------------------------------------------------MSLLRE
GATA_COCP7       ------------------------------------------------------MSLLRE
GATA_EMENI       ------------------------------------------------------MSLLLE
GATA_ASPFU       ------------------------------------------------------MSLLRE
GATA_TUBMM       ------------------------------------------------------MALLEI
GATA_MAGO7       -------------------------------------------------------MLVHG
GATA_NECH7       ------------------------------------------------------MSAAVV
GATA_NEUCR       -------------------------------------------------------MSARI
GATA_PODAN       -------------------------------------------------------MLSRS
GATA_ASHGO       --------------------------------------------------------MKRA
GATA_YEAST       ------------------------------------------------------MPLKRS
GATA_YARLI       ------------------------------------------------------------
GATA_CANAW       ------------------------------------------------------MRKTLT
GATA_CANAL       ------------------------------------------------------MRKTLT
GATA_COPC7       --------------------------------------------------------MHGG
GATA_USTMA       -------------------------------------------------------MRNRG
GATA_CAMJE       --------------------------------MI--------------------TLKEAL
GATA_HELPY       --------------------------------MI--------------------TLKQAL
GATA_BORBU       -------------------------MDLSNLTLT--------------------KIQELV
GATA_CHLTR       ---------------------------MYRKSAL--------------------ELRDAV
GATA_FRATT       -----------------------------MSYIK--------------------KLRARL
GATA_METJA       ------------------------------------------------------------
GATA_METMP       ------------------------------------------------------------
GATA_METTH       ---------------------------MLKMETV--------------------DKVDMI
GATA_CENSY       ---------------------------MLPESLV--------------------EYVREV
GATA_THEMA       --------------------------------------------------------MIDL
GATA_ARCFU       ------------------------------MRIA--------------------EWKEKV
GATA_SACS2       ---------------------------MNRIMIV--------------------DLVNDL
GATA_METAC       -------------------------MMAKWMSVA--------------------QVKDKI
GATA_METHJ       --------------------------------MK--------------------KLTFHP
GATA_LEPIN       ------------------------MNEILKKSYV--------------------ELKDSL
GATA_AQUAE       --------------------------MLWKKSLS--------------------ELRELL
GATA_FUSNN       ----------------------MVYNNLYELTAK--------------------ELRDKF
GATA_BACAN       -------------------------MSLFDHSVS--------------------ELHKKL
GATA_BACCR       -------------------------MSLFDHSVS--------------------ELHKKL
GATA_BACSU       -------------------------MSLFDHKIT--------------------ELKQLI
GATA_LISMO       -------------------------MGLFDFSVK--------------------ELHDKL
GATA_STAA8       -------------------------MSIRYESVE--------------------NLLTLI
GATA_LACLA       -------------------------MSYNNKSIK--------------------ELHELL
GATA_STRR6       -------------------------MTFNNKTIE--------------------ELHNLL
GATA_ENTFA       ------------------------MEKLYDKSLT--------------------ELHDLL
GATA_LACPL       -------------------------MTYFDQDLT--------------------SLHADL
GATA1_CLOAB      -------------------------MELYKLKAH--------------------ELKDMI
GATA_CLOBH       -------------------------MDLTKLTAH--------------------ELKDML
GATA2_CLOAB      -------------------------MEILDMTVE--------------------QLRNAI
GATA_KORVE       -------------------------MDINVLTID--------------------ATRIAI
GATA_SALRD       ---------------------------MEYPTFT--------------------DARRAL
GATA_CHLTE       ---------------------------MQFHGYE--------------------DLRSRL
GATA_CORGL       --------------MTNKYLVEGSENELTTKTAA--------------------ELAGLI
GATA_MYCTU       ------------------------MTDIIRSDAA--------------------TLAAKI
GATA_STRCO       ------------------------MSDIIKLTAA--------------------EIAAKI
GATA_BIFLO       --------------------MSNETATLVKLSAA--------------------EQAAAV
GATA_DEIRA       --------------------------MAAFQTAA--------------------QLARAV
GATA_THET8       --------------------------MLAHEIRA--------------------RVAR--
GATA_RHOBA       ----------------------------MLHSAS--------------------EILKQL
GATA_ARATH       MLSTLQPP-----RSLSLLPLRRFQISKTIVSAASSKTIDTS--VISPPQSQILTTRRSL
GATA_VITVI       MLSTVQNPRFLLRQCRHFPPKRRRFHSSTPLFLSQPQTLASTDPPSSPPQSQILTIRDNL
GATA_ORYSI       MPPPLQAQRLLLSHRRLPSPHRRRFTAVSSLPSSPAKTVAAAAAH---APSSILSIRESL
GATA_ORYSJ       MPPPLQAQRLLLSHRRLPSPHLRCFTAVSSLPSAPAKTVAAAAAH---APSSILSIRESL
GATA_SORBI       MPPPLQAHRLLISHRRLPSPARRRFTAASSLQSAPATTLAPGP-----ATSSILSIRESL
GATA_MAIZE       MPPPLQAHRLLISHRRLPTPARRRFTAASSVQSAPATTLAPGP-----ATSSILSIRESL
GATA_DESVH       ------------------------MSALHTLSLA--------------------AIRDAL
GATA_CHLAA       ------------------------MTELHHLTVT--------------------AAQAAL
GATA_MOOTA       -------------------------MELYYLTAH--------------------ELSDLL
GATA_GEOSL       -------------------------MELFELTLH--------------------ELHDKL
GATA_THEYD       -------------------------MELNKLKLT--------------------ELVPLI
GATA_SYNY3       -----------------------------MSLIR--------------------ALHQQL
GATA_THEEB       -----------------------------MSVIQ--------------------ELHRQL
GATA_GLOVI       -----------------------------MTSIG--------------------QLRSQV
GATA_PROMA       ------------------------------MSIA--------------------KWRQKL
GATA_BORPE       --------------------MTQSALHTEFGGIA--------------------ALRDAL
GATA_BURPS       ---------------------------MHAKSLT--------------------ELRAAL
GATA_NEIG1       ---------------------------MTQYTLK--------------------QAGSLL
GATA_NEIMB       ---------------------------MTQYTLK--------------------QASVLL
GATA_COXBU       ---------------------------MHQKTIA--------------------ELKQDL
GATA_PSEAE       --------------------------MLHQLTLA--------------------EIARAL
GATA_AGRFC       ------------------------MTDLTSLTIA--------------------EAREKL
GATA_BRADU       ------------------------MTDLTSLTLA--------------------EARKGL
GATA_CAUVC       -------------------------MSLTNLTLK--------------------AAIDGL
GATA_RHOS4       -------------------------MNANELTIA--------------------DARDAL
GATA_RHORT       ---------------------MTNATTLTDLTIA--------------------EARDAM
GATA_RICPR       ------------------------MTELNKLTVA--------------------ESVKGL
GATA_DICDI       ---------------------------MNRLTNIS-------------------KIRKSL
GATA_HUMAN       ---------------------------MLGRSLR--------------------EVSAAL
GATA_MACFA       ---------------------------MLGRTLQ--------------------EVSAAL
GATA_BOVIN       ---------------------------MLGRTLR--------------------EVSVEL
GATA_CANLF       ---------------------------MLGRTLR--------------------EVSAAL
GATA_MOUSE       ---------------------------MLGRTLR--------------------EVSAAL
GATA_RAT         ---------------------------MLGRTLR--------------------EVSSAL
GATA_ORNAN       ---------------------------MLGLTLR--------------------EISAAL
GATA_XENLA       ---------------------------MLGMSLR--------------------EAAAVL
GATA_XENTR       ---------------------------MLGMSLR--------------------EAAAAL
GATA_DANRE       --------------MSASSAARRPVEAMLGLSIR--------------------EVSQAL
GATA_AEDAE       ------------------------MNRRLPLKLK--------------------ELSECF
GATA_CULQU       ------------------------MNRRLPATLR--------------------ELSECF
GATA_ANOGA       -------------------------MNRLPLRAR--------------------VLSECF
GATA_DROME       ------------------------MRRHLQWSIK--------------------QLTASY
GATA_DROPS       ------------------------MRRHLQWSIK--------------------QLTSSY
GATA_IXOSC       ---------------------------MLSLTIK--------------------ELVSHF
GATA_PEDHC       ---------------------------MLQTSIK--------------------KIHGKL
GATA_SCHPO       -----------------------------------------------------------M
GATA_MYCPN       --------------------------MKSQIL----------------------KLQQTL
GATA_MYCGE       --------------------------MRSNIL----------------------SLRAIL
                                                                             

GATA_AJECG       AEKCLANQKTYASLNAFITPL-----------QRAGPWRDRVRDSDTRRERGVTKSP---
GATA_COCP7       AERCLVNRKAFASLNAFVTPL-----------DRVGSWIERVKDADARRKRGAPKSS---
GATA_EMENI       AERYVANQSSNRMLNAFITPLC----------RHSGRWHDQAKDADIRGKQGKLRSR---
GATA_ASPFU       AEKCIANQRSHAALNAFITTV-----------QHLGPLREQVRDAELRRESGRSKSE---
GATA_TUBMM       AKKSLLAAEKYLALNSLISVQS----------QPELLSQVQASQERISADSGESKSS---
GATA_MAGO7       RRLGLLLGRSHVAAPKHTSHLPR----------RTVHLNHFVSKGEAASEAEPPQS----
GATA_NECH7       RRLALNSPRHTIISRRAVHLQPLCGQQYVKSKLRNWTCLTFLGESVTAGSSIPLRKD---
GATA_NEUCR       GRLRGLCLRHVSSTRQTSPI-------------QRRSLNQFISRVQQHDQPALE------
GATA_PODAN       G-LRGARLRVVSLTSQ------------------RRLLNHFITHPPEPIPPPPPPAPSSS
GATA_ASHGO       L-ERLRQLPRA-----------------------NERFNIFNSVNLSAAQQVMP--SEK-
GATA_YEAST       LKESIERLSSF-----------------------QSKYNIFTSINPSPYSITNKKGTKE-
GATA_YARLI       ----MENIIKS-----------------------NPYSNALISTAENPQVAQSG------
GATA_CANAW       SIRFLSDGIRV-----------------------KDKWNSLISDLVVEPTNSTG------
GATA_CANAL       SIRFLSDGIRV-----------------------KDKWNSLISDLVVEPTNSTG------
GATA_COPC7       LTKALRSS-----RLARRSVHS----------HALAAEANRATNALVSLKFPDSPP----
GATA_USTMA       VHRCIISVGSSNAAHVRRCAVS----------CCTLASANLARRDLTSSSAAHSNSGTFR
GATA_CAMJE       KYSKEELENLKKELNEKAKK-EK----------KLGAYIEQFLDKDLSVSG---------
GATA_HELPY       SLSQDELETLKNEIDAKVR--AS----------DLNAYIKAPSLNGASA-----------
GATA_BORBU       LTRKCKIYDILLAYKNNYEL-NK----------DINGYIEFFDDSLEIAKRYDDCLKNCE
GATA_CHLTR       VNRELSVTAITEYFYHRIESHDE----------QIGAFLSLCKERALLRASRIDDKLAKG
GATA_FRATT       DSGEISAVELTKEYLAKIKEQDK----------RINSVITLCEAEALKEAEDADAIISAG
GATA_METJA       -----MIVERVEEYLDRIEKINK----------DINALIEVKPEKVLEEAKKLEKDEKAK
GATA_METMP       -----MITDRVSDYLEKIEK--S----------DVNAFIDVNGEKVLKEAEELEKNDTLK
GATA_METTH       KNHGLTASENLEKFLKRIEAKND----------DINAFLEVRGEEAIKRAEEIDARIASG
GATA_CENSY       GSGGTTCEEFTAGAIERTKK--Q----------GLDAYITLN-EKALDEARRIDSRIKKG
GATA_THEMA       DFRKLTIEECLKLSEEEREK-LP----------QLSLETIKRLDPHVKAFISVRENVSVE
GATA_ARCFU       ESQ--GCYDAVSEMLERIEK--S----------RLNAYITV----CKDEALKMAEKYDRG
GATA_SACS2       RNKNLEAEEYIERTYEKIGKYDK----------YINAFITIR---SKEEVLKEVKESINK
GATA_METAC       KES--SAEEVTAGYLEVIEK--S----------KINGYITV-----SDKALEQAKKIDVE
GATA_METHJ       DDS-------------------------------VHAFITT------------IPEVTYG
GATA_LEPIN       NSGKISSTELVSACINRIREVDG----------AVKAFLYLDEKKVLNSAEESDKRRKEG
GATA_AQUAE       KRGEVSPKEVVESFYDRYNQTEE----------KVKAYITPLYGKALKQAESLKERE---
GATA_FUSNN       LSNELSAEEIVNSFYERIEKVED----------KIKSFVSLRKDKALDEARKLDEKRKNG
GATA_BACAN       NNKEISVTDLVEESYKRIADVED----------NVKAFLTLDEENARAKAKELDAKI-GA
GATA_BACCR       NNKEISVTDLVEESYKRIADVED----------NVKAFLTLDEENARAKAKELDAKI-GA
GATA_BACSU       HKKEIKISDLVDESYKRIQAVDD----------KVQAFLALDEERARAYAKELDEAVDGR
GATA_LISMO       VKKEISPFDLVSESFNRIESVED----------KVGSFITLNKEAAFGVAEELGDAG--I
GATA_STAA8       KDKKIKPSDVVKDIYDAIEETDP----------TIKSFLALDKENAIKKAQELDELQAKD
GATA_LACLA       VNKEISALELTKATLSDISAREP----------QIDAFLKITEEKALQDAAAIDARG--I
GATA_STRR6       VSKEISATELTQATLENIKSREE----------ALNSFVTIAEEQALVQAKAIDEAG--I
GATA_ENTFA       VSKEITAVDLTEETLNRIQDTEE----------QLGSFITVSEEKAMALAKAIDLKG--I
GATA_LACPL       VAKKISATELAKATFANMNQVDP----------KLGAFLNLNEEQALQQAAALDQDG--I
GATA1_CLOAB      SKKEVKVEEVTNSFLNRIEEVDE----------KVNALLYVAKEEAVNTAKELDKKIESG
GATA_CLOBH       SNKEVKAEEITKAFLDRINLVDN----------KLGAYLYVSEEEAIKKAKEIDGKIEKN
GATA2_CLOAB      LDKHLKSEDIVKAYFDNIKRNEP----------EINAYITLCEDYALKEAKDVDKKIANG
GATA_KORVE       QERQATATAIAESFYKKIEAEDG----------EINAYLTLSRDRALAQAAKIDAIADRG
GATA_SALRD       DAGETSCEALVSSFLERIDARDN----------EINAFTSVDQDGALNHARYLDSQRERG
GATA_CHLTE       LSGELTCEQVISDYLQRIDS-SR----------DDNIFTVVFHDEAMARARELDSKLQRG
GATA_CORGL       HSREVTSREVTQAHLDRIAAVDG----------DIHAFLHVGQEEALNAADDVDKRLDAG
GATA_MYCTU       AIKEVSSAEITRACLDQIEATDE----------TYHAFLHVAADEALAAAAAIDKQVAAG
GATA_STRCO       ASGELTAVQVTEAHLARIEAVDE----------KVHAFLHVDREGALAQARAVDEKRERG
GATA_BIFLO       KKGDVTSRELVEAHLKVIEAAEP----------SIKAFLKVSGDVALEQADAFDAKSAED
GATA_DEIRA       QSGETTPQQLLHGALARAEAVR-----------GLNALVSLN-SHAEEQAAAVQGRMQ--
GATA_THET8       --GEVSPLEVAQAYLKRVQELDP----------GLGAFLSLN-ERLLEEAEAVD------
GATA_RHOBA       DSGEVTAVEVIAQSLAAIRASQP----------TINAFTHVAEETAMQAAEAVDADRKAG
GATA_ARATH       LSGETTAVEIAKSYLSRIRLTEP----------QLKCFLHVSENVL-KDAQEIDQRIAKG
GATA_VITVI       INRRTTAVELAQLSLNRLRLTEP----------QINSFISVSETVL-REAEEIDAKIARN
GATA_ORYSI       LSGERTAAEITAEYLSRLRRTEP----------SVRSFIHVADAAAEREAEELDRRIATE
GATA_ORYSJ       LSGERTAAEITAEYLSRLRRTEP----------SVRSFIHVADAAAEREAEELDRRIATE
GATA_SORBI       LSGERTAADITSEYLSRLRRTEP----------SLRSFIHVADAAAEREAEELDRRIASG
GATA_MAIZE       LSGERTAADITSEYLSRLRRTEP----------TLRSFIHVADAAAEREAEELDRRIASG
GATA_DESVH       ARREVRAEDAVLDCLARIETTEP----------RIDALLHLRAEAAIEEARALDA----A
GATA_CHLAA       AAGDITAVELTEACLARINATEP----------TIRAFLHLTPDAALAAARAADERRQQG
GATA_MOOTA       NRKEISSEEATAAIIDRIEAVDG----------RVQAYLTRTAEQALEEARAVDAARARG
GATA_GEOSL       AKREVSSVEATRALLARIEATDS----------RVNAYITVTPDEALAAAEAADRRIAAG
GATA_THEYD       SKGEVRPHEIIIDVFKRVQEVEG----------KVKAYITLTVEKAYDMAREAENAIFSG
GATA_SYNY3       IDQEISAVAVAQASLARIEAVDD----------RLKSFLQVTAPQAIAQAEKVDAQIAAG
GATA_THEEB       VRKERSATEITQAYLDRIAQVEP----------TLHSFLTVTRDRALAQAAEVDKRLAAG
GATA_GLOVI       ASKERSAVEVARQYLERAERLDT----------EVHAFLRLTPERALAAAEAVDAKIARG
GATA_PROMA       NKGEVSSLELINQQINRIEEVEN----------TLHSYLYLNHEKARASAIKIDEARAAG
GATA_BORPE       ARRQVSAVELAQSGLDAAQAAS-----------GLNAFLHIDPDLTLAQARAADAALAAG
GATA_BURPS       DAKECSAVELAQHYLKRIDAAR-----------DLNAFVHVDAELTLAQAKAADAALANG
GATA_NEIG1       QSKQISAVELASAYLAAIAEKNP----------ALNGYITIDQDKTLAEARAADERIAQG
GATA_NEIMB       QSKQISAVELASAYLAAIAEKNP----------ALNGYITIDQDKTLAEARAADERIAQG
GATA_COXBU       RDKTISSVELTQHFLDRIKTINP----------TLNSFISITEEYALTQAKAADARLAKG
GATA_PSEAE       ADKQFSAEELTRTLLGRIRQLDP----------QLNSFISITDDLAIAQAKAADERRANG
GATA_AGRFC       KAKDFSALELTDAYLSAIDAANG----------ALNAYVALTPEKARDMAKASDERIASG
GATA_BRADU       AAKTFTSLELTDAHLSAIEAAR-----------VLNAFVMETPDRARDMAREADGKIAKG
GATA_CAUVC       AAREFTSVELTRAHIEAIEAAR-----------GLNAYILETPDKAIDMAAKSDARRALG
GATA_RHOS4       AKGELSAVDLTMACLTAIDAGT-----------PLNAFVHATPEIALDQARAADARRGAG
GATA_RHORT       AKGAFTPLELTNAHLARMEAGR-----------GLNAFITETPDLARMQAERSGERLRAG
GATA_RICPR       KNKDFTSKELVNAYIKQIEKYK-----------NLNAYVTETFDLALKQAEAADQNYGQN
GATA_DICDI       IDGKLKVNDLVLNKIKEINKVSPN---------HLNTFISLQDEKSLGKQIKESQERYDN
GATA_HUMAN       KQGQITPTELCQKCLSLI-KKTK----------FLNAYITVSEEVALKQAEESEKRYKNG
GATA_MACFA       KQGQITPTELCQKCLSLI-KKTK----------FLNAYITVSEEVALKQAEESEKRYKNG
GATA_BOVIN       KQGQITPTELCQRCLSLI-KKTK----------FLNAYITVSEEVALKQAEESEKRYKKG
GATA_CANLF       KQGQITPTELCQKCLSLI-KKTK----------FLNAYITVSEEVALKQAEESEKRYKKG
GATA_MOUSE       KQGQVTPTELCKNCLSLI-KKTK----------YLNAYITVSEEVALKQAEESEKRYKQG
GATA_RAT         KQGHITPTELCKKCLSLI-KKTK----------YLNAYITVSEEVALKQAEESEKRYKQG
GATA_ORNAN       KQGQVSPIELCQRCLSRI-KETK----------FLNAYITVTEERALKQAAESEKRYEKG
GATA_XENLA       RLGQVKPTELCQKCLSLI-KETS----------FLNAYITITEDIALKQAAEADKRFAQG
GATA_XENTR       RLGQIKPTELCQKCLSFI-KETS----------FLNAYITVTEDFALKQAAEADERFIQG
GATA_DANRE       RDGKVSATELCRKCINQI-QRTR----------YLNAYITIAEETAMEQAERADKRLRTG
GATA_AEDAE       RTQTLDPVSATEQILQLA-NRLQ----------HLNAFIRTSPEKALAQAEKSSTRHKTG
GATA_CULQU       RSKSLDPLTFTEHTLHRASDRAK----------HLNAFVRISSQTALQQAEASTQRHRSG
GATA_ANOGA       RSKSLDPVAVVEHSLAQI-ESHK----------HLNAFVRVSSEKALEQAKQSKDRHDAN
GATA_DROME       SDGQLSPRRVTEDALQDA-LRWK----------TLNAFVRLTPEQAGQQAQDAEQRYKLR
GATA_DROPS       ADGQLSPRRVTEQALEDS-VNLK----------TLNAFVRLTPEEARQQAQQSEQRYQKK
GATA_IXOSC       KAKKCSPVDICATCIKEI-NDSS----------FLNAFVTVLPEAAEKQARESHARWKSG
GATA_PEDHC       KGSNLNTAEVIVNSFKRA-EQVL----------ELNSFISMNNN-AGLQVESSNEYFKNG
GATA_SCHPO       SNKYNNLLKEVAAKYASIILNDA----------KIKSLTSINSAEYLYDSFVEISKLPLE
GATA_MYCPN       TKKPASINPLLQQIDGAINEHWS-----------SNFLLKNTVEWAQAQAPKNRSKS---
GATA_MYCGE       DKKPSAINDVLTSINAKIELNKS-----------SNFLLKNTVEIYSKKINKSDEKI---
                                                                             

GATA_AJECG       ------------------------------LDGKLVAIKDNICTRDMP--------TTCA
GATA_COCP7       ------------------------------LDGKLIAIKDNICTRDVR--------TTCA
GATA_EMENI       ------------------------------LDGRFIAFKDNICTRDFP--------TTCA
GATA_ASPFU       ------------------------------VDGRLIAFKDNICTRDFP--------TTCA
GATA_TUBMM       ------------------------------IDGQLIAVKDNICTTDFP--------TTCA
GATA_MAGO7       --------------------------------TFTVAVKDNIATQAHP--------TTCA
GATA_NECH7       ------------------------------AKPFKLAVKDNIATADFP--------TQCA
GATA_NEUCR       ------------------------------QRQFRLAVKDNIATVSPNSEEETPLTTTCG
GATA_PODAN       ----------------------------PSPKQFTLAVKDNIATTIPG------LPTTCA
GATA_ASHGO       -----------------------------PLGNLVVGIKDNIVTKKLP--------TTCS
GATA_YEAST       -----------------------------TLTGCVASIKDNIVTKDFP--------TTCA
GATA_YARLI       -----------------------------ALAGIALAVKDNICTNEMH--------TTCA
GATA_CANAW       -----------------------------PLSGTTYIVKDNIATSHGY--------TTAA
GATA_CANAL       -----------------------------PLSGTTYIVKDNIATSHGY--------TTAA
GATA_COPC7       -------------------------AEKGPLSGLRIAVKDNIVTRDFP--------TTCS
GATA_USTMA       DGRFDPYNAIIADITSSSTSSPSGAATKGRLKGWTAAIKSNICIRDHP--------TTCS
GATA_CAMJE       -------------------------------EGVPVAIKDNISVKGWE--------LTSA
GATA_HELPY       -------------------------------KGVPILIKDNISVKGWE--------ITCS
GATA_BORBU       L-------------------------EDLPLIGMLIAVKDNISIQDKS--------LTCA
GATA_CHLTR       D-------------------------PIGLLAGIPIGVKDNIHITGVK--------TTCA
GATA_FRATT       K--------------------------QGLLTGIPILHKDLFCTKGIR--------TTAA
GATA_METJA       K---------------------------KPLYGKIIVVKANINVEGYT--------ISCA
GATA_METMP       N---------------------------KPLYGKIVAVKSNINVKGYK--------ISCA
GATA_METTH       K-------------------------ETGKLAGLVIGVKSNINVEDFN--------VSAA
GATA_CENSY       E-------------------------KVGRCLGAPIAVKDNICVRGMR--------TTCA
GATA_THEMA       K-------------------------K-GKFWGIPVAIKDNILTLGMR--------TTCA
GATA_ARCFU       E-------------------------LKGRLAGIPVAVKDNISTKGIL--------TTCA
GATA_SACS2       ---------------------------GGKLAGVLIAIKDNISTEGIR--------TTCA
GATA_METAC       G-------------------------HEGPLAGVPIAIKDNISVVGLP--------NSCG
GATA_METHJ       ---------------------------DGPLSGVTVAVKDNISTKGIE--------TTCA
GATA_LEPIN       K-------------------------PLSEFDGMPVAIKDNICIRDTI--------TSCS
GATA_AQUAE       ----------------------------LPLFGIPIAVKDNILVEGEK--------TTCA
GATA_FUSNN       E-------------------------KLGRLAGIPIAIKDNILMEGQK--------STSC
GATA_BACAN       E-------------------------DNGLLFGMPIGVKDNIVTNGLR--------TTCA
GATA_BACCR       E-------------------------DNGLLFGMPIGVKDNIVTNGLR--------TTCA
GATA_BACSU       S-------------------------EHGLLFGMPIGVKDNIVTKGLR--------TTCS
GATA_LISMO       D-------------------------PNNMLAGLPIGIKDNIVTKNLR--------TTAA
GATA_STAA8       Q-------------------------MDGKLFGIPMGIKDNIITNGLE--------TTCA
GATA_LACLA       N-------------------------PDVVTDGISIAVKDNIVTEGIE--------TTAA
GATA_STRR6       D-------------------------ADNVLSGIPLAVKDNISTDGIL--------TTAA
GATA_ENTFA       T-------------------------ESNPLAGIPIGIKDNIVTKDIL--------TTAG
GATA_LACPL       D-------------------------ANNVFAGIPMAVKDNIVTKGLT--------TTAA
GATA1_CLOAB      E-------------------------SLSGLSGVPVAIKDNISVKNMQ--------NTCA
GATA_CLOBH       E-------------------------ELKALSGIPVGIKDNINVKGMQ--------NTCA
GATA2_CLOAB      D-------------------------KVGRLAGIPIAIKDNICTDGIK--------TTCA
GATA_KORVE       D-------------------------DLPRLAGLPVAIKDVISTKGVR--------TTAG
GATA_SALRD       N-------------------------PRP-LAGLVLAVKDNICIRGYP--------VSCG
GATA_CHLTE       E-------------------------APGVLFGMPIAIKDNIAMKGAP--------LSCA
GATA_CORGL       -E-----------------------APASALAGVPLALKDVFTTTDAP--------TTAA
GATA_MYCTU       -E-----------------------PLPSALAGVPLALKDVFTTSDMP--------TTCG
GATA_STRCO       -E-----------------------K-LGPLAGVPLALKDIFTTEGIP--------TTVG
GATA_BIFLO       -K-----------------------AALPELAGVPIAIKDMIVTKGIE--------TTAA
GATA_DEIRA       -A-----------------------GETLPLAGVPIVVKDNINVTGTR--------TTCG
GATA_THET8       --------------------------PGLPLAGLVVAVKDNIATRGLR--------TTAG
GATA_RHOBA       -K------------------------TLGPLAGLPVAIKDVLCTSDMP--------TTCS
GATA_ARATH       -------------------------EELGPLAGVLIGVKDNICTQGMP--------STAA
GATA_VITVI       -------------------------EELGPLAGVFVGVKDNICTADMP--------STGG
GATA_ORYSI       GL-----------------------DAVGPLAGVLVGVKDNLCTANMP--------STGG
GATA_ORYSJ       GL-----------------------DAVGPLAGVLVGVKDNLCTANMP--------STGG
GATA_SORBI       EK-----------------------DAVGPLAGVLVGVKDNLCTANMP--------STGG
GATA_MAIZE       EK-----------------------DAVGPLAGVLVGVKDNLCTANMP--------STGG
GATA_DESVH       GP-----------------------DASRPLWGVPVTVKDALTTAGTP--------TTAG
GATA_CHLAA       R-------------------------SLGPLDGIPIAIKDVICTDGVP--------TTAG
GATA_MOOTA       E-------------------------TLGPLAGVPMALKDNLCTEGVR--------TTCS
GATA_GEOSL       --------------------------GLTPLTGVPVALKDIFVTRGIR--------TTCG
GATA_THEYD       --------------------------KKSLLTGIPIAVKDNICTKGIL--------TTCA
GATA_SYNY3       E-------------------------PIGLLAGIPIGIKDNLCTKGIV--------TTCA
GATA_THEEB       E-------------------------EIGLLTGIPLAIKDNLCTYGVR--------TTCA
GATA_GLOVI       E-------------------------DPGLLAGVPVAVKDNLCMVGIP--------TTCA
GATA_PROMA       E-------------------------ELPPLAGVPFAIKDNLCTKGIP--------TTCS
GATA_BORPE       T--------------------------AGPLAGIPIAHKDAFVTRGWR--------TTAG
GATA_BURPS       E--------------------------AGPLAGLPIAHKDVFVTRGWR--------STAG
GATA_NEIG1       N--------------------------ASALTGVPVAYKDIFCQTGWR--------SACA
GATA_NEIMB       N--------------------------ASALTGVPVAYKDIFCQTGWR--------SACA
GATA_COXBU       E--------------------------ATSLTGIPIAQKDIFCTKDIK--------TSCG
GATA_PSEAE       E--------------------------NGALLGAPIAHKDLFCTQGVR--------TSCG
GATA_AGRFC       S--------------------------AGELEGVPLGVKDLFATRDVH--------TQAC
GATA_BRADU       D--------------------------AGPLAGIPLGMTDLFATKGVR--------TTAC
GATA_CAUVC       E--------------------------AGPLEGAPLGVKDLFCTNGVR--------TTAC
GATA_RHOS4       ---------------------------AGALNGIPLGIKDLFCTRGVA--------SQAA
GATA_RHORT       K--------------------------AGPMEGIPIGIKDLFCTEGVR--------TTAG
GATA_RICPR       K--------------------------ARTLEGIPFAVKDLFCTKGIR--------TTAC
GATA_DICDI       G-------------------------TNKRLDGIPIGVKDNFSSKNFK--------TTCG
GATA_HUMAN       Q-------------------------SLGDLDGIPIAVKDNFSTSGIE--------TTCA
GATA_MACFA       Q-------------------------SLGDLDGIPVAVKDNFSTSGIE--------TTCA
GATA_BOVIN       H-------------------------SLGDLDGIPIAVKDNFSTSGIE--------TTCA
GATA_CANLF       H-------------------------SLGDLDGIPIAVKDNFSTSGIE--------TTCA
GATA_MOUSE       Q-------------------------SLGDLDGIPVAVKDNFSTTGIE--------TTCA
GATA_RAT         Q-------------------------SLGDLDGIPVAVKDNFSTSGIE--------TTCA
GATA_ORNAN       Q-------------------------ELGVLDGIPFSVKDNFSTAGIE--------TTCA
GATA_XENLA       K-------------------------PLGELDGIPIAIKDNFSTAGIE--------TTCA
GATA_XENTR       K-------------------------PLGDLDGIPIAIKDNFSTAGIE--------TTCA
GATA_DANRE       K-------------------------TLGPLDGIPFSVKDNFCTENIK--------TTCA
GATA_AEDAE       K-------------------------PLSLLDGAPIAVKDNFCTKGIH--------TTCA
GATA_CULQU       S-------------------------TLGPLDGATIAVKDNFCTRNVA--------TTCA
GATA_ANOGA       S-------------------------PKSILDGVTIAVKDNFCTKGIH--------TTCA
GATA_DROME       Q-------------------------PISDLDGVTIAIKDNFCTKDVH--------TTCA
GATA_DROPS       Q-------------------------PSSGLDGVTIAIKDNFCTENVH--------TTCA
GATA_IXOSC       K-------------------------PRGPLDGVPIAVKDNFCMTGVR--------TTCG
GATA_PEDHC       K-------------------------PRSLLEGIPIAVKDNFCVKDTL--------TTCG
GATA_SCHPO       K--------------------------KLPLKWKLITVKENICTKTNL--------TTAA
GATA_MYCPN       -----------------------------PLNNIPFVLKDNIATKGIV--------TTGG
GATA_MYCGE       -----------------------------LLNNIPYVLKDNIATKDIV--------TTGG
                                                       .  :                  

GATA_AJECG       SRILD-TYTSPFNATVVESLEKSGAIIAGKTNLDEFGMGSHSMHSHFGPVKNVTE--SR-
GATA_COCP7       SAILE-NFTSPFNATVVELLEESGAIVAGKTNLDEFGMGSHSTYSHFGPVKGVRA--DD-
GATA_EMENI       SKSLD-TFTSPFNATVVQQLEDAGAIVAGKTNLDEFGMGSHSIYSSFGHVMNTRRG-DD-
GATA_ASPFU       SGILA-KFTSPFNATVVEQLSEAGAIVAGKTNLDEFGMGSHCLNSCFGPVKNQRQC-QE-
GATA_TUBMM       SKLLE-QYVSPFDATVVRKAKEAGAVIMGKTNMDEFGMGSHSMYSHFGPVMQSAE--DG-
GATA_MAGO7       SNILR-DYTSPYEATVVRQLRRRGARVVGTTNLDEFGMGTHSTHSAHGPVASPAGR----
GATA_NECH7       SQILS-SHPSPFEATVVRQLRERGASIVGKTNMDEFGMGSHSTNSIHGAVRNPLAED---
GATA_NEUCR       SNFLA-NYRSPFEATIVSQLRSRGALLVGKTNLDEFGMGSHSVHTAFGAVAQEGEHEQQ-
GATA_PODAN       SGILSKSYVSPIEATIITQLRARGAVITGKTNLDEFGMGSHSIYSHYGPVSQD-----T-
GATA_ASHGO       SGVLA-GYMSPYDATVVELLDEAGAVTAGKTNMDEFGMGSGGIHSFFGPTLNPAFPER--
GATA_YEAST       SHILE-NFKSPFDATVVKLLKQAGVHILGKTNLDEFGMGSGGVHSIRGPVINPLYPHED-
GATA_YARLI       SGILE-TFTSPFDATVVDLLKQEGVSIVGKANLDEFGMGSDNANSWFGPVFNPLYPDE--
GATA_CANAW       SKILS-NYESPFNATIIDLLSSNGSKLIGKSNLDEFGMGSANYNSYFNKVTNPYDNTK--
GATA_CANAL       SKILS-NYESPFNATIIDLLSSNGSKLIGKSNLDEFGMGSANYNSYFNKVTNPYDNTK--
GATA_COPC7       SNVLK-NFVSPFDATVVHRIRENGGQIIGKANCDEFGMGSLNTYTIHGPVINPF-PLSKV
GATA_USTMA       SAMLQ-HFKPTFDASAVSLLRQAGTDIRYITNCDEFGMGSNNIHSVHGPVRNPASPRSES
GATA_CAMJE       SKILQ-GYIAPYDASAIVNLKANGFSPFGRCNMDEFAMGSSTASSCYGKTLNPLNFE---
GATA_HELPY       SKILE-GYVAPYHASVMENLHQNSMAGFGLSNMDEFAMGSTTESSCYGITKNPRDKN---
GATA_BORBU       SEILK-GYISPYDATVIKRLKNKGAILIGRTNMDEFAMGSTCEFSYYGATLNPLNRE---
GATA_CHLTR       SKMLE-NFVAPFDSTVVRRIEMEDGILLGKLNMDEFAMGSTTRYSAFHPTNNPWDLE---
GATA_FRATT       SKMLD-NFVAPYDSTVTKNCKDQGMVTLGKLNMDEFAMGSTNEYSYYGAVSNPWDLE---
GATA_METJA       SKTLE-NYIAPYDATVIEKIKENGGLIIGIANMDEFACGSSGETSYFGPTKNPRAKD---
GATA_METMP       SKTLE-KYVGTYDATVVKKLRSQGALIVGMTNMDEFAGGSSGETSCYGPTKNPAAMD---
GATA_METTH       SKTLE-NYTGSYDATVIRRIKEEDGIIIGMTNMDEFAAGSSTETSFFGPTDNPAAPG---
GATA_CENSY       SKMLE-GYESPYDATVVTRLLAEDAIITGKTNMDEFAMGLTTEFSAYGPSRNPWNKE---
GATA_THEMA       SRILE-NYESVFDATVVKKMKEAGFVVVGKANLDEFAMGSSTERSAFFPTRNPWDLE---
GATA_ARCFU       SKMLS-NYRPVFDAHVVEKLKQEGAIIIGKANMDEFAMGTTTETSYFGVVRNPHDEA---
GATA_SACS2       SKMLE-DYIPPYDATVIEKLKKEGAVIIGKTNMDEFAMGSTTETSYFGPTRNPWDLE---
GATA_METAC       SKILE-GYVPPFNAHVIEKLLDAGAVILGKTNLDEFAMGSSTETSYYGPTANPWDLE---
GATA_METHJ       SKILK-GYIPPYDAHVVTLLKNAGAAIVGKTNMDEFGMGTTTENSAYGPTLNPLDHQ---
GATA_LEPIN       SKILE-NYKSPFHATVVEKLLEKGFILFPRTNMDEFAMGSSTENSAFQTTRNPFDLE---
GATA_AQUAE       SKILE-NFVAPYDATVIERLKKAGALIVGKTNLDEFAMGSSTEYSAFFPTKNPWDLE---
GATA_FUSNN       SKILE-NYIGIYDATVVKKLKEEDAIIIGITNMDEFAMGSTTKTSFHHKTSNPWDLN---
GATA_BACAN       SKILA-NFDPIYDATVVQKLKAADTITIGKLNMDEFAMGSSNENSGFYATKNPWNLD---
GATA_BACCR       SKILA-NFDPIYDATVVQKLKAADTITIGKLNMDEFAMGSSNENSGFYATKNPWNLD---
GATA_BACSU       SKILE-NFDPIYDATVVQRLQDAEAVTIGKLNMDEFAMGSSTENSAYKLTKNPWNLD---
GATA_LISMO       SKILE-NFDPIYDATVVSKLKNAQTINIGKLNMDEFAMGSSTETSYFHKTHNPWDLS---
GATA_STAA8       SKMLE-GFVPIYESTVMEKLHNENAVLIGKLNMDEFAMGGSTETSYFKKTVNPFDHK---
GATA_LACLA       SKILG-GWIPPYNATVANKLSESGLITIGKLNMDEFAMGGSGENSSVKPTKNAWDQT---
GATA_STRR6       SKMLY-NYEPIFDATAVANAKTKGMIVVGKTNMDEFAMGGSGETSHYGATKNAWDHS---
GATA_ENTFA       SKMLH-NFDPIYDATVMDKVYQADMIPVGKLNMDEFAMGGSTETSYFKKTKNAWDQT---
GATA_LACPL       SKMLE-NFVPVYNATVVDKLLASNALIVGKTNMDEFAMGGSTETSAFHVTRNPWDIS---
GATA1_CLOAB      SKILE-GYVSPYDATVIENLKKNNGVIIGKANMDEFAMGSSTENSAFKVSKNPWSLE---
GATA_CLOBH       SKILE-GYTSPYDAHVTEKIKQEEGIILGKLNMDEFAMGSSTENSAFKLAKNPWDLE---
GATA2_CLOAB      SKMLY-DFVPPYDATVIKKLKAEDAIIIGKVNMDEFAMGSSTENSAFKITKNPRDIT---
GATA_KORVE       SKILE-EFIAPYDATVVQKLEAAGAVILGKTNCDEFAMGSSNENSAYGPVRNPRDKS---
GATA_SALRD       SKMLA-DFSSLYDATVIDRLRDAGAIFIGKTNCDEFAMGSSNETSHFGPVRNPHAPE---
GATA_CHLTE       SKILA-GYESVYDATVIKRMQAEDAIFVGRTNMDEFAMGSSNENSAIGPVPNPYDKT---
GATA_CORGL       SKMLE-GYMSPYDATVTRKIREAGIPILGKTNMDEFAMGSSTENSAYGPTHNPWDLE---
GATA_MYCTU       SKILE-GWRSPYDATLTARLRAAGIPILGKTNMDEFAMGSSTENSAYGPTRNPWNLD---
GATA_STRCO       SKILE-GWIPPYDATVTKRLKAADVVILGKTNMDEFAMGSSTENSAYGPTGNPWDLT---
GATA_BIFLO       SKILE-GWVPPYDATVIEKLKAAGMPILGKTNLDEFAQGSSTEHSAYQTTHNPWDTE---
GATA_DEIRA       SRMLA-NYVSPYTATAAQKLQGAGAVIVGKANMDEFAMGSSTESSASGPTLNPWDHE---
GATA_THET8       SRLLE-NFVPPYEATAVARLKALGALVLGKTNLDEFGMGSSTEHSAFFPTKNPFDPD---
GATA_RHOBA       SKMLE-GFVPPYDATVVARLKSAGAIVVGKTNMDEFAMGASTETSAMGVTGNPWDTT---
GATA_ARATH       SRILE-HYRPPFDATAVKKIKELGGIVVGKTNMDEFGMGSTTEASAFQVTANPWDLS---
GATA_VITVI       SRILE-NYRPPFDATAVKRVKDCGGIVVGKTNLDEFGMGSTTEGSAFQVTANPWDVS---
GATA_ORYSI       SRILD-GYQPAYDATAVRRLREAGAIVVGKTNLDEFGMGSTTEGSGFQVTTNPWDDS---
GATA_ORYSJ       SRILD-GYQPAYDATAVRRLREAGAIVVGKTNLDEFGMGSTTEGSGFQVTTNPWDDS---
GATA_SORBI       SRILD-GYRPAYDATAVRRLQEAGAIVVGKTNLDEFGMGSTTEGSAFQVTTNPWDDS---
GATA_MAIZE       SRILD-GYRPAYDATAVRRLREAGAIVLGKTNLDEFGMGSTTEGSAFQVTTNPWDDS---
GATA_DESVH       SRILE-DFVPFYDAFAVQRLREAGAIILGKNNMDEFAMGSSTENSAYKPTRNPWDTA---
GATA_CHLAA       SRILA-GFRPPYNATVIERLVAAGAVLVGKLNCDEFAMGSSTENSAYQITTNPWDPT---
GATA_MOOTA       SRMLA-DWVPPYDATVVRRLKEAGAVMLGKLNMDEFAMGSSTENSSFFPTRNPWDLE---
GATA_GEOSL       SKILG-NFIPPYDGTVVAKLREAGAVIVGKLNQDEFAMGSSGESSAFGATKNPWNLA---
GATA_THEYD       SKILY-NFYPPYESTVTSKLLNNKYILIGKTNMDEFAMGSSTENSGFHVTKNPWDLE---
GATA_SYNY3       SQILR-GFVPPYESTVTEKLQKAGAVMVGKTNLDEFAMGSSTENSGYQVTANPWDLT---
GATA_THEEB       SKMLE-HFVPPYESTVTEKLQAAGAIMVGKTNLDEFAMGSSTENSAFGFTANPWNPE---
GATA_GLOVI       SKILE-NYRPPYESTVTRRLEEQGALIIGKTNLDEFAMGSSTENSAFGPTRNPWDLG---
GATA_PROMA       SKMLE-EFIPPYESTVTQRLWKAGGILLGKTNLDEFAMGSSTETSAFGPTKNPWDIT---
GATA_BORPE       SKMLA-GYASPFDATVVERLAEAGAVSLGKLNCDEFAMGSGNENSAYGPVRNPWDTQ---
GATA_BURPS       SKMLA-NYASPFDATVVARLSAAGMVTLGKTNMDEFAMGSSNENSAFGPVKNPWDTS---
GATA_NEIG1       SKMLD-NFIFPYTATVVQNLLDEGMVTLGRTNMDEFAMGSTNENSFYGAAKNPWNPE---
GATA_NEIMB       SKMLD-NFISPYTATVVQNLLDEGMVTLGRTNMDEFAMGSTNENSFYGAAKNPWNLE---
GATA_COXBU       SKMLD-NFIAPYDATVVEQLNKAGAILIGKTNMDEFAMGSSNENSYFGAVKNPWDLE---
GATA_PSEAE       SKMLD-NFVSPYDATVVEKLTAAGAVTLGKLNMDEFAMGSSNQSSHYGAVKNPWSLD---
GATA_AGRFC       SHVLD-GFKPKYESTVTQNLWDQGAVMLGKLNMDEFAMGSSNESSWYGPVINPWRANGS-
GATA_BRADU       SKILG-NFVPTYESTVTSQLWRDGAVMLGKLNNDEFAMGSANETSCFGPVGNPWRREGS-
GATA_CAUVC       SKILE-NFVPTYESTVTSQLWRDGAVMLGKLNLDQFAMGSSNETSYFGPVTNPWRAQGS-
GATA_RHOS4       SNILK-GFKPEYESTVTSKLFEAGAVMLGKLNMDEFAMGSSNETSCYGDAVNPWKVD---
GATA_RHORT       SKILD-GFVPPYESTVSANLAKAGAVMLGKTNLDEFAMGSSNKTSASGPVINPWTRTDD-
GATA_RICPR       SNILK-NFIPHYESSVTQNIFDKGGVILGKTNMDEFAMGSANITSCFGNVISPWKANDD-
GATA_DICDI       SKILE-NYIPSFDSTVVKLLKEEGAIIIGKTNMDEFSMGSSSTSGHFGKVINPWSKPNNN
GATA_HUMAN       SNMLK-GYIPPYNATVVQKLLDQGALLMGKTNLDEFAMGSGSTDGVFGPVKNPWSYSKQY
GATA_MACFA       SNMLK-GYIPPYNATVVQKLLDQGALLMGKTNLDEFAMGSGSTDGIFGPVKNPWSYSKQY
GATA_BOVIN       SNMLK-GYVPPYNATVVQKLLDQGALLMGKTNLDEFAMGSGSTDGIFGPVKNPWSYSKQY
GATA_CANLF       SNMLK-GYVPPYNATVVQKLLDQGAVLMGKTNLDEFAMGSGSTDGVFGPVKNPWSYSKQY
GATA_MOUSE       SNMLK-GYVPPYNATVVQKLLDQGALLMGKTNLDEFAMGSGSTDGVFGPVRNPWTYSKQY
GATA_RAT         SNMLK-GYLPPYNATVVQRLLDQGALLMGKTNLDEFAMGSGSTDGVFGPVKNPWTYSKQY
GATA_ORNAN       SNMLK-GYVPPYNATVVQKLLDQGAVLMGKTNLDEFAMGSGSTDGVFGPVRNPWSYSKQY
GATA_XENLA       SRMLK-GYVAPYNATVVQKLFDQGAVLMGKTNLDEFGMGSGSTDSIFGPVRNPWSYSRSY
GATA_XENTR       SRMLK-GYIAPYNATVVQKLFDQGAVFMGKTNLDEFAMGSGSTDSIFGPVKNPWSYSRSY
GATA_DANRE       SNMLK-GYVPPFSATVVQKLLDQGAVLVGKTNLDEFAMGAGSTDGAFGPVRNPWSYAAPY
GATA_AEDAE       ARMLE-NFVPTYNATVYERLARNGAILVGKTNMDQYGMGSGTVDSIFGPTKNYWDAVEGE
GATA_CULQU       SRMLE-SFVPTYSATVWERLERGGAVLVGKTNMDQFGMGSGTVDSIFGPTRNCWSESLEG
GATA_ANOGA       SRMLQ-NFIPTYDATVVERLQAHGAVIVGKTNLDQFGMGSGCIDSIFGPTRNNWSEDTND
GATA_DROME       SRMLQ-DFVPPYDATVCSRLKQAGAVILGKTNMDQFAMGAGTVDSLYGPTKNIWSEDLNK
GATA_DROPS       SRMLQ-DFVPPYDATVCSRLRQAGAVLLGKTNMDQFAMGAGTVDSIYGPTKNIWSEDLTQ
GATA_IXOSC       SRMLA-NFYPPYTATVVERLQGEGAVVLGKTNMDEFGMGSGATDSAFGPTKNPWKNAGEA
GATA_PEDHC       SKMLQ-NFRPKYTATVVQKLLDSGAILVGKTNMDEFAMGSGTTTSIFGPTKNIWGSRFSN
GATA_SCHPO       SNMLK-DYNSPFDASIVESLKKAGGIILGKTNMDEFAMGVKSENNLFGRTVNPVVKDSN-
GATA_MYCPN       SRFLE-DYIPPFSATVFELLNNSGALLVGKANLDEFGLGGTGLHSGFGFVHHPWNET---
GATA_MYCGE       SLFLK-NYLPPFSATVFELLEMNGALLVGKANMDEFGLGGTGSYSAFGVVHHPENSS---
                 :  *         .                 * *::. *                     

GATA_AJECG       --------------REPISPGGSSGGSAVAVATGQCYAALGTDTGGSVRLPAAYTGTVGF
GATA_COCP7       --------------LGYVSAGGSSGGSAIAVATEQCYAALGTDTGGSVRLPAAYTGTVGF
GATA_EMENI       --------------SKFLSAGGSSGGNAVAVATDQCYAALGTDTGGSIRLPAAYTGTVGF
GATA_ASPFU       --------------GRILSAGGSSGGSAVSVATDQCYAALGTDTGGSVRLPAAYTGTVGF
GATA_TUBMM       --------------RPARSAGGSSGGSAVAVATGMCYAALGTDTGGSVRLPAAYCGIVGF
GATA_MAGO7       ------------------SAGGSSGGSAVAVAAGEVEVALGTDTGGSVRLPAAYNGVVGF
GATA_NECH7       ---------------DDVSAGGSSGGSAVAVRLGDADVALGTDTGGSIRLPAAYTGTVGY
GATA_NEUCR       --------------AVKHSAGGSSGGSAVAVATGEADIALGTDTGGSVRLPAGYTGVVGF
GATA_PODAN       --------------PPETSAGGSSGGSAVAVANGEVELALGTDTGGSVRLPAAYTGIIGY
GATA_ASHGO       ----------------PTVAGGSSSGSAAAVAAGVVDFALGTDTGGSVRMPAAYTSTVGF
GATA_YEAST       ----------------KKIMGGSSSGAAASVACDLVDFALGTDTGGSVRLPACYGSVLGF
GATA_YARLI       ----------------PHTPGGSSGGSAAAVAADMCHFALGTDTGGSVRYPAAQCSVIGL
GATA_CANAW       ------------------VPGGSSGGSAASVAGKMCSFSIGTDTGGSVRLPASYCNVFGF
GATA_CANAL       ------------------VPGGSSGGSAASVAGKMCSFSIGTDTGGSVRLPASYCNVFGF
GATA_COPC7       GLN-----------NDKRSAGGSSGGSAAAVAADICDAALGTDTGGSIRLPASYCGIVGL
GATA_USTMA       GPIW--------NLEEERVAGGSSGGSAAVVKAGLVRFALGSDTGGSVRLPAAYCGIVGL
GATA_CAMJE       -----------------RVPGGSSGGSAAAVAGGLALASLGSDTGGSVRQPAAFCGCVGF
GATA_HELPY       -----------------RVPGGSSGGSAAAVAGGLAVAALGSDTGGSIRQPASYCGCVGL
GATA_BORBU       -----------------YVIGGSSGGSAAVVAAFQAPFSLGSDTGGSVRLPASFSGILGF
GATA_CHLTR       -----------------RVPGGSSGGSAAAVSARFCPIALGSDTGGSIRQPAAFCGVVGF
GATA_FRATT       -----------------RVPGGSSGGSAAAVAAGFAPISTGSDTGGSVRQPASFCGLTAM
GATA_METJA       -----------------RIPGGSSSGSAAAVSADLCDMALGSDTGGSIRNPASHCGVVGF
GATA_METMP       -----------------RIPGGSSSGSAAAVAADLCDMAIGSDTGGSIRNPASHCGIVGF
GATA_METTH       -----------------RIPGGSSGGSAAAVAAGMCDLALGSDTGGSIRNPASHCGVMGF
GATA_CENSY       -----------------CTPGGSSGGSAAAVGGLECIASLGSDTGGSVRNPASFCGMVGF
GATA_THEMA       -----------------RVPGGSSGGSAAAVSAGMVVAALGSDTGGSVRQPASLCGVVGY
GATA_ARCFU       -----------------RVAGGSSGGSGAVIAADEAVLSLGSDTGGSIRCPASFCGVYGL
GATA_SACS2       -----------------RTPGGSSGGSGAALAAGYVELALGSDTGGSIRAPAAYNAIFGL
GATA_METAC       -----------------RVPGGSSGGSAAVVAAGEAPFALGSDTGGSVRCPAAFCGVVGL
GATA_METHJ       -----------------RVPGGSSGGSAAAVAAGLVDCAIGSDTGGSIRCPAAFCGIVGL
GATA_LEPIN       -----------------RIPGGSSGGSAAAVAASMVPLALGSDTGGSVRQPASLCGLYGL
GATA_AQUAE       -----------------RVPGGSSGGSAASVAVLSAPVSLGSDTGGSIRQPASFCGVIGI
GATA_FUSNN       -----------------RVPGGSSGGAAASVAAQEVPISLGSDTGGSVRQPASFCGVVGF
GATA_BACAN       -----------------YVPGGSSGGSAAAVAAGEVLFSLGSDTGGSIRQPAAYCGVVGL
GATA_BACCR       -----------------YVPGGSSGGSAAAVAAGEVLFSLGSDTGGSIRQPAAYCGVVGL
GATA_BACSU       -----------------TVPGGSSGGSAAAVAAGEVPFSLGSDTGGSIRQPASFCGVVGL
GATA_LISMO       -----------------RVPGGSSGGSASAVAAGEVLFSLGSDTGGSIRQPAAFCGVVGM
GATA_STAA8       -----------------AVPGGSSGGSAAAVAAGLVPFSLGSDTGGSIRQPAAYCGVVGM
GATA_LACLA       -----------------KVPGGSSSGSAASVASGQVRLSLGSDTGGSIRQPAAFNGIVGL
GATA_STRR6       -----------------KVPGGSSSGSAAAVASGQVRLSLGSDTGGSIRQPAAFNGIVGL
GATA_ENTFA       -----------------KVPGGSSGGSASAVAAGQVPVSLGSDTGGSIRQPAAFNGIVGL
GATA_LACPL       -----------------RVPGGSSGGSAVAVASGQVPVALGSDTGGSIRQPSSFNGIVGM
GATA1_CLOAB      -----------------RVPGGSSGGSAVAVASLEAPISLGTETGGSVRQPASFCGLVGL
GATA_CLOBH       -----------------RVPGGSSGGSAVAVAGSEATLSLGTDTGGSVRQPASFCGVVGL
GATA2_CLOAB      -----------------RVPGGSSGGSAAVVAAKMAPISLGSDTGGSIRQPAAFCGVVGL
GATA_KORVE       -----------------RVPGGSSGGSAAVVAAGTAVTSLGSDTGGSIRQPASFCGVVGL
GATA_SALRD       -----------------YVPGGSSGGSAAAVAAGLCHAALGSDTGGSVRQPAAFCGTVGL
GATA_CHLTE       -----------------RVPGGSSGGSAAAVANDLAMVALGSDTGGSVRQPAGFCNIIGL
GATA_CORGL       -----------------RTAGGSGGGSSAALAAGQAPLAIGTDTGGSIRQPAALTNTVGV
GATA_MYCTU       -----------------RVPGGSGGGSAAALAAFQAPLAIGSDTGGSIRQPAALTATVGV
GATA_STRCO       -----------------KIPGGSGGGSSAALAAFQAPLAIGTDTGGSIRQPASVTGTVGV
GATA_BIFLO       -----------------RVPGGSGGGSASAVAAFEAPIALGTDTGGSIRQPGALTGTVGV
GATA_DEIRA       -----------------RVPGGSSGGSAVAVAAGISPVSLGSDTGGSVRQPAALCGVYGF
GATA_THET8       -----------------RVPGGSSGGSAAALAADLAPLALGSDTGGSVRQPAAFCGVYGL
GATA_RHOBA       -----------------KTPGGSSGGAAAAVAAGAVPLSLGTDTGGSIRQPAAFCGITGL
GATA_ARATH       -----------------RVPGGSSGGSAAAVAARQCMVSLGSDTGGSVRQPASFCGVVGL
GATA_VITVI       -----------------RVPGGSSGGSAAAVSARQCVVSLGSDTGGSVRQPASFCGVVGL
GATA_ORYSI       -----------------RVPGGSSGGSASAVSARQCVVSLGSDTGGSVRQPASFCGVVGL
GATA_ORYSJ       -----------------RVPGGSSGGSASAVSARQCVVSLGSDTGGSVRQPASFCGVVGL
GATA_SORBI       -----------------RVPGGSSGGSASAVSARQCVVSLGSDTGGSVRQPASFCGVVGL
GATA_MAIZE       -----------------RVPGGSSGGSAAAVSARQCVVSLGSDTGGSVRQPASFCGVVGL
GATA_DESVH       -----------------RVPGGSSGGSAASVAAGQCFASLGTDTGGSIRQPASLCGCVGL
GATA_CHLAA       -----------------RVPGGSSGGSAAAVAAGQVPATLGTDTGGSIRQPAALCGISGL
GATA_MOOTA       -----------------RVPGGSSGGAVAAVAAGEAYFALGSDTGGSIRQPASFCGVVGM
GATA_GEOSL       -----------------CIPGGSSSGSAAAIAARSATATLGTDTGGSIRQPASHCGCVGL
GATA_THEYD       -----------------RVPGGSSGGSAAAVAADECIAALGSDTGGSIRQPASFCGVVGL
GATA_SYNY3       -----------------RVPGGSSGGSAAAVAADECLIALGSDTGGSIRQPASLCGVVGM
GATA_THEEB       -----------------RVSGGSSGGSAAAVAARECAAALGSDTGGSIRQPAAFCGVVGL
GATA_GLOVI       -----------------RVPGGSSGGSAAAVAACEAVASLGSDTGGSIRQPASFCGVVGL
GATA_PROMA       -----------------RVPGGSSGGSAAAVASGLCTAALGSDTGGSIRQPASFCGVVGL
GATA_BORPE       -----------------AVPGGSSGGSAAAVAARLVAAATGTDTGGSVRQPAALCGVSGI
GATA_BURPS       -----------------AVPGGSSGGSSAAVAARLAPAATGTDTGGSIRQPASFAGVTGI
GATA_NEIG1       -----------------HVPGGSSGGSAAVVAARLAPAALGSDTGGSIRQPASHCGITGI
GATA_NEIMB       -----------------HVPGGSSGGSAAVVAARLAPAALGSDTGGSIRQPASHCGITGI
GATA_COXBU       -----------------RVPGGSSGGSAAAVAARLVPGATGTDTGGSIRQPAALCGITGL
GATA_PSEAE       -----------------RVPGGSSGGSAAAVAARLLPAATGTDTGGSIRQPAALTNLTGI
GATA_AGRFC       --------------EQKLVPGGSSGGSAAAVAAHLCAGATATDTGGSIRQPAAFTGTVGI
GATA_BRADU       --------------NTTLVPGGSSGGSASAVAALLCMGATATDTGGSIRQPAAFTATVGI
GATA_CAUVC       --------------TKALTPGGSSGGSAAAVAADLCLGATATDTGGSIRQPAAFTGTVGI
GATA_RHOS4       --------------DRRLTPGGSSGGSAAAVAADLCLAATGTDTGGSIRQPAAFTGIVGI
GATA_RHORT       --------------DEQLVPGGSSGGSAAAVAGRLAMAATGTDTGGSIRQPAAFCGLVGL
GATA_RICPR       --------------NSDLVPGGSSGGSAAAVSAFMASAALGSDTGGSVRQPASFTGLVGF
GATA_DICDI       NNNDNDNNNNG---EVLYVAGGSSGGSAAAVASNYCVASIGSDTGGSIRQPSSYCGVVGF
GATA_HUMAN       REKRKQNPHSENEDSDWLITGGSSGGSAAAVSAFTCYAALGSDTGGSTRNPAAHCGLVGF
GATA_MACFA       REKRKQNPHSKNEDSDWLITGGSSGGSAAAVSAFTCYAALGSDTGGSTRNPAAHCGLVGF
GATA_BOVIN       REKRKQNSHSENEDSNWLITGGSSGGSAAAVSAFTCFAALGSDTGGSTRNPAAHCGVVGL
GATA_CANLF       KEKTKHKAHGENEDSNWLITGGSSGGSAAAVATFTCFAALGSDTGGSTRNPAAHCGVVGF
GATA_MOUSE       RERSRQDAG---DDSHWLITGGSSGGSAAAVAAFTCFAALGSDTGGSTRNPAAHCGIVGF
GATA_RAT         RERSRQDAQ---EDSHWLITGGSSGGSAAAVAAFTCFAALGSDTGGSTRNPAAHCGTVGF
GATA_ORNAN       RGKGSPDSSQEDQEPQWLVAGGSSGGSAAAVAAFTCFVALGSDTGGSTRNPAAHCGVVGL
GATA_XENLA       IEKRPISHHAAKDDSDWVIAGGSSGGSACAVSAGTCYLAIGSDTGGSTRNPASHCGVVGL
GATA_XENTR       IDKTSLSHHAAKDDSDWVITGGSSGGSACAVSAGTCYLAIGSDTGGSTRNPASHCGVVGL
GATA_DANRE       REQS-----AEDPDSDWTITGGSSGGSAAAVASLSSFLALGSDTGGSTRNPGSLCGVVAL
GATA_AEDAE       --------------SDFRIAGGSSGGSAVAVASGICFAALGSDTGGSTRNPASYCGVVGF
GATA_CULQU       --------------ERFRIAGGSSGGSAVAVASGVCFAALGSDTGGSTRNPASYCGVVGL
GATA_ANOGA       --------------DRFRIAGGSSGGSAVAVAAGLCYAALGSDTGGSTRNPASYCGIVGL
GATA_DROME       --------------DHWRIAGGSSGGSASAVAAGLCYAAIGSDTGGSTRNPASYCGVVGL
GATA_DROPS       --------------NNWRIAGGSSGGSASAVAAGLCFAGIGSDTGGSTRNPASYCGVVGL
GATA_IXOSC       A-------------DDWYITGGSSGGSAVAVATGCSFGALGSDTGGSTRNPASRCGVVGL
GATA_PEDHC       LCIQ--------EKNDWFIPGGSSGGSAVAVASGICLGALGSDTGGSCRNPASYCGIVGL
GATA_SCHPO       -----------------YDVGGSSGGAAAAIAADICYASVGSDTGGSIRLPAAYVGCVGF
GATA_MYCPN       -----------------LIPGGSSSGSAYAVARGIVPFSIGTDTGDSVRRPASICNIVGF
GATA_MYCGE       -----------------LIAGGSSSGSAYAVAKDIVPFSIATDTGDSIRRPASICNVVGF
                                     ***..*    :         .::**.* * *.      . 

GATA_AJECG       KPSYGHVSRWGVVAYANSLDTVGVLGSSISTIRE---------VYKTINHPD-LHDPTNL
GATA_COCP7       KPSYGLLSRWGVVAYANSLDTVGIIGANTSTVSE---------VFGVLNRYD-HRDPTSI
GATA_EMENI       KPSYGLLSRWGVIAYANSLDTVGILAKRVSVARD---------VFDVLNKHD-PRDPTSI
GATA_ASPFU       KPSYGLVSRWGVVAYANSLDTVGILAKNASTARD---------VFRIVNRHD-PRDPTNL
GATA_TUBMM       KPSYGMLSRWGVVAYANSLDTL----------------------YDAINGHD-DNDPTSI
GATA_MAGO7       KPSYGMLSRYGVVPYANSLDTVGLLARSVERIRDLVVG------EGLWAQHD-DKDPTSL
GATA_NECH7       KPSYGMISRFGVVPYANSLDTVGFLASEVKPIHDLVFK------TGLYQEHD-SSDPTSL
GATA_NEUCR       KPSYGMLSRYGVVPYANSLDTVGLLAKEVRPIAELILGGADKVTRGLWAEHD-PLDPTSL
GATA_PODAN       KPSYGMISRYGVIPYANSLDTVGFLSKQINPLKELIIG-----ERGLWKEHD-SNDPTSL
GATA_ASHGO       KPSYGRVSRHGVIAYAQSLDTVGIGARDVGLVRR---------VFEVLDRHD-PKDPTSL
GATA_YEAST       KPSYGRLSRFGVIAYSQSLDTVGILSKKINVLRK---------VFHTLDKYD-MKDPTSL
GATA_YARLI       KPSYGLISRHGVIAYAQSLDTVGILTKDIDLLEK---------VFNILNKYD-PLDPTSL
GATA_CANAW       KPTYGRISRWGVIPYAQTLDTVGIIGENVNIIKR---------VYDVLNKYD-DKDPTCL
GATA_CANAL       KPTYGRISRWGVIPYAQTLDTVGIIGENVNIIKR---------VYDVLNKYD-DKDPTCL
GATA_COPC7       KPSYGLVSRWGVVSYADSLDCVGVLARDVETTSC---------VFERISEYD-PNDPTSA
GATA_USTMA       KPSYGLVSRWGLVSYADSLDTVGVLAKTVEDVSV---------VHSVLSQND-PHDPTSA
GATA_CAMJE       KPSYGRVSRYGLASYSSSLDQIGVLTQNVEDAAI---------LYDAIAGYD-KMDSTSA
GATA_HELPY       KPTYGRVSRYGLIAYCSSFDQIGPITQNVEDASI---------LFDAISGYD-SKDSTSA
GATA_BORBU       KPSYGGLSRYGLASYASSFDQIGFFSHSIEDIAL---------ILKHTCGSD-KMDSTSV
GATA_CHLTR       KPSYGAVSRYGLVAFGSSLDQIGPLTTVVEDVAL---------AMDAFAGRD-PKDSTTR
GATA_FRATT       KPSYGSTSRFGMVAFASSFDQAGVLGHYAEDVAI---------MLDAIAGEC-EFDSTCV
GATA_METJA       KPSYGVVSRYGLCDLAMSFDQIGPLTKTAEDALL---------LTNIIKGKD-LRDTTTV
GATA_METMP       KPSYGVVSRQGLCDLAMSFDQIGPLTKNAEDALV---------LTNAIKGID-RSDSTSL
GATA_METTH       KPTYGAVSRQGLLDLAMSFDQIGPLAADVSGISL---------ALDVISGYD-PADPTTL
GATA_CENSY       KPTYGLVSRYGLVSYANSIEQIGPITRTVEDAAF---------MMDVISGAD-PNDATTI
GATA_THEMA       KPTYGLVSRYGLVAFASSLDQIGPITKTVRDAAI---------LMEIISGRD-ENDATTV
GATA_ARCFU       KPTYGLVSRYGLIPYANSLEQIGPMADSIEDLAL---------LLEVIAGKD-TRDSTNA
GATA_SACS2       KPSYGTVSRFGLVAYANSLEQIGPMARNAEDLGL---------LFSIIAGPD-ERDATTI
GATA_METAC       KPTYGAVSRYGVVAYANSLEQVGPLANNVEDIAI---------LMDVIAGYD-RRDSTSI
GATA_METHJ       KPTYGRVSRFGLIAYANSLEQIGPMARDVQTLSN---------LYSVIAGHD-SRDATSV
GATA_LEPIN       KPTYGTVSRYGLVAYASSLDQIGPFSRELQGCID---------LYSVISGKD-VRDSTSI
GATA_AQUAE       KPTYGRVSRYGLVAFASSLDQIGVFGRRTEDVAL---------VLEVISGWD-EKDSTSA
GATA_FUSNN       KPTYGRVSRYGLMAFASSLDQIGTLAKTVEDIAI---------CMNVIAGVD-DYDATVS
GATA_BACAN       KPTYGRVSRYGLVAFASSLDQIGPITRTVEDNAY---------LLQAISGLD-RMDATSA
GATA_BACCR       KPTYGRVSRYGLVAFASSLDQIGPITRTVEDNAY---------LLQAISGID-RMDATSA
GATA_BACSU       KPTYGRVSRYGLVAFASSLDQIGPITRTVEDNAF---------LLQAISGVD-KMDSTSA
GATA_LISMO       KPTYGRVSRFGLIAFASSLDQIGPITKNVEDNAY---------LLEAISGLD-ANDSTSI
GATA_STAA8       KPTYGRVSRFGLVAFASSLDQIGPLTRNVKDNAI---------VLEAISGAD-VNDSTSA
GATA_LACLA       KPTYGRVSRFGLIAFASSLDQIGPLAPTVEENAQ---------LLNVISGFD-KNDSTSS
GATA_STRR6       KPTYGTVSRFGLIAFGSSLDQIGPFAPTVKENAL---------LLNAIASED-AKDSTSA
GATA_ENTFA       KPTYGRVSRFGLIAFASSLDQIGPLTRNVKDNAL---------ALNAISGYD-EKDGTSA
GATA_LACPL       KPTYGRVSRWGLIAFGSSLDQIGPMTRTVKDNAA---------ALNMIAGND-VHDTTSS
GATA1_CLOAB      KPTYGRISRYGVVAFGSTLDQVGMFARDVEDCAL---------LTQNIAGLD-KMDFTTV
GATA_CLOBH       KPTYGRISRSGVVAFGSTLDQVGPMGKDVEDCAL---------LTSVIAGLD-KKDFTTV
GATA2_CLOAB      KPTYGLVSRFGLIAFASSLDQIGPLGKTVKDCAE---------LLEVISGED-ELDNTSS
GATA_KORVE       MPTYGRVSRYGLIAFASSLDHIGPFAKDVKDAAI---------MLEVIAGRD-PMDATSA
GATA_SALRD       KPTYGRVSRSGLVAFASSLDVIGPLTRSAEDAAT---------ILNVIAGED-ERDSTSA
GATA_CHLTE       KPTYGRISRYGLVAFASSFDQIGLLAANCDDAAL---------VLGVIAGKD-EHDATSS
GATA_CORGL       KPTYGTVSRYGLIACASSLDQGGPTARTVLDTAL---------LHEVIAGHD-AFDATSV
GATA_MYCTU       KPTYGTVSRYGLVACASSLDQGGPCARTVLDTAL---------LHQVIAGHD-PRDSTSV
GATA_STRCO       KPTYGGVSRYGMVAFSSSLDQGGPCARTVLDAAL---------LHEVIAGHD-PMDSTSI
GATA_BIFLO       KPTYGGVSRFGAIAMASSLDQIGPVSRTVLDSAL---------LQEIIGGHD-KRDSTSI
GATA_DEIRA       KPTYGRVSRYGLVAYASSLDQIGPFARSAEDLAL---------LMNVIAGHD-PRDATSL
GATA_THET8       KPTYGRVSRFGLIAYASSLDQIGPMARSVRDLAL---------LMDAAAGPD-PLDATSL
GATA_RHOBA       KPTYGRVSRYGLVAFASSLDQAGPMGWSVDDVAI---------GLQAMAGYD-PRDSTSV
GATA_ARATH       KPTYGRVSRFGLMAYASSLDVIGCFGSTVADAGM---------LLHAISGYD-RFDSTSS
GATA_VITVI       KPTYGRVSRFGLMAYASSLDVIGCFGSSVADTGI---------LLHAIAGYD-GLDSTSS
GATA_ORYSI       KPTYGRVSRFGLMAYASSLDVVGCFGSSVVDTAT---------ILSVIAGHD-KMDSTSS
GATA_ORYSJ       KPTYGRVSRFGLMAYASSLDVVGCFGSSVVDTAT---------ILSVIAGHD-KMDSTSS
GATA_SORBI       KPTYGRVSRFGLMAYASSLDVVGCFGSSVFDTAT---------ILSVVAGHD-KMDSTSS
GATA_MAIZE       KPTYGRVSRFGLMAYASSLDVVGCFGSSVFDTAT---------ILSVVAGHD-KMDATSS
GATA_DESVH       KPTYGRVSRYGLIAYGSSLDQIGPMTRTVEDAAI---------VMGVIAGHD-KRDSTCA
GATA_CHLAA       KPTYGRVSRYGLIAYGSSLDQIGPMAWTVADLAV---------LLNVIAGHD-PRDGTSA
GATA_MOOTA       KPTYGRVSRYGLVAFASSLDQIGPITRDVTDCAL---------VLEAIAGHD-PLDSTSA
GATA_GEOSL       RPTYGRVSRYGVIAYASSLDQVGPVTRDVTDCAL---------MLGAVAGHD-PLDSTSI
GATA_THEYD       KPTYGRVSRFGLVAFASSLDQIGPITKCVADAAL---------LMNVISGHD-PMDSTSA
GATA_SYNY3       KPTYGLVSRFGLVAYASSLDQIGPFARRVEDAAI---------LLQAIAGHD-SRDSTSL
GATA_THEEB       KPTYGLVSRYGLVAYASSLDQIGPLAPTVTDAAI---------LLGAIAGHD-PKDATSL
GATA_GLOVI       KPTYGLVSRYGLIAFASSLDQIGPFTRTVEDAAL---------VLQAIAGHD-PLDSTSL
GATA_PROMA       KPTYGRVSRWGLIAFASSLDQVGPFSTNVSDAAE---------ILQVIAGHD-PRDSTCL
GATA_BORPE       KPTYGTVSRYGIIAFGSSLDQAGPLAPSSRDLLE---------LLDVMTGFD-PRDATSL
GATA_BURPS       KPTYGRVSRYGMIAFASSLDQGGPMARSAADCAL---------LLNAMAGFD-ERDSTSL
GATA_NEIG1       KPTYGTVSRFGMVAYASSFDQAGPMAQTAEDCAI---------LLNAMAGFD-PKDSTSF
GATA_NEIMB       KPTYGTVSRFGMVAYASSFDQTGPMAQTAEDCAI---------LLNAMAGFD-PKDSTSL
GATA_COXBU       KPTYGRVSRYGMIAFASSLDQAGPMAQTAEDAAL---------LLNALAGHD-AKDSTSI
GATA_PSEAE       KPTYGRVSRWGMIAYASSLDQGGPLARTAEDCAL---------MLGVMAGFD-PKDSTSV
GATA_AGRFC       KPTYGRCSRFGIVAYASSLDQAGPIARDVRDAAI---------LLKTMASVD-AKDTTSV
GATA_BRADU       KPTYGRCSRWGIVAFASSLDQAGPIARSVRDSAM---------LLRSMAGHD-PKDTTSV
GATA_CAUVC       KPTYGRCSRWGVVAFASSLDQAGPIAKTVEDAAL---------LLTSMSGHD-PKDSTSL
GATA_RHOS4       KPTYGRVSRWGIVAFASSLDQAGPMTKSVRDAAI---------LLGAMAGHD-PKDSTSA
GATA_RHORT       KPTYGRCSRWGVVAFASSLDQAGPMTRTVRDAAI---------MLKAMAGHD-PMDGTSA
GATA_RICPR       KPTYGRCSRYGMVSFASSLDQAGIFTRSVLDSSI---------MLEAMMGFD-EKDSTSI
GATA_DICDI       KPSYGLISRFGLVAYASSLDTPGVLTNNVEDAAE---------LLDILIKKDQENDSTSI
GATA_HUMAN       KPSYGLVSRHGLIPLVNSMDVPGILTRCVDDAAI---------VLGALAGPD-PRDSTTV
GATA_MACFA       KPSYGLVSRHGLIPLVNSMDVPGILTRCVDDAAI---------VLGALAGPD-PKDSTTV
GATA_BOVIN       KPSYGLVSRHGLIPLVNSMDVPGILTRCVDDAAT---------VLGVLAGHD-PKDSTTI
GATA_CANLF       KPSYGLVSRHGLIPLVNSMDVPGILTRCVDDAAI---------VLGMLAGHD-PKDSTTV
GATA_MOUSE       KPSYGLVSRHGLIPLVNSMDVPGILTRCVDDTAI---------VLGTLAGHD-PKDSTTV
GATA_RAT         KPSYGLVSRHGLIPLVNSMDVPGIFTRCVDDTAI---------VLGVLAGHD-PKDSTTV
GATA_ORNAN       KPTYGLVSRHGLIPLVNSMDVPGILTRCVEDAAI---------ILEVLAGHD-PKDSTTV
GATA_XENLA       KPTYGLVSRHGLIPLVNSMDIPGILTRCVDDAAT---------VLGMLAGHD-LYDSTTV
GATA_XENTR       KPTYGLVSRHGLIPLVNSMDVPGIVTRCVDDAAT---------VLGVLAGHD-PYDSTTI
GATA_DANRE       KPSYGLLSRHGLIPLVNSMDVPGIMTRSVHDAAT---------VLRILQGRD-ERDSTTV
GATA_AEDAE       KPTYGLLSRYGLIPLVNSMDVPGILTRTVDDCLA---------VFNAIAGPD-DRDSTTI
GATA_CULQU       KPTYGLLSRHGLIPLVNSMDVPGILTRTVKDCAT---------VLNAIAGPD-ERDSTTV
GATA_ANOGA       KPTYGLVSRHGLIPLVNSMDVPGIMTRTVDDCAS---------MLNAVAGPD-VYDSTTV
GATA_DROME       KPTYGLVSRHGLIPLVNSMDVPGIFARSVSDCVA---------VLNTVAGPD-KLDSTTI
GATA_DROPS       KPTYGLVSRHGLIPLVNSMDVPGILARSVSDCVE---------VLNAVAGPD-GKDSTTI
GATA_IXOSC       KPTYGALSRHGLIPLTNSMDVPGILAKCVDDAAV---------LLSATACAD-PNDSTSV
GATA_PEDHC       KPTYGLLSRYGLIPLVNSMDVPAIMALNVEDTAC---------LLGIMMGRD-ENDSTTV
GATA_SCHPO       KPSFGRISRYGMLAFANSFDTVGIAANNVKGVTK---------VFNVLDHPD-INDSTCL
GATA_MYCPN       KPTYGLISRNGVYPYAPSLDHVGIFARYVYDVAL---------VSDEIIKHDKADFSAQK
GATA_MYCGE       KPTYGLISRNGVFPYAPSMDHVGIFAKFVSDIAI---------VSDVVIKHDKTDFSSQK
                  *::*  ** *      :::                                     :  

GATA_AJECG       PPATRTRLTAAVH---------NSSTTRSSPSPYLRIGIPTEYNI-HELSPTVRTAWQRS
GATA_COCP7       SKATRSRIDEITG---------STSKTRSER---LRIGVPIEYNI-LELDPFVRETWRKS
GATA_EMENI       SPSSRSRISSKLN---------LPQLTSRLTSRPLRIGIPLEYNI-SELAPSVRQAWCHS
GATA_ASPFU       SPRSRSRIASHLQ---------QPALLSRMTS-SLRIGVPIEYNI-SELSPSVRRAWALS
GATA_TUBMM       TPQTRERIQDRLS---------RSRRR----GQRLAIGYPEEFNL-VELDDPVRDAWENT
GATA_MAGO7       SAAARLRCASGRTG------YKGEAAKVGWEG--LTFGIPLEYNI-FELDPLIREAWEEV
GATA_NECH7       PIASRKRCAETTPS------TLPDLSK-------LNIGIPLEYNI-EELDPSIRDAWVAA
GATA_NEUCR       SHGARRRCASQRDC------YTGPLPKDPYPLKNLKFGLPLEYNI-TELSPSIRHSWSAA
GATA_PODAN       TTAARKRCAAQRRG------YRSRQGQ-TTELEGLKFGIPLEYNI-AELDPEIRDAWAAA
GATA_ASHGO       PDELRQQAAALRR-----------------EKKHLKIGIPAELLH-GSVAAEIRERLLVV
GATA_YEAST       SVELRELIEGNKK-----------------VRRPLKVGIVKEFSH-ESMPIGFHRLYLSL
GATA_YARLI       TPHKRAKLKP-PK-----------------PHRKLTFGLVKEYNI-KGISENVKMAWSQI
GATA_CANAW       PEEVRQKIPTTKK-----------------ET--LTIGVPHEFVL-KELSADVRESWEYA
GATA_CANAL       PEEVRQKIPTTKK-----------------ET--LTIGVPHEFVL-KELSADVRESWEYA
GATA_COPC7       LPETREKADALSSQRL----DELSSALAEGSLHGLRIGIPQEFFP-SELSNHVLNRFRQS
GATA_USTMA       SQQARAAAATTVETLI----SALPSSNSSQPLKGLRVGVPKEYFP-VELHPRVLPPFRRA
GATA_CAMJE       N-IEFI-KTVPNLN----------------ANKKLKIAVIENYVN-D-ADSEVKNALLKT
GATA_HELPY       N-LKPT-QTFKNLN----------------RDKRFKIAVLMDHIK-D-ASNEVQLAYENT
GATA_BORBU       D-IFDD-FYPLKIE----------------SLQGKNLAVIKELSE-DLMDKNVANSFAKF
GATA_CHLTR       D-FFKG-TFSQALS----------------LEVP-KLIGVPRGFL-DGLQEDCKENFFEA
GATA_FRATT       G-VKQN-HFTQDLE----------------KDISGKVIGVDESLI-KDLPAQIQEAVSKT
GATA_METJA       E-TKP---FEKKD------------------IKGFKVGVVKEFM--DVADEKIRDKVEKA
GATA_METMP       E-TPK---FEKKD------------------ISNYKIGVVKEFM--DVTDEKIRNEIEKG
GATA_METTH       D-SSPD-LEVERE------------------LKGLRVGVVREFL--EVTDEAIDEVIQGK
GATA_CENSY       E-CKGG-FLDGIDA----------------GIKGKKVGLITEMAG-EGIDPRVAEATRDA
GATA_THEMA       N-RKVD-FLSEIEE----------------GVSGMKFAVPEEIYE-HDIEEGVSERFEEA
GATA_ARCFU       G-REFR-FE-PEDR-------------------KLRVGIIAEMGG-NDD---VMKRFNEA
GATA_SACS2       N-LNLN-FE-LKER----------------SVKNVRIGVLSDILE-MSEKP-VSGVIKDV
GATA_METAC       D-SKTE-YQKALVD----------------DVKGLKIGVPKEFFG-EGIHPGVEKAVWNA
GATA_METHJ       D-KPYK-HN--PVS----------------DITGLKIGVPDEFFG-EGVNPNVAEVVRQA
GATA_LEPIN       HRPKFS-ASDVQPQ----------------DFKGLKVGVIKMTP---EIQSEVVKSYDKV
GATA_AQUAE       K-VPVPEWSEEVKK----------------EVKGLKIGLPKEFFE-YELQPQVKEAFENF
GATA_FUSNN       K-KEVPDYTEFLNK----------------DIKGLKIGLPKEYFI-EGLNPEIKNVVDNS
GATA_BACAN       N-VEVGNYLAGLTG----------------DVKGLRIAVPKEYLG-EGVGEEARESVLAA
GATA_BACCR       N-VEVGNYLAGLTG----------------DVKGLRIAVPKEYLG-EGVGEEARESVLAA
GATA_BACSU       N-VDVPDFLSSLTG----------------DIKGLKIAVPKEYLG-EGVGKEARESVLAA
GATA_LISMO       N-QPVERFSDSLTG----------------DIKGLRIGVPKEYLA-EGVDPGVKQAVLDA
GATA_STAA8       P-VDDVDFTSEIGK----------------DIKGLKVALPKEYLG-EGVADDVKEAVQNA
GATA_LACLA       N-VAVPDFTSKIGQ----------------DIKGMKIALPKEYFG-EGIDEKVKEQILAA
GATA_STRR6       P-VRIADFTSKIGQ----------------DIKGMKIALPKEYLG-EGIDPEVKETILNA
GATA_ENTFA       G-VSVPDFTADLTG----------------DIKGMKIALPKEYLG-EGVQPDVREAVLKA
GATA_LACPL       K-QTVPDFTAGLTG----------------DIKGMKIGLPKEYMG-DGIDPKVREVIQQA
GATA1_CLOAB      D-TPVQDYSKSLNK----------------DLKGRKIGIPKEFFE-EGLDEGVREAVKEA
GATA_CLOBH       D-KEVPDYKKSLTK----------------DIKGKRIGIPKEFFG-DGLDKNVRKSVEEA
GATA2_CLOAB      KKHEKEDYLEGIDD----------------GIKGMKIGMPKEFLN-DGLDPEIRKCIDDT
GATA_KORVE       EVAVPKYSDEIGK-----------------PVRGMKIGVAKEYFG-EGLDPEVKASVEAS
GATA_SALRD       PVDVPDYTEGLGD-----------------GVEGLRLGLPEEYFA-EGLDDDIRRMVTEQ
GATA_CHLTE       HHDVPEYDTAMDHV----------------SVDGLRIGVPRAFFP-ESLNADVAGVVKAG
GATA_CORGL       NRPVAPVVQAAREG-------------ANGDLKGVKVGVVKQFDR-DGYQPGVLEAFHAS
GATA_MYCTU       DAEVPDVVGAARAG-------------AVGDLRGVRVGVVRQLHGGEGYQPGVLASFEAA
GATA_STRCO       DAPVPAVVEAAR----------------NGSVDGMRVGVVKQFRG-EGYQAGVVQRFDES
GATA_BIFLO       PEGPRPMVAAAREG-------------AKRDLKGMKVGLIKELGG-DGFQPGVEARFNEA
GATA_DEIRA       DAPARFAVGGAD------------------SLRGLRVGVIRESLG--GNTPGVEAALGAT
GATA_THET8       DLPPRFQEALEG------------------PLPPLRLGVVREALA--GNSPGVERALEEA
GATA_RHOBA       NAEVPDFTPAMA----------------AEDVRGMRIGVLREGLDQDGISPAVRDALATA
GATA_ARATH       KQDVPEFQSQFLSVD----------HFESKPLNGVKVGIIRETLE-DGVDSGVRSATQEA
GATA_VITVI       KHEVPNYTSQFMSIS----------SLESKPLKGLRVGLIRETLD-DGVDKAVVSSIVGA
GATA_ORYSI       SHDVSDYKSELVPLD----------LLESKPLNGMRIGIIQETLG-EGVETGVISSIKDA
GATA_ORYSJ       SHDVSDYKSELVPLD----------LLESKPLNGMRIGIIQETLG-EGVETGVISSIKDA
GATA_SORBI       SQVVPDYASELVSLD----------LLESKPLAGLRIGIIQETLG-EGVANGVISSIKGA
GATA_MAIZE       SQVVPEYASELVSLD----------LLESKPLNGVRIGIIQETLG-EGVASGVVSSIKGA
GATA_DESVH       DRPVEDFAAALASRH----------DLA-----GVRIGVPAEFWG-EGLSPEVATSCRAA
GATA_CHLAA       PIDTPDYTTALT-----------------GDIRGLRIGIPREYFV-EGMEPGVESATRTA
GATA_MOOTA       DLPVPDYRSALK-----------------PEVKGLKIGVPREYFG-AGMEPEVAAIVRRA
GATA_GEOSL       DLPVPDYAAALT-----------------GQVKGLRLGLPKEYYL-EGLDPDVKRALDAA
GATA_THEYD       PIESSDFTEYLG-----------------KEVKGIKIGIPKEYFI-EGMDKEVEERIKDA
GATA_SYNY3       DVPIPDYTQALK-----------------PDLKGVKVGVIMDAFG-EGLDDTVNEAVQTA
GATA_THEEB       RVPIPDYTQALK-----------------PDLKGMRIGLIQETVG-EGVQPEVKSALEAA
GATA_GLOVI       AVNVPDYRQALI-----------------SDLKGVKVGFVKEFFA-EGLDPDVADAVFEA
GATA_PROMA       DVPVPKYSDHIS-----------------ESISGLRIGLIKECFDQEGLDLEVKKSVLKA
GATA_BORPE       QACDGQANESGRVRRGHDAAQAGYDAAGSQPLKGLRIGVPQEYFG-AGLAPDVAAAVEAA
GATA_BURPS       ERADEDYT-----RHLGKAWAAGGDAG--KPLAGLRIGLPAEYFG-AGLADDVRAAIDAA
GATA_NEIG1       EREKEDYT-----------------RDLDKPLKGVKIGLPKEYFS-EGNSTDVQTALQNT
GATA_NEIMB       EREKEDYT-----------------RDLNQPLKGLKIGLPKEYFG-EGNSADVLTALQNT
GATA_COXBU       NKNVPDYT-----------------ATLTTSLEGLKVGLPKEYFG-EGLNSSIAESIETV
GATA_PSEAE       EQPVDDYL-----------------AALQKPLSGLRIGLPREYFG-AGLDSRIADAVLAV
GATA_AGRFC       DLPVPDYEKAIGQS-----------------LKGLKIGIPREYRVDG-MPEEIEKLWAKG
GATA_BRADU       DIPVPDYEAAIGKS-----------------VKGIRIGIPKEYRLDG-MPAEIEKLWSEG
GATA_CAUVC       DIPVPDFTQFVGKS-----------------VKGLKIGIPKEYRVDN-MPAEIEKLWQDG
GATA_RHOS4       DIPVPDFEAALTGD-----------------IRGRKIGIPREYRMEG-MPAEIEALWARG
GATA_RHORT       PVEVPNFEAVLSGD-----------------IRGLRVGLPRQYRPEG-LDPEIAALWDRG
GATA_RICPR       NAQVPELQSAIGSS-----------------MKNMKIGVPLSLGEGGIIEHDIMKMWHDT
GATA_DICDI       EFINNNQNQNQNNGEKRNILDEFNEKLKNKNIKDLVFGIPKDYLV-KELDTDILNLWKEV
GATA_HUMAN       HEPIN-KPFMLPSL---------------ADVSKLCIGIPKEYLV-PELSSEVQSLWSKA
GATA_MACFA       HDPIN-KPFMLPSL---------------ADVSKLCIGIPKEYLI-PELSSEVRSLWSKA
GATA_BOVIN       QDPV--KPFTLPSL---------------TDVSKLCIGIPKEYLT-PELSSEVQSLWSKA
GATA_CANLF       QDPV--KPFTLPSL---------------TDVSKLCIGIPKEYLT-PELSSEVQSLWSKA
GATA_MOUSE       RNPA--QPASVPGG---------------MDVSRLCIGIPKEYLV-PELSSEVRSLWSQA
GATA_RAT         NDPV--KPTTLPSV---------------PDVSGLCIGIPKEYLV-PELSSEIRSLWSQA
GATA_ORNAN       QDLV--SPLALPSS---------------VDISKLCIGIPKEYRA-EGLSCETQAFWTRA
GATA_XENLA       QDPF--QPFSLPET---------------IDLSNLCIGIPKEYHA-PGLSTEILSLWSKT
GATA_XENTR       QDPF--QPFSLPEK---------------VDVRNVCIGIPKEYHA-PGLSAEILSLWSET
GATA_DANRE       QAPN--TPPSLPEH---------------FDMRKICVGIPKEYHA-PGLSEDTLAQWSRV
GATA_AEDAE       KTFFKPISLPDASK---------------ICLKGLKVGIPIEYHC-EGLSDEVLTTWTKV
GATA_CULQU       KKPFKPVELPES-----------------ICLKGLRIGIPVEYHC-EGLSEEVLHTWAKV
GATA_ANOGA       KRPFESIAPLEK-Q---------------MSLKGVRIGIPIEYHC-DGLEKEVLETWTVI
GATA_DROME       RQPFTRLHLPEVGQ---------------IDLSTVRIGIPKEYHC-HGLSAEVLETWSKV
GATA_DROPS       RQPFTKLQLPEVDG---------------LDLQTVRIGIPKEYHC-NGLSAEVLETWTKV
GATA_IXOSC       SAPDSVRHLKLAGE---------------PSLKGVKIGVPKEYHC-PGMCPEVLDLWRDV
GATA_PEDHC       SKNL--NLALNYSS---------------SSVKGLKIGIPAEYNC-QGLSDEIRSAWNDI
GATA_SCHPO       TKEARYFVKEQHKKLS---------------RKPIKIGIPIDWNV-SETHPNVLDKWNEF
GATA_MYCPN       SPDAGKFTRSLKES----------------FNKQIKIGYLKPLEEWFDIELSKKWNSLKE
GATA_MYCGE       SPDENQFFNELAIP----------------FTRSIRFGYLKPLEKLFNKHLQKKWNNLKK
                                                     .                       

GATA_AJECG       IVHLQRMGHTILPVSLPATKHALAAYYVLAPAEASSNLARYDGVRYGTR-----------
GATA_COCP7       IQHLKNQGHTVHPVSLPATKQALSAYYVLAPAEASSNLAKYDGVRYGTR-----------
GATA_EMENI       LEYLRQQGHTIQPVSLPMTKLALSAYYVLAPAEASSNLAKYDGVRYGTR-----------
GATA_ASPFU       IAFLREQGHTIHPVSLPTTKLALSAYYVLAPAEASSNLAKYDGIRYGSR-----------
GATA_TUBMM       LAHLNSQSHRIAPVSLPHTKHALSAYYVLAPAEASSNLAKYDGVRYGYR-----------
GATA_MAGO7       AALLQSLGANVVPVSLPTTRQALSAYYVLAPAEASSNLAKYDGVRYGNP-----------
GATA_NECH7       ASALEAQGATLVPISLPSTTEALCAYYVLAPAEASSNLAKYDGVRYGKR-----------
GATA_NEUCR       AAKLQSLGARLVPVSLPSTRHALSAYYVIAPAEASSNLAKYDGIRYGTRFTSPTESDAAI
GATA_PODAN       AKRLQDAGARIVPVSLPTTKHALAAYYVIAPAEASSNLAKYDGVRYGAR-----------
GATA_ASHGO       LDKLQAQGHELYPVSVPAVKNSLLVYYMLAPAEAASNLARYDGIRYGCR-----------
GATA_YEAST       LEKLINLGLEIYPVSIPSVKNCLPIYYTLSPAEAASNLSRYDGIRYGYR-----------
GATA_YARLI       MDELIKMGHEVVTCSIPAIKNALPAYYAIAPAEASSNFARFDGIRYGSR-----------
GATA_CANAW       LSKICKLGHLVKPISIKTIKKALPSYYTLATAEAASNLSRYDSIRYGYN-----------
GATA_CANAL       LSKTCKLGHLVKPISIKTIKKALPSYYTLATAEAASNLSRYDGIRYGYN-----------
GATA_COPC7       VQLLKERGAQIIPVSLPSTSYSLSAYYVLASAEASSNMARYDGIQYGERIPTQ-------
GATA_USTMA       VAGLEELGAQVVQITLPSTPSALSAYYIISSAEASSNLARYDGVEYGFHTPSA-------
GATA_CAMJE       IDMLKANGHEIVYKNLLDSKFDIAAYYIIATAEASANLSRYDGVRYGKRSE---------
GATA_HELPY       LKALKEMGHEIVEKKMLDSHYQISIYYIISMAEASSNLARFDGVRYGRRAQ---------
GATA_BORBU       KLDLLSKGINIKEVSIEEINFILSIYYIISPVEASSNLARYTGLCYGKRIS---------
GATA_CHLTR       LAVMEREGSRIIDVDLSVLKHAVPVYYIVASAEAATNLARFDGVRYGHRCA---------
GATA_FRATT       LDNFKKLGAEIKSVKVPDLKEALSTYYIITPAEAAANLARYDGIRYGYRNP---------
GATA_METJA       IEVFKDLGCEIVELSYKYVDLALPTYYLINYVEFFSSTRRYDGRRYGYKI----------
GATA_METMP       IEVFKDMGCKIVDLSYKYIDLALPTYYLINYVEFFSATRKYDGRRYGEFI----------
GATA_METTH       LGAMEDEGAEIVELDFGYIDLCLPTYYLINYVEFFSATRKYDGRKYGHRI----------
GATA_CENSY       MAALEDAGARCGKVSLDMVKYSVAAYYTITATEAASNLARYDNTMYGYDMP---------
GATA_THEMA       LKLLERLGAKVERVKIPHIKYSVATYYVIAPAEASSNLARFDGVKYGLRIK---------
GATA_ARCFU       VEVIR-EKHEVGEVSMPSFKYALAAYYIIAMSEASSNLARYDGVRYGFALE---------
GATA_SACS2       VNKLSSEGALIEDTKLGNAEYALPAYYIIAMSEASSNLARYDGVRYGYSKY---------
GATA_METAC       IHKFESLGATRQEVSMPNINYALASYYIIAMSEASSNLARFDGTRYGFRAN---------
GATA_METHJ       IDTLESMGATAVPCTIPSMKYALSAYYVTCTSEASSNLARFDGVRYGPAVG---------
GATA_LEPIN       LNQLKEKGATLVDLDFSKFGFAIPIYYIIATAECSSNLSRFDGIRFGSRKD---------
GATA_AQUAE       IKELEKEGFEIKEVSLPHVKYSIPTYYIIAPSEASSNLARYDGVRYGYRAK---------
GATA_FUSNN       VKALKELGAEVVEISLPHTKYAVPTYYVLAPAEASSNLARFDGIRYGYRAK---------
GATA_BACAN       LKVLEGMGATWEEVSLPHSKYALATYYLLSSSEASANLSRFDGVRYGVRSD---------
GATA_BACCR       LKVLEGMGATWEEVSLPHSKYALATYYLLSSSEASANLSRFDGVRYGVRSD---------
GATA_BACSU       LKVLEGLGATWEEVSLPHSKYALATYYLLSSSEASANLARFDGIRYGYRTD---------
GATA_LISMO       LKTLEKLGATWDEVSLPHSEYGVASYYILASSEASSNLSRFDGVRYGYRSP---------
GATA_STAA8       VETLKSLGAVVEEVSLPNTKFGIPSYYVIASSEASSNLSRFDGIRYGYHSK---------
GATA_LACLA       AKHLEKLGAIVEEVSLPHSKYGVAVYYIIASSEASSNLQRFDGIRYGYRAQ---------
GATA_STRR6       AKHFEKLGAIVEEVSLPHSKYGVAVYYIIASSEASSNLQRFDGIRYGYRAE---------
GATA_ENTFA       AETFKALGATVEEVSLPHSKYGIAAYYIIASSEASSNLQRFDGIRYGYRSE---------
GATA_LACPL       VKQFEDLGATVEEVSLPNSRYGVAAYYIIASSEASSNLQRFDGIRYGFRAD---------
GATA1_CLOAB      IKVFEENGAEVKECSLPLSDYALAAYYIISSAEASSNLARFDGVRYGYRDA---------
GATA_CLOBH       IKVLEANGAEVKPCSLPLMDYALSAYYIISSAEASSNLARFDGIRYGYRSK---------
GATA2_CLOAB      IEKLKSLGAEVCEMSLPITEEGLSAYYIISSAEASSNLARFDGIRYGYRPD---------
GATA_KORVE       IQNLAKAGAEIIEVSLPHTKYAIPTYYLVATAEASSNLARFDGVRYSHRSK---------
GATA_SALRD       VDRLDDAGATVEEVSLPHTEYGVATYYLVATAEASSNLARYDGIRYGHRADLQETKQALQ
GATA_CHLTE       LKKLEEAGAELVEIDLPESDYAIAAYYILVTAEASSNLARFDGARYGYRSP---------
GATA_CORGL       VEQMRSQGAEIVEVDCPHFDDALGAYYLILPCEVSSNLARFDGMRYGLRAGDDG------
GATA_MYCTU       VEQLTALGAEVSEVDCPHFDHALAAYYLILPSEVSSNLARFDAMRYGLRVGDDG------
GATA_STRCO       VELLKSLGAEIVELDCPSFDLALSAYYLIAPSECSSNLARFDGLRYGARVGDDG------
GATA_BIFLO       VDKLKEMGAEVVEVSVPHIGYSLGAYYIIMPSEVSSNLARYDGMRYGLRVMPPTGV----
GATA_DEIRA       LDALRGAGAVVGEVSIPELEYAIAAYYLIAMPEASSNLARYDGMVYGERVPGGD------
GATA_THET8       LKVFRELGLSVREVSWPSLPQALAAYYILAPAEASSNLARYDGTLYGRRAAGEE------
GATA_RHOBA       ESVFREQGAEIVEVELPHSKYWVPTYYVIAPCEASSNLSRFDGAHYGYRVADAEIAAAD-
GATA_ARATH       ASHLEALGCILTEVSLPSFSLGLPAYYVIASSESSSNLSRYDGVRYGNQVMA--------
GATA_VITVI       ASHLEELGCTVTEVSLPSFSLGLPAYYILASSESSSNLSRYDGVRYGSQVGA--------
GATA_ORYSI       ASHLEQLGSVVEEVSLPSFSLGLPAYYILASSEASSNLSRYDGIRYGRQVSG--------
GATA_ORYSJ       ASHLEQLGSVVEEVSLPSFSLGLPAYYILASSEASSNLSRYDGIRYGRQVSG--------
GATA_SORBI       ASHLEQLGSVVEEVSLPSFSLGLPAYYILASSEASSNLSRYDGIRYGRQFSA--------
GATA_MAIZE       ASHLEQLGSVVEEVSLPSFSLGLPAYYILASSEASSNLSRYDGIRYGGQVSA--------
GATA_DESVH       LDAARDLGATIVDVALPHTPQSIAAYYIVASAEASSNLARYDGVRYGKRAHAP-------
GATA_CHLAA       IEVLRDLGAILVDVSLPHTRYALPTYYIIAPAEASANLARFDGVRYGFRAEGE-------
GATA_MOOTA       IAKLEELGAVCEETSLPHTEYALPAYYLVAPAEASSNLARYDGVSYGLRVPGK-------
GATA_GEOSL       IETYRGLGAEFVEVSLPHTDYAVATYYLIATAEASSNLARYDGVRFGHRAAGAA------
GATA_THEYD       IKELESLGCIPVEISLPHTEYAVATYYIIATSEASSNLARYDGVKYGLRVQGK-------
GATA_SYNY3       IAKLRELGATIEEIHCPRFRSGIAAYYVIAPSEASANLARYDAVRYGLRAE-AD------
GATA_THEEB       LKTLEALGATLVELSCPRFAYGLPTYYIIAPSEASANLARYDGVNFGFRAEGAS------
GATA_GLOVI       IEVMRDLGAQIQEVSCPRFARGLSTYYIIATSEASANLARYDGVKYGLRDREAD------
GATA_PROMA       ADQLQSLGAELIEVSCPRFTDGIATYYVIAPSEASANLARYDGVKYGYRAKEVD------
GATA_BORPE       LAQFEQLGAVRVPVSLPRTELAIPAYYVIAPAEASSNLARYDGVRYGHRAAQ--------
GATA_BURPS       LKTYEALGATLVPVSLPKTELSIPVYYVIAPAEASSNLSRFDGVRYGHRAAE--------
GATA_NEIG1       IDLLKAQGAELVEVSLPQTKLSIPAYYVLASAEAGTNLSRYDGVRYGHRAAQ--------
GATA_NEIMB       IDLLKAQGAELIEVSLPQTKLSIPAYYVLASAEASTNLSRYDGVRYGHRAAQ--------
GATA_COXBU       KKTLEKMGATFIEIQLPHTDFAAPAYYVLAPAECSSNLARYDGVRYGYRCDK--------
GATA_PSEAE       VEELKTLGATVKDISLPNMQHAIPAYYVIAPAEASSNLSRFDGVRYGYRCDA--------
GATA_AGRFC       VEWLRDAGAEVVDISLPHTKYALPAYYIVAPAEASSNLARYDGVRYGLRV----------
GATA_BRADU       AAWLKAAGAELVEVSLPHTKYALPAYYIVAPAEASSNLARYDGVRYGLRE----------
GATA_CAUVC       IAWLKEAGCEIVDISLPHTKYALPAYYIVAPAEASSNLARYDGMRYGLRE----------
GATA_RHOS4       REMLADAGAEIVDISLPHTKYALPAYYVIAPAEASSNLARYDGVRYGHRARLG-------
GATA_RHORT       AEMLKDAGATLVEVDLPHTKYALATYYIVAPAEASSNLARYDGVRYGLRV----------
GATA_RICPR       IELLKNAGAEIVDITLPHAKYGVAVYYVIAPAEAASNLSRYDGVRYGLRVEC--------
GATA_DICDI       VEEIEKRGGKVVSVSLPHTRYALPAYYLLATSEASSNLSRFDGVRYGYRFEEEKDENKVD
GATA_HUMAN       ADLFESEGAKVIEVSLPHTSYSIVCYHVLCTSEVASNMARFDGLQYGHRCDIDVS-----
GATA_MACFA       ADLFESEGAKVLEVSLPHTSYSIVCYHVLCTSEVASNMARFDGLQYGHRCDINVS-----
GATA_BOVIN       ANLFESEGAKVTEVSLPHTSYSIVCYHVLCTSEVASNMARFDGLEYGHRCDSDVS-----
GATA_CANLF       ANLFESEGAKVIEVSLPHTSYSIVCYHVLCTSEVASNMARFDGLEYGHRCDIDVS-----
GATA_MOUSE       ADLFESEGAKVIEVSLPHTCYSIVCYHVLCTSEVASNMARFDGLQYGHRSGVDVS-----
GATA_RAT         ADLFEAEGARVIEVCLPHTCYSIVCYHVLCTSEVASNMARFDGLQYGHRSAVDMSS----
GATA_ORNAN       ADLFQSAGARVIEVSLPHTSYSIDCYHVLCTAEVASNMARFDGLEYGHRCNRDVS-----
GATA_XENLA       ADLLEKAGAKVMEVSLPHTPYSIVCYHVLCTAEVASNMARFDGLEYGHRSDIDDS-----
GATA_XENTR       ADLLENAGAKVVEVSLPHTPYSIVCYHVLCTAEVASNMARFDGLEYGHRSDIDDS-----
GATA_DANRE       ADIFENAGARVKEVSLPHTPYSIVCYHVLCCCEVASNMARFDGLEYGHRSAVDSS-----
GATA_AEDAE       ADMLEDAGASVHPVSLPYTSASIFVYSILNQCEVASNMARYDGIEFGHRSDEDAS-----
GATA_CULQU       ADMLEDAGATVTSVSLPYTSASIFVYSILNQCEVSSNMSRYDGIEFGLRSDEDAS-----
GATA_ANOGA       ADMLESAGATVKAVSLPNTASSIFVYSILNQCEVASNMSRYDGIEYGHRSQEDSS-----
GATA_DROME       ADLLECSGASVRQVSLPNTAASIFVYTILNQCEVASNMARYDGIEYGHRATDERS-----
GATA_DROPS       ADLLECAGASVQQVSLPNTAASIFVYSILNQCEVASNMARYDGIEFGHRAADERS-----
GATA_IXOSC       ADRLAALGAVVSSVSLPHSRYSTECYSVLNCCEVASNFARYDGLEYGHRASDDSS-----
GATA_PEDHC       AKVLYQGGASIVPVSMPHTKYSIVCYSILNQCEVASNMARYDGIEFGLRSKEKGN-----
GATA_SCHPO       ISLLKSNGYLVQEIQLPISLYANSVYSTMAYAEATSNLAKYNTIAFGNCLDEKF------
GATA_MYCPN       RITLEGCELIPFHFPLELLEVIDPVYKLISYSEAVSCYSNLTGIVFGQKLFEPNQ-----
GATA_MYCGE       TLEQKNYQLIPLDFDVELLKVIDSIYKIISYSEAVSCYSNLTGIVFGQKVFEPNS-----
                                          *      *  :   .     :.             

GATA_AJECG       -------------------------DTDAPDDAEPGGYLYASSRGKGLGSEVKRRILLGA
GATA_COCP7       -------------------------DLDSPDNT--GGYLYARSRGSGFGPEVKRRIVLGA
GATA_EMENI       -------------------------SDDS-TENQSETYLYAKTRGAGFGPEVKRRIMLGA
GATA_ASPFU       -------------------------CNSPDSGGQPESYLYAKTRGDGFGLEVKRRILLGA
GATA_TUBMM       -------------------------DPADRSQD---GLLFSPTR-ANFGAEVRRRIIAGA
GATA_MAGO7       ----------------------------GPESENEGGVLYSAARGAGFGDEVKRRILLGA
GATA_NECH7       ----------------------------GEGSDAVGETLYSDTRGAGFGDEVKRRILLGT
GATA_NEUCR       S------------------------EGPEGREEEEEGILYARARTAGFGDEVKRRILLGA
GATA_PODAN       -------------------------DAEGASDASAGGVLYASTRGKGFGEEVKRRILLGS
GATA_ASHGO       ----------------------------DEDLDMSDEVLFAPTRGK-FGKEVKNRIVLGN
GATA_YEAST       ----------------------------DSELDIKDGILFAPTRSK-FGTEVKNRIILGN
GATA_YARLI       ----------------------------APEDRGEHGTLYAPTRQEYFGNEVKRRMWLGT
GATA_CANAW       ----------------------------TNESVNSPIELIATNRSDGFGSEVQRRILLGN
GATA_CANAL       ----------------------------TNELVNSPIELIATNRSDGFGSEVQRRILLGN
GATA_COPC7       ----------------------------DPSDLKKVSTVYARTRSSTFGPEVQRRILLGT
GATA_USTMA       ----------------------------PGH------HAYAATRTTAFGDEVRKRILLGT
GATA_CAMJE       -------------------------------NIQNLKEMYVNTRSEGFGEEVKRRILLGT
GATA_HELPY       -------------------------------NIKDLKELYLKSRSEGFGDEVKRRIMLGN
GATA_BORBU       -------------------------------EGLSLNDFYFKHRSNFLSEEVKRRIVLGN
GATA_CHLTR       -------------------------------QADNMHEMYARSRKEGFGKEVTRRILLGN
GATA_FRATT       -------------------------------EARDLDELYRKSRTDGFGAEVKRRIMIGN
GATA_METJA       --------------------------------------------EEVCGEEVLRRIMIGS
GATA_METMP       --------------------------------------------EEACGEEVLRRILIGK
GATA_METTH       --------------------------------------------EDVCGSEVLRRIHMGS
GATA_CENSY       -------------------------------IESYEFHSYISKARRKFGPEVTRRMILGG
GATA_THEMA       --------------------------------EKGLREMYMKTRNVGFGEEVRRRIMIGT
GATA_ARCFU       -------------------------------KLDSWRRYFSKVRAEGFGDEVKRRIMLGS
GATA_SACS2       -------------------------------MEGNWREVYAKNRGEAFGMEVKRRILLGS
GATA_METAC       -------------------------------GE-NWHAMVSKTRAEGFGTEVKRRILLGT
GATA_METHJ       -------------------------------TLKSWHDAYSEQRKAGFGKEVRRRIILGT
GATA_LEPIN       -------------------------------KTGKLEDLFVDSRTEGFGPEVKRRILLGT
GATA_AQUAE       -------------------------------EYKDIFEMYARTRDEGFGPEVKRRIMLGT
GATA_FUSNN       -------------------------------DYTDLESLYVKTRSEGFGAEVKRRIMIGT
GATA_BACAN       -------------------------------NVNNLMDLYKNTRSEGFGDEVKRRIMLGT
GATA_BACCR       -------------------------------NVNNLLDLYKNTRSEGFGDEVKRRIMLGT
GATA_BACSU       -------------------------------NADNLIDLYKQTRAEGFGNEVKRRIMLGT
GATA_LISMO       -------------------------------NATTLEELYTKTRSEGFGDEVKRRIMLGT
GATA_STAA8       -------------------------------EAHSLEELYKMSRSEGFGKEVKRRIFLGT
GATA_LACLA       -------------------------------DIKNLEDLYVKSRSEGFGPEVQRRIMLGT
GATA_STRR6       -------------------------------DATNLDEIYVNSRSQGFGEEVKRRIMLGT
GATA_ENTFA       -------------------------------NVQNLEDVYVNSRSEGFGTEVKRRIMLGT
GATA_LACPL       -------------------------------DVKNLEDVYVRSRSEGFGDEVKRRIMLGT
GATA1_CLOAB      -------------------------------EAENALDLYVKSRSKGFGEEAKRRIMLGT
GATA_CLOBH       -------------------------------NFKDAKDIYLKSRSEGFGDEVKRRIMLGT
GATA2_CLOAB      -------------------------------DFEDVYDLMETSRSEAFGDEVKRRIMLGT
GATA_KORVE       -------------------------------EAKTLSEMYRKSRDEGFGAEVKRRIILGT
GATA_SALRD       ERREELKEELASARAQGDEARADTLEAQLDDEQSTLDALYTRSRTEGFGDEVKRRIMLGT
GATA_CHLTE       -------------------------------DSPDLSSMYVNSRTEGFGAEVKRRIMLGT
GATA_CORGL       --------------------------------TRSADEVMAYTRAQGFGPEVKRRIILGT
GATA_MYCTU       --------------------------------TRSAEEVMAMTRAAGFGPEVKRRIMIGT
GATA_STRCO       --------------------------------THSAEEVTSLTREAGFGPEVKRRIMLGT
GATA_BIFLO       --------------------------------PQTAANMMAYTREAGFGDEVKRRIILGT
GATA_DEIRA       -----------------------------------VTRSMTLTREQGFGQEVQRRILLGT
GATA_THET8       -----------------------------------VEGMMEATRAL-FGLEVKRRVLVGT
GATA_RHOBA       --------------------------------SGPLEAMYSLSRAGGFGSEVKRRIMVGT
GATA_ARATH       ---------------------------------EELNKLYECSRGEGFGGEVKMRILMGT
GATA_VITVI       ---------------------------------DRLNSLYGDSRAKGFGPEVKMRILTGT
GATA_ORYSI       ---------------------------------DDLNELYGGSRANGLGHEVKMRILMGT
GATA_ORYSJ       ---------------------------------DDLNELYGGSRANGLGHEVKMRILMGT
GATA_SORBI       ---------------------------------DDLNELYGESRANGLGHEVKMRILMGT
GATA_MAIZE       ---------------------------------DDLNELYGESRANGFGHEVKMRILMGT
GATA_DESVH       ---------------------------------EDLMDLYVRSRSEGLGDEVQRRIMLGT
GATA_CHLAA       ----------------------------------TMWEQIEQTRGQGFGPEVRRRIMLGT
GATA_MOOTA       ----------------------------------DIIEMYMNTRSQGFGPEVKRRIMLGT
GATA_GEOSL       ----------------------------------NLIDMFRRSRAEGFGAEVKRRIMIGT
GATA_THEYD       ----------------------------------DLLEMYMKTRSRGFGTEVKRRIMLGT
GATA_SYNY3       ----------------------------------NLMEMYTHTRAKGFGAEVKRRIMLGT
GATA_THEEB       ----------------------------------DLLEMYMKTRAQGFGAEVKRRIMIGT
GATA_GLOVI       ----------------------------------ALVPMYGRTREEGFGSEVKRRIMLGT
GATA_PROMA       ----------------------------------NLSDMTAFTRARGFGSEVQRRILIGT
GATA_BORPE       --------------------------------YGDLNEMISRSRAEGFGDEVKRRILIGT
GATA_BURPS       --------------------------------YRDLLDMYKKSRAEGFGPEVKRRILVGT
GATA_NEIG1       --------------------------------FGDLEEMYGKTRAEGFGSEVKRRIMIGT
GATA_NEIMB       --------------------------------FADLEEMYGKTRAEGFGSEVKRRIMIGT
GATA_COXBU       --------------------------------PVDLDDLYKRSRTEGFGSEVKRRIMIGT
GATA_PSEAE       --------------------------------PQNLEDLYKRSRAEGFGSEVKNRIMVGT
GATA_AGRFC       -------------------------------DGKDIADMYEKSRAAGFGKEVQRRIMVGT
GATA_BRADU       -------------------------------QGKNIIELYENTRAEGFGAEVRRRVMIGT
GATA_CAUVC       -------------------------------EGANLTEIYENTRASGFGDEVKRRILIGT
GATA_RHOS4       -------------------------------QGDGIVDMYEKTRAEGFGKEVQRRVMIGT
GATA_RHORT       -------------------------------PGETLDEMYCKTRAAGFGEEVRRRVLIGT
GATA_RICPR       -------------------------------ENMTLDEMYEMTRSAGFGEEVKRRIMLGT
GATA_DICDI       NDNDDDDDVDE------------------NKIGMGLKDMYTKTRTNGFGEEVKKRIILGT
GATA_HUMAN       -----------------------------------TEAMYAATRREGFNDVVRGRILSGN
GATA_MACFA       -----------------------------------TEAMYAATRREGFNDVVRGRILSGN
GATA_BOVIN       -----------------------------------TEAMYAATRREGFNDVVRGRILSGN
GATA_CANLF       -----------------------------------TEAMYAATRREGFNDVVRGRILSGN
GATA_MOUSE       -----------------------------------TEAMYAATRQEGFNDVVRGRILSGN
GATA_RAT         -----------------------------------TEALYAATRQEGFNDVVKGRILSGN
GATA_ORNAN       -----------------------------------TEAMYAATRREGFNDVVRGRILSGN
GATA_XENLA       -----------------------------------TEAMYAATRREGFNDVVRGRILSGN
GATA_XENTR       -----------------------------------TEALYAATRREGFNEVVRGRILSGN
GATA_DANRE       -----------------------------------TDAMYATTRHEGFNNVVRRRILSGN
GATA_AEDAE       -----------------------------------TEQLYAKSRAEGFNGVVKNRILSGN
GATA_CULQU       -----------------------------------TEQLYARSRAEGFNGVVKNRILTGN
GATA_ANOGA       -----------------------------------TEQLYARTRAEGFNGVVKNRILSGN
GATA_DROME       -----------------------------------TEQLYALSRAEGFNDVVKTRILTGN
GATA_DROPS       -----------------------------------TEQLYAQSRAEGFNDVVKTRILTGN
GATA_IXOSC       -----------------------------------TDALYAASRHEGLNEVVRGRILAGN
GATA_PEDHC       -----------------------------------RKNSYVTTRYSGFNEVVRSRIIAGN
GATA_SCHPO       ----------------------------------EEEIISSTARSFFLGDEVKKRLLLGA
GATA_MYCPN       --------------------------------ASDFSKTITANRDRFFGEQLKRRFIIGA
GATA_MYCGE       --------------------------------PSNFDQTITRNRDQFLGKQLKRRFVIGA
                                                                 .     *.  * 

GATA_AJECG       FSLSADAIDNYFLQA-QRVRRLVQADFERVFRVKNPLL----------------PAVDVD
GATA_COCP7       FSLSAEAIDNYFIQA-QKVRRLVQSDFNKVFRLHNPLL----------------QATLTS
GATA_EMENI       FSLSAQAIDNYFIQA-QRIRRLVRHDFDAAFQAEHPLA----------------AEIR-N
GATA_ASPFU       FSLSADAINNYFIQA-QRVRRLVQHDFNAVFRAEQPIS----------------PSRQ-K
GATA_TUBMM       YSLSSEAIDNYFLKA-QSARRIIQRDFSNAFAQPNYLI----------------TDNL--
GATA_MAGO7       YSLSSEAMDNYFVQA-QKVRRLVRGDFDRVFLLDNPLVDKEPTEEGFGEEAEQADLADLH
GATA_NECH7       YSLSSEAMDNYFIQA-QKVRRMVQQDFDRVFRLDNPLY-----------EPAQFDLSDMA
GATA_NEUCR       YTLSSAAMDNYFLKA-QKVRRLVRRDFNRVFALPNPLLDKP----------ERFELSELP
GATA_PODAN       YTLSSEAMDNYFIKA-QRVRRLVRRDFNRVFALENPLQER-----------ETFELSDLP
GATA_ASHGO       YNLCSGAFKNNYMKA-QKLRVELINQFDSIFAFENICT----------------------
GATA_YEAST       YNLCSDAFKNNFIKA-EKLRVNLIDEFDGIFRFPNVLT----------------------
GATA_YARLI       WNLSTDAFNHDYIRS-QKIRRILQEDFDEVFNRPNVLS----------------------
GATA_CANAW       YTLSSDS-GDHYLRA-TQIREELCAEFSSIFNNSHVLL----------------------
GATA_CANAL       YTLSSDS-GDHYLRA-TQIREELCAEFSSIFNNSHVLL----------------------
GATA_COPC7       YALTADAFDNYFLQA-QRVRQLIKDDFDRVFAMPNVRYAQP-------------------
GATA_USTMA       FALTADAYDNYFLQA-SRVRAQVQEDFASALRIRNASTKD--------------------
GATA_CAMJE       FVLSSGYYDAYYIKA-QKARAFIKAKYEEILQ----------------------------
GATA_HELPY       FVLSSGYYDAYYLKA-QQMRLIIKEQYNKIFE----------------------------
GATA_BORBU       YLLSERYDSKYYAKACEILQNLIIPKFNKLFE----------------------------
GATA_CHLTR       YVLSAERQNIFYKKG-MAVRARLIDAFQAAFE----------------------------
GATA_FRATT       YVLASSQYDSYYNKA-QQLRKVMTDQINQIFT----------------------------
GATA_METJA       MISQKEYSGKYYKNA-LKARNLMRNEMIKIMK----------------------------
GATA_METMP       HISEQEFSGKYYKKA-LQARKSMKKEMLGLFN----------------------------
GATA_METTH       YISQKELSGKYYKRA-LQARSLIRREITGLLS----------------------------
GATA_CENSY       FVSSSGHGGRYYHRA-LKVRGLLAREAEEALA----------------------------
GATA_THEMA       FTLSAAYYEAYFNKA-MKVRRKISDELNEVLS----------------------------
GATA_ARCFU       YALSAGYYGKYYLKA-QKVRTLVIRDFKKAFE----------------------------
GATA_SACS2       FILSAGYYEEFYLKA-LKVRNLIKKNLDELFK----------------------------
GATA_METAC       YALSAGYHDKYYLKA-LKVRTLVKQDFDKALS----------------------------
GATA_METHJ       FSLAAGYYGRYYQKA-QTARQMVRDDFERIFR----------------------------
GATA_LEPIN       FSLSAGYYDAYYGTA-QKARALIRKEYESFFS----------------------------
GATA_AQUAE       FALSAGYYDAYYLKA-QKVRRLITNDFLKAFE----------------------------
GATA_FUSNN       YVLSAGFYDAYFKKA-QKVRTLIKQDFENVLN----------------------------
GATA_BACAN       FALSSGYYDAYYKKA-QQVRTLIKNDFENVFA----------------------------
GATA_BACCR       FALSSGYYDAYYKKA-QQVRTLIKNDFENVFA----------------------------
GATA_BACSU       FALSSGYYDAYYKKA-QKVRTLIKKDFEDVFE----------------------------
GATA_LISMO       YALSSGYYDAYYKKA-QQARTLIKQDFINVFE----------------------------
GATA_STAA8       FALSSGYYDAYYKKS-QKVRTLIKNDFDKVFE----------------------------
GATA_LACLA       FSLSAGSYDKHFKKA-GQVRTLIINDFAKVFE----------------------------
GATA_STRR6       FSLSSGYYDAYYKKA-GQVRTLIIQDFEKVFA----------------------------
GATA_ENTFA       FSLSAGYYDAHFKKA-GQVRTLIKQDFENVFA----------------------------
GATA_LACPL       FSLSAGYYDAYFHKA-GQVRTMIINDFNKVFE----------------------------
GATA1_CLOAB      YVLSKGYYDAYYKKA-LKVRSLIKNDFQRAFK----------------------------
GATA_CLOBH       YVLSAGYYDAYYKKA-LKVRKLIKDDFQRVFK----------------------------
GATA2_CLOAB      YALSSGYYDAYYKRA-LKLKKKIKNEFKEAFE----------------------------
GATA_KORVE       YALSAGYYDAYYLKA-QKVRTLLAQDFDEAFA----------------------------
GATA_SALRD       YALSAGYYDKYYEKA-QRVRTLIRHDFERAFE----------------------------
GATA_CHLTE       YVLSAGYYDTYYKKA-QQVRRVFQDKYREAFE----------------------------
GATA_CORGL       YALSVGYYDAYYLQA-QRVRTLIAQDFAKAYE----------------------------
GATA_MYCTU       YALSAGYYDAYYNQA-QKVRTLIARDLDAAYR----------------------------
GATA_STRCO       YALSSGYYDAYYGSA-QKVRTLIKQEFERAFE----------------------------
GATA_BIFLO       YALSAGYYDAWYGSA-QKVRTLIIEDFKKAFE----------------------------
GATA_DEIRA       YALSSGYYDAYYAKA-MKVRRLIADEFTTAFG----------------------------
GATA_THET8       FVLSSGYYEAYYGRA-QAFRRRLKAEAQALFR----------------------------
GATA_RHOBA       YALSEGYYDAYYNQA-LKVRRLIRNDYDAAFQ----------------------------
GATA_ARATH       YALSAGYYDAYYKRA-QQVRTLIRKDFKAALE----------------------------
GATA_VITVI       YALSAGYYDAYYKRA-QQVRTLVQKSFKAALN----------------------------
GATA_ORYSI       YALSAGYYDAYYKRA-QQVRTLVKKSFKEALE----------------------------
GATA_ORYSJ       YALSAGYYDAYYKRA-QQVRTLVKKSFKEALE----------------------------
GATA_SORBI       YALSAGYYDAYYKRA-QQVRTLVKESFKDALE----------------------------
GATA_MAIZE       YALSAGYYDAYYKRA-QQVRTLVKQSFKDALE----------------------------
GATA_DESVH       YVLSSGYYDAYYRKA-AQVRRRILEDYRNAFA----------------------------
GATA_CHLAA       YALSAGYYDAYYRRA-QQVRTLIKRDFEQVFT----------------------------
GATA_MOOTA       YALSSGYYDAYYLKA-LKVRTLIRRDFETAFE----------------------------
GATA_GEOSL       YALSSGYYDAYYLKA-QKVRTLIMQDFMKAFE----------------------------
GATA_THEYD       YSLSAGYYEAYYKKA-QQVRTLIKNDFEKAFE----------------------------
GATA_SYNY3       YALSAGYYDAYYLKA-QKVRTLIKQDFDQAFT----------------------------
GATA_THEEB       YALSAGYYDAYYLRA-QKVRTLIKEDFARAFE----------------------------
GATA_GLOVI       YALSAGYYDAYYLKA-QKVRTLIKQDYLDAFA----------------------------
GATA_PROMA       YALSAGYVDAYYRKA-QQVRTLIRRDFENAFK----------------------------
GATA_BORPE       YVLSHGYYDAYYLQA-QRLRRLIAQDFQRAFAG---------------------------
GATA_BURPS       YVLSHGYYDAYYLQA-QKIRRIIAQDFQEAFK----------------------------
GATA_NEIG1       YVLSHGYYDAYYLKA-QKLRRLVADDFQTAFA----------------------------
GATA_NEIMB       YVLSHGYYDAYYLKA-QKLRRLVADDFQTAFA----------------------------
GATA_COXBU       YVLSAGYYDAYYLKA-QKIRRLIRDDFMKAFE----------------------------
GATA_PSEAE       YALSAGYYDAYYLQA-QKIRRLIKNDFVSAFA----------------------------
GATA_AGRFC       YVLSAGYYDAYYLKA-QKVRTLIKRDFENVFHE---------------------------
GATA_BRADU       YVLSAGYYDAYYLRA-QKVRTLIKKDFEDCFAK---------------------------
GATA_CAUVC       YVLSAGYYDAYYLKA-LKVRRRIAEDFDNAWTQ---------------------------
GATA_RHOS4       YVLSAGFYDAYYNRA-RKVRALIKRDFDEAFAA---------------------------
GATA_RHORT       YALSAGYYDAYYLKA-QKVRALIAQDFKTAFET---------------------------
GATA_RICPR       YVLSSHCMDAYYFKA-QKVRRLVANDFNNAFAK---------------------------
GATA_DICDI       MALSRSSYDNFYTKA-QKIRRLVSDDFKNVFQGEN-------------------------
GATA_HUMAN       FFLLKENYENYFVKA-QKVRRLIANDFVNAFNSG--------------------------
GATA_MACFA       FFLLKENYENYFVKA-QKVRRLIANDFVNAFNSG--------------------------
GATA_BOVIN       FFLLKENYENYFVKA-QKVRRLIANDFVNVFNSG--------------------------
GATA_CANLF       FFLLKENYENYFIKA-QKVRRLIANDFVNVFNSG--------------------------
GATA_MOUSE       FFLLKENYENYFVKA-QKVRRLIVKDFVDVFESG--------------------------
GATA_RAT         FFLLKENYENYFVKA-QKVRRLIVNDFVNVFGSG--------------------------
GATA_ORNAN       FFLLKENYNDYFIKA-QKVRRLIANDFIHVFSSG--------------------------
GATA_XENLA       YFLLKQNYEKYFVKA-QKVRRLIADDFVKVFNSG--------------------------
GATA_XENTR       YFLLKRNYEKYFVKA-QKVRRLIADDFVKVFNSG--------------------------
GATA_DANRE       YFLLKSNYERYFVKA-QQMRRLIAEDFKKVFSSG--------------------------
GATA_AEDAE       FFLLRKNYDKYFEKA-LKVRRLIANDFDRAFQE---------------------------
GATA_CULQU       YFLLRKNYDKFFQKA-LQVRRLIAEDFDKAFTK---------------------------
GATA_ANOGA       YFLLRENYDKYFQKA-LKVRRLIADDFVRAFKE---------------------------
GATA_DROME       FLLLKKNYDHYFEKA-LRVRRLIAEDFARVFDSSAKEE----------------------
GATA_DROPS       FLLLRKNYDHYFEKA-LRVRRLIAEDFLKVFEAPSKED----------------------
GATA_IXOSC       YFLLRANYEKYFTKA-LQVRRLISDDFTKVFASG--------------------------
GATA_PEDHC       FFLLSSNSNKYYEKA-LKVRRLIADDFNNAWRKG--------------------------
GATA_SCHPO       YSLARMNSSDLFSKA-RYVRRAIQLEFNKNFFLPSF------------------------
GATA_MYCPN       FGTDKNNFTKYFEKA-QKIRRVMVDAYLNLFK----------------------------
GATA_MYCGE       FATDEKNFEKYFEKA-QKIRRVLVDNFLNLFS----------------------------
                            :  .    :  .                                     

GATA_AJECG       ADVDGRDKKQIAGDNAGVDVLVVPTAPTLPPTVESLKRASTV----ETYMNDIFTVPASL
GATA_COCP7       HPKALESD---GDTAEKVDVLVCPTAPSPPPLLCSLENAAPT----EAYTNDVFTVPASL
GATA_EMENI       VELRQQAK------QTGIDVLISPTAPTPPPTISDITDTSTKRSNLDAYINDVFTVPASL
GATA_ASPFU       GDTELKSK------QAEVDVLICPTAPSCPPQLADLVETDSIFSSLNAYTNDVFTVPASL
GATA_TUBMM       --EEGRGK-------EGVDVLIAPCSLSKAPFLEDVKMQKSA---LDSYVNDVLTVPASL
GATA_MAGO7       EDVPLLNK----RGPARVDFILSPTAPTPAPTLDEALSQT----SLDSATNDVFTVPASL
GATA_NECH7       EATGMEDK----RGPLQVDFILCPTAPTFPPRLDEIKEQS----SVDVYMNDVFTVPASL
GATA_NEUCR       ETVGLEDK----WGPTEVDFLLCPTAPTTAPRLDEVLSEEEK-DPVSAYMNDVFTVPASL
GATA_PODAN       EEVEMEDK----WGPEEVDFLLCPTAPTLAPKLKGVMEQQ----PVDAYMNDVFTVPASL
GATA_ASHGO       GNKPNPA---------GVDVLLSLTCMAPPPSLEAFTSKENK-SPVNSYINDVFTVPMSL
GATA_YEAST       NSKGNPD---------GLDLLIVPTSSKLPGSIRDFEEEEAK-SPANSYINDVFTVPMSL
GATA_YARLI       GNEGQKAN-----DEPGVDFIIAPTSNCAPYPLSKLNDS----APVDTYLNDVLTVPASL
GATA_CANAW       QDEQSSD---------KVDLIMAPTSTSTAPTWDEFVSANEK-NFLNSYVNDVLTVPASL
GATA_CANAL       QDEQSSD---------KVDLIMAPTSTSTAPTWDEFVSANEK-NFLNSYVNDVLTVPASL
GATA_COPC7       SNTPAQAS-------QKVDVLLHPSAIRSAPRLDEVETAA---SSLDAYVQDVLTVPASL
GATA_USTMA       DKLTARDQ-------EGVDVILHPSAVDTAPTLAAAMQPGE--PSAAEYVQDVLTVPASL
GATA_CAMJE       ----------------DCDLIFMPVT---PTTAFKFD--TQ-KSPMQTYLEDVYTISVNL
GATA_HELPY       ----------------EVDLIFTPVA---PTSAHLFN--YH-ASPLEMYLSDIYTIGANL
GATA_BORBU       ----------------SCDFIITPTS---FVKPFRLG--LDFDDPVKMYYSDICTVIANL
GATA_CHLTR       ----------------RCDVIAMPVC---ATPAIRDQ--DV-LDPVSLYLQDVYTVAVNL
GATA_FRATT       ----------------QVDAIFMPAS---PSEAFKKG--DK-LDPVSAYLSDIYTIPANI
GATA_METJA       ----------------DVDIIVGATV---PKLPHKLG--EKL-TPMEMYSYDVLTVPANI
GATA_METMP       ----------------SADLIVGPTV---PKLPHKLG--EDV-SPMEMYAYDVLTVPTNI
GATA_METTH       ----------------HVDIIAGPTV---PKLPHTLG--EEL-EPMEMYAYDVLTVIANL
GATA_CENSY       ----------------EYDLLLSPTV---PILPFKLG--EKMGDPVGLFLVDYNTVTANL
GATA_THEMA       ----------------QYDAILTPTS---PVTAFKIG--EIK-DPLTYYLMDIFTIPANL
GATA_ARCFU       ----------------EYDVLISPTM---PALPFKIG--E-LADPLTMYKADVNTVPVNL
GATA_SACS2       ----------------KYDILLSPTM---PILPPKIG--EVINDPVRMYAMDLNTVIANL
GATA_METAC       ----------------TVDLLMAPTM---PNPAFRIG--EKIEDPLTLYLSDVNTCPINL
GATA_METHJ       ----------------DVDVIAGPTM---PDIAFKLG--E-KSDPLQMYLSDILTVPANL
GATA_LEPIN       ----------------KVDCILQPTS---PTTAFKIG--EKTKDPIQMYKADIWTTSVNL
GATA_AQUAE       ----------------EVDVIASPTT---PTLPFKFG--ERLENPIEMYLSDILTVPANL
GATA_FUSNN       ----------------EVDVILTPVA---PSVAFKLS--DT-KTPIELYLEDIFTISANL
GATA_BACAN       ----------------NYDVIIGPTT---PTPAFKVG--EKVDDPMTMYANDILTIPVNL
GATA_BACCR       ----------------NYDVIIGPTT---PTPAFKVG--EKVDDPMTMYANDILTIPVNL
GATA_BACSU       ----------------KYDVIVGPTT---PTPAFKIG--ENTKDPLTMYANDILTIPVNL
GATA_LISMO       ----------------NYDVIIGPSS---PTTAFKID--GMINDPITMYSNDILTVPINL
GATA_STAA8       ----------------NYDVVVGPTA---PTTAFNLG--EEIDDPLTMYANDLLTTPVNL
GATA_LACLA       ----------------KYDLILGPTT---PTPAWDLG--ARVDDPLSMYLADLLTIPVNL
GATA_STRR6       ----------------DYDLILGPTA---PSVAYDLD--SLNHDPVAMYLADLLTIPVNL
GATA_ENTFA       ----------------DYDLIIGPST---PTVAFGLG--ENINDPITMYMYDILTVPVNL
GATA_LACPL       ----------------DYDLIMGPVA---PTPAFKLG--DELSDPITMYMNDVLTIPVNL
GATA1_CLOAB      ----------------EFDAIITPTT---PTPAFRIG--EKTKDVLSMYMSDIYTVPVNI
GATA_CLOBH       ----------------EFDAIVSPTS---PTTAFKVG--EKKDDVMSMYLSDIYTVPISV
GATA2_CLOAB      ----------------NYDLILSPVS---PVLPFKIG--EKKADPLQMYLADIYTVNINL
GATA_KORVE       ----------------KVDAIVTPTT---PTPAFKLG--EKADDPLAMYLADIFTVTADL
GATA_SALRD       ----------------DVDALITPTT---PTPPFRLG--EKTDDPLEMYLNDIYTVTANL
GATA_CHLTE       ----------------KVDVIFGPTS---PFPPFGIG--DKMDNPLEMYLADVFTVPASI
GATA_CORGL       ----------------QVDILVSPTT---PTTAFKLG--EKVTDPLEMYNFDLCTLPLNL
GATA_MYCTU       ----------------SVDVLVSPTT---PTTAFRLG--EKVDDPLAMYLFDLCTLPLNL
GATA_STRCO       ----------------QVDVIVSPTT---PTTAFAIG--ERADDPMAMYLADLCTIPTNL
GATA_BIFLO       ----------------QVDVLVAPTS---PSTAFKFG--EKMDDPLAMYMNDIATIPANL
GATA_DEIRA       ----------------QYDVLVTPTS---PFPAFRRG--EKASDPLAMYAADVDTVAVNL
GATA_THET8       ----------------EVDLLLLPTT---PHPAFPFG--AR-RDPLAMYREDLYTVGANL
GATA_RHOBA       ----------------QVDLMLGPVT---PSPAFALN--EKTDDPIAMYLCDLFTVGANL
GATA_ARATH       ----------------QNDILISPAA---PSAAYKIG--EKKDDPLAMYAGDIMTVNVNL
GATA_VITVI       ----------------ENDILISPAA---PSPAYSIG--EKKNDPLAMYAGDIMTVNVNL
GATA_ORYSI       ----------------RYDILVSPAA---PSAAYKIG--EKINDPLAMYAGDTMTVNVNL
GATA_ORYSJ       ----------------RYDILVSPAA---PSAAYKIG--EKINDPLAMYAGDTMTVNVNL
GATA_SORBI       ----------------RYDILISPAA---PSAAYKIG--EKINDPLAMYAGDILTVNVNL
GATA_MAIZE       ----------------RYDILISPAA---PSAAYKIG--EKINDPLAMYAGDIMTVNVNL
GATA_DESVH       ----------------TCDVICGPVS---PVTAWPLG--ALTADPLQMYLMDVFTLSLNL
GATA_CHLAA       ----------------QVDLLAAPTS---PTVAFPIG--QKINDPLAMYLSDVCTLPINL
GATA_MOOTA       ----------------KYDLLATPTS---PTVAFRLG--EKAGDPLAMYLSDLCTIPINM
GATA_GEOSL       ----------------QVDALLTPVA---PTPAFKIG--EKVDDPLQMYLSDIFTIPVNL
GATA_THEYD       ----------------KVDFIVTPTA---PSPAFKIG--EKIDDPLQMYLSDIFTISVNL
GATA_SYNY3       ----------------KVDVLVCPTA---PTTAFKAG--EKTDDPLSMYLSDLMTIPVNL
GATA_THEEB       ----------------QVDVLICPTA---PTTAFKAG--EKTADPLSMYLSDLMTIPVNL
GATA_GLOVI       ----------------KVDVLVGPTA---PTTAFAFG--DKVSDPLSMYLSDIYTIPLNL
GATA_PROMA       ----------------NVDILLTPTS---PTTAFKSG--AHQNDPLAMYLSDLLTIPANL
GATA_BORPE       ----------------QCDVIMGPVS---PTVAKNIG--DNRDDPTADWLADVYTLGVSL
GATA_BURPS       ----------------SCDVIMGPAS---PTVAWDIG--AKGDDPVQMYLADIYTLSVSL
GATA_NEIG1       ----------------RCDLILAPTA---PSAAPKIG--AD-TSPVETYLSDIYTIAVNL
GATA_NEIMB       ----------------RCDLILAPTA---PTAAPKIG--AD-ASPVETYLSDIYTIAVNL
GATA_COXBU       ----------------TVDVILTPAT---PTPAFKLN--EKIADPVAMYLSDVYTIAVNL
GATA_PSEAE       ----------------EVDVILGPTT---PNPAWKIG--EKNDDPVSQYLEDIYTITANL
GATA_AGRFC       ----------------GVDAILAPIT---PSSAFAVGDEELASDPVKMYLQDVFTITVNM
GATA_BRADU       ----------------GVNAILTPAT---PSAAFGIG-EKGGADPVEMYLNDIFTVTVNM
GATA_CAUVC       -----------------CDAILTPTA---PSAAFGLG--ENSNDPIAMYLNDVFTVTTNL
GATA_RHOS4       ----------------GVDAILTPAT---PSSAFGLG-EMADADPVAMYLNDVFTVTVNL
GATA_RHORT       -----------------VDVLLTPTT---PSAAFGLN--ETIDDPITMYLNDVFTVPTSL
GATA_RICPR       -----------------VNAILLPTA---PSAAFKIG--KKQNDPTIMYLNDLFTIPASL
GATA_DICDI       ----------------KVDILITPTA---PSPAFKQN---EKMDPIEVYVNDIMTIPSNL
GATA_HUMAN       -----------------VDVLLTPTT---LSEAVPYLEFIKEDNRTRSAQDDIFTQAVNM
GATA_MACFA       -----------------VDVLLTPTT---LSEAVPYLEFIKEDNRTRSAQDDIFTQAVNM
GATA_BOVIN       -----------------VDVLLTPTT---LSEAVPYTEFIKEDNRTRSAQDDIFTQAVNM
GATA_CANLF       -----------------VDVLLTPTT---LREAVPYQEFIKEDNRTRSAQDDIFTQAVNM
GATA_MOUSE       -----------------VDVLLTPTT---LTEAVPYLEFIKEDNRTRSAQDDIFTQAVNM
GATA_RAT         -----------------VDVLLTPTT---LTQAVPYLEFIKEDNRTRSAQDDIFTQAVNM
GATA_ORNAN       -----------------VDVLLTPTT---LSDAVPYLEFIKEDNSTRSAQDDVFTQAVNM
GATA_XENLA       -----------------VHVLLTPTT---LGDAAPYLEFIQEDNRTRSAEEDVFTQCTNM
GATA_XENTR       -----------------VHVLLTPTT---LGDAAPYLEFIQEDNRTRSAQEDVFTQCANM
GATA_DANRE       -----------------IDVLLTPTT---LSDAARYADFITEDNRTRSAQEDVFTQPVNM
GATA_AEDAE       -----------------VDILLTPTT---LSDAPRYSEFIQSNNRDQCAVQDFCTQPANM
GATA_CULQU       -----------------VDFLLTPTT---LSSAPLYEDFVQGTNRDQCAVQDFCTQPANM
GATA_ANOGA       -----------------VDVLLTPTT---LSEAPLYKDFVQSNNRDQCAVQDFCTQPANM
GATA_DROME       ----------------RVDILLTPTT---LTEAPLYKDFASLTNRDQCAVQDFCTQPANM
GATA_DROPS       ----------------RVDILLTPTT---LTEAPLYKDFSSLSNRDQCAVQDFCTQPANM
GATA_IXOSC       -----------------VELLLTPVT---LTAALRHSEWTLKDNRERASVEDFCTQPVNM
GATA_PEDHC       -----------------INILLTPTT---LTDAPKYSEYIKKDEREQSAIQDYCTQPANM
GATA_SCHPO       ----------------SVDDPRGDIDFIVTPSFFNSS-QPIETPSSYSHLSDTMLVPANM
GATA_MYCPN       ----------------EADFIVSPSASGFTKTIAAVQ-----KGESFTNLVDDFLQLANF
GATA_MYCGE       ----------------DVDFVLSPSASCFASTIEDIQ-----ANKPYTNIIDDFLQLANF
                                   .                                *      ..

GATA_AJECG       AGLPALSVPVQMRGLSTVGDGDESKGDGADAAFGSVGIQAIGQFGDDEMVLHVGEMLEGM
GATA_COCP7       AGLPALSVPV------TPGDREQE---------SPLGIQVIGQFGDDQLVLDVGSRLEKM
GATA_EMENI       AGLPAISVPVSGK--DNAGNQEGD---------ILAGIQVIGQYGDDELVLKVGELLERR
GATA_ASPFU       AGLPAASVPVRVN--CRDEGSSDA---------DLAGIQIIGQYGDDELVLKVSESLEGK
GATA_TUBMM       AGIPAICLPV------MHGEND------------PVGIQVMAQYGDEETMWEVAKIIEEG
GATA_MAGO7       AGLPAISLPV------DMKEDVHG-------VGRFAGIQIIGQYWDDARLLDVAVALRGV
GATA_NECH7       AGLPAVSVPA------KVE----G-------SRFPAGLQVIGQYWDDQRVLLLAEKLKEA
GATA_NEUCR       AGLPAISVPM------RVEDKE---------GAGMAGLQLIGQYWDDARLLAVAETVADV
GATA_PODAN       AGLPAISVPM------KVATE------------GAAGLQLIGQYWDDARLLDVADAVAKE
GATA_ASHGO       AGLPCISVPLAGM-------------------KG-VGIQLTAQFADDYGLLDAAEDVMQE
GATA_YEAST       AGLPSLSMPLKEK-------------------TP-IGLQVVGQYGDDSTVLDFVESIS--
GATA_YARLI       TGIPSLNIPWKTK-------------------QGNVGMQIMGQYGDDLGVMKVGRLLLDK
GATA_CANAW       AGIPAISVPVNG-----------------------IGIQLMGQFGDDDLVLQLADQI---
GATA_CANAL       AGIPAISVPVNG-----------------------IGIQLMGQFGDDDLVLQLADQI---
GATA_COPC7       AGLPALSIPCPPSSS------------ETEEVEWPIGVSIVGQWGSDHFVLAVGKFLESA
GATA_USTMA       AGLPALAVPAGAAS----------------DDGWPVGVTLVSQWGCDEVLLHVGKHLQTQ
GATA_CAMJE       AGLGGISVPVAK-----------------DKEGLNISAQLICKAYDEQTLLDGALSLEQM
GATA_HELPY       SGLPALSLPVAK-----------------DPLGLPIGMQFIAKAFDEQSLLDVSYALEQE
GATA_BORBU       IGAPAISLPYSK-----------------DEEGLSIGMQIIGRSKKDFELLSFSKNVIRE
GATA_CHLTR       AYLPAISVPSGL-----------------SKEGLPLGVQFIGERGSDQQICQVGYSFQEH
GATA_FRATT       SGLPAIAFPIGF-----------------ANN-LPVGGQLMAKAFNDNILTQMVVQYQKH
GATA_METJA       CGLCAGVVPCG------------------DINGIPVGLQIQGKPFEDEKVLSAMIAFEKA
GATA_METMP       CGICSGVVRCG------------------NISGVPVGLQIQGAPLEDEKVLSAMIEFEKN
GATA_METTH       AGIPAASIPAG------------------DVGGVPVGLQLQAKPGDDGMIVSAMREIASL
GATA_CENSY       TGKPAASVPYT------------------VCDGLPVGMQLMGRPSGDAEVLQAAYSLQER
GATA_THEMA       AGLPAISVPFG------------------FSNNLPVGVQVIGRRFADGKVFRIARAIEKN
GATA_ARCFU       AGLPALSVPVG------------------MVKGLPVGLQVIGNYFSENTLLNFGKWVGER
GATA_SACS2       AAIPALSMPVG------------------FYSDLPIGLQLMGKYLSDIYLINISSFIERN
GATA_METAC       AGVPSVSVPCG------------------FTDGLPVGLQIMGKPFDEPTVLRAAYTFEKN
GATA_METHJ       AGVPALSVPCG------------------KINSMPVGLQLIGRYFEDERIIDTAYAYEQG
GATA_LEPIN       AGLPAMSVPMGA-----------------DQKGLPIGLQITTPHFQEGKLFGIALALSTL
GATA_AQUAE       AGLPAISIPIAW------------------KDGLPVGGQLIGKHWDETTLLQISYLWEQK
GATA_FUSNN       AGVPAISLPGGL------------------VDNLPVGVQFMGKPFDEEILIKIADALEKK
GATA_BACAN       AGVPAISVPCGF-----------------GANNMPLGLQIIGKHFDEATIYRVAHAFEQA
GATA_BACCR       AGVPAISVPCGF-----------------GANNMPLGLQIIGKHFDEATIYRVAHAFEQA
GATA_BACSU       AGVPGISVPCGL------------------ADGLPLGLQIIGKHFDESTVYRVAHAFEQA
GATA_LISMO       AGVPAISVPCGF------------------SDGLPVGLQIIGNYFEESLLYKVAHAFEQE
GATA_STAA8       AGLPGISVPCGQ------------------SNGRPIGLQFIGKPFDEKTLYRVAYQYETQ
GATA_LACLA       AGLPGISIPAGF------------------ADGLPVGMQLIGKRYDEETIYKVAAAFEAT
GATA_STRR6       AGLPGISIPAGF------------------SQGLPVGLQLIGPKHSEETIYQVAAAFEAT
GATA_ENTFA       AGLPGMSIPAGF------------------SEGLPVGLQIIGKHFDEHTMYKAAYAFEQA
GATA_LACPL       AGLPGMSVPAGF------------------ADGLPVGLQLIGKAFDESTMYRAGYAFEQA
GATA1_CLOAB      AGIPSISVPCGF-----------------V-SGLPVGLQIMGNYFKEDTLFNLAYSYEQS
GATA_CLOBH       AGVPAISLPCGM-----------------I-DGLPVGLQIISDYFKEDVLFNLAYNYEQS
GATA2_CLOAB      AGIPAISLPCSV-----------------SKEGLPIGLQLLGPHFGEKKIFRAARALEKE
GATA_KORVE       VGIPGISVPCGSS---------------KD--GLPIGLQVFAKHFQEATMIRVAHAVEHA
GATA_SALRD       AGLPGLTVPIGEH---------------PDTPGLPVGLQVLGPHFDEALLLRIGAAIME-
GATA_CHLTE       VGMPAISVPVG-----------------FDSLGLPVGAHLICNFFEEGKMLGIARHLQTL
GATA_CORGL       AGLAGMSLPSGLAS--------------DTG--LPVGLQLMAPAFQDDRLYRVGAAFEAG
GATA_MYCTU       AGHCGMSVPSGLSP--------------DDG--LPVGLQIMAPALADDRLYRVGAAYEAA
GATA_STRCO       AGNAAMSLPCGLAP--------------EDN--LPVGLQIIAPAMKDDRLYKVGAAVEAA
GATA_BIFLO       AGVPAMSIPAGLS---------------DDG--LPVGFQFIAPQQRDEVMYKPAAALEAA
GATA_DEIRA       AGLPALSVPAGFEE--------------VDGKRLPVGVQFIAPALQDERLLALAGALE-A
GATA_THET8       TGLPALSFPAGFEG--------------H----LPVGLQLLAPWGEDERLLRAALAFEEA
GATA_RHOBA       AGVPAISLPGGFDA--------------VG---LPVGVQLQAPVMEETRLLRAGNVFQMA
GATA_ARATH       AGLPAMVLPCGLVE--------------GGPSGLPVGLQMIGAAFDEEKLLKVGHIFEQT
GATA_VITVI       AGLPALVLPCGFVE--------------GGPAGLPVGLQMIGAAFDEEKLLKVGHIFEQM
GATA_ORYSI       AGLPALVVPCGFVE--------------GGSAGLPVGLQMIGSPFSEGNLLRIGHIFEQT
GATA_ORYSJ       AGLPALVVPCGFVE--------------GGSAGLPVGLQMIGSPFSEGNLLRIGHIFEQT
GATA_SORBI       AGLPALVVPCGFVE--------------GGPAGLPVGLQLIGSPFCEGNLLRVGHIFEQT
GATA_MAIZE       AGLPALVVPCGFVE--------------GGAAGLPVGLQMMGSPFCEGNLLRVGHIFEQT
GATA_DESVH       AGLPGLSLPVGL----------------GTESGMPVGIQLLGRSFDEATLLSVGNVLSRA
GATA_CHLAA       AGVPALVVPCGFSE------------------GLPVGLQLIGRPFDEATLLRVGDAYQRL
GATA_MOOTA       AGLPALSLPCGFSQ------------------GLPVGLQLIGRPFAEATLLQAAYAFEQS
GATA_GEOSL       AGTCAISVPAGMSA--------------A---GLPIGLQLIGRPFGEETILRAAHAFEQA
GATA_THEYD       AGVPAISLPCGFSE--------------K---GLPVGLQIIGKPFDEAGILQLAYAYEQS
GATA_SYNY3       AGLPAMSVPCGFDD--------------N---NLPIGLQLVGNVLGEEMLFRVGYAYEQA
GATA_THEEB       AGLPGLSVPCGFDS--------------N---GLPIGLQLIGNVLQEATLFHVAYAYEQT
GATA_GLOVI       AGVAGASIPCGFDA--------------K---GLPIGFQIMANALEEGKLLRAAYAYEQA
GATA_PROMA       AGLPSISLPCGFDE--------------K---ALPIGLQLIANVLDETRLLQVAHQYEQA
GATA_BORPE       AGLPAMSVPCGFG---------------GQDGRRPVGLQIIGNYFDEGRLLALADRYQQV
GATA_BURPS       AGLPGMSVPCGFGA--------------GANAKRPVGLQIIGNYFDEARMLQVADAFQRA
GATA_NEIG1       AGLPALTLPAGFS-----------------GGGLPVGVQLVGNYFAEAKILGAAHQIQLN
GATA_NEIMB       AGLPALTLPAGFS-----------------GGGLPVGVQLVGNYFAEAKILGAAHQIQLN
GATA_COXBU       AGLPAIAFPAGFM-----------------DQ-LPIGAQLIGNYFEEARLLNITHRYQQE
GATA_PSEAE       AGLPGLSMPAGFV-----------------DG-LPVGVQLLAPYFQEGRLLNVAHQYQQV
GATA_AGRFC       AGLPGLSVPAGLD-----------------GKGLPLGLQLIGKPFEEETLFKTAHAIEQA
GATA_BRADU       AGLPGIAVPAGKD-----------------AQGLPLGLQLIGRPFDEETLFSLGEVIEQA
GATA_CAUVC       AGLPGLSLPAGLD-----------------ANGLPLGLQIIGKPLDEATVFSVAGAVEKA
GATA_RHOS4       AGLPGISVPVGLD-----------------AKGLPLGLQLIGRPWDEAGLLNHAHVLERA
GATA_RHORT       AGLPGLSVPVGLS-----------------SRGLPLGLQLVGRYFDEETVLNAGLALERA
GATA_RICPR       AGLPCASVPAGLS-----------------ARGLPLGMQIIGKQLDEYNVLKVASTIETG
GATA_DICDI       AGLPACSIPLKLS-----------------NSNLPISVQLISNRLTDDNLLFAAHTIMNF
GATA_HUMAN       AGLPAVSIPVALS-----------------NQGLPIGLQFIGRAFCDQQLLTVAKWFEKQ
GATA_MACFA       AGLPAVSIPVALS-----------------NQGLPIGLQFIGRAFCDQQLLTVAKWFEKQ
GATA_BOVIN       AGLPAVSVPVALS-----------------SQGLPIGLQFIGRAFCDQQLLIVAKWFEKQ
GATA_CANLF       AGLPAVS-PVALS-----------------NQGLPVGLQFIGRAFHDQQLLTVAKWFEKQ
GATA_MOUSE       AGLPAVSVPVALS-----------------NQGLPIGLQLIGRAFCDQQLLTVAKWFEKQ
GATA_RAT         AGLPAVNVPVALS-----------------SQGLPIGLQLIGRAFCDQQLLTVAKWFEKQ
GATA_ORNAN       AGLPAVTVPAARS-----------------KRGLPVGLQFIGRAFCEQQLLTVAKWFEQE
GATA_XENLA       AGLPAVTVPAGLS-----------------SRGLPLGLQFIGRAFCERQLLTVAKWCEKQ
GATA_XENTR       AGLPAVTVPAALS-----------------SRGLPLGLQFIGRAFCEQQLLTIAKWFEKQ
GATA_DANRE       AGLPAVTVPTALS-----------------QRGLPIGLQLIGQTLQDWKLLTIAHWMEKQ
GATA_AEDAE       GGIPALSLPIRLS-----------------EQRLPISLQLMAPNFSEKRLFKVAKWIEEQ
GATA_CULQU       GGIPAISLPIRLS-----------------EHKLPISLQLMGPNFSEQNLLTVAKWIESQ
GATA_ANOGA       AGIPAISIPIRLS-----------------SRQLPISLQLMGDHFTERNLLQVANWIEKQ
GATA_DROME       AGIPAVSIPIRLS-----------------QAGLPLSLQLMSNSLNEQLLLTVARWIEAQ
GATA_DROPS       AGIPAVSIPIRLS-----------------RSGLPLSLQLMSRSLNEQLLLSVARWIEAQ
GATA_IXOSC       AGLPAVSVPCRLS-----------------REGLPLSLQLVGPKFSEAAMLAAAKRLELE
GATA_PEDHC       AGCPAISIPIELS-----------------KKGFPISLQLMAPKFEEKTLLGCALYIENA
GATA_SCHPO       AGIPSVSIPFGTLN-----------------NGLPMGIQIMAQYLNDEDLLSFAGQFA--
GATA_MYCPN       AGNPSITIPWLVKQ-----------------KDQTIGLSVNANCFHDKQLLQVAAWLEEL
GATA_MYCGE       AGSPSITIPWLVQT-----------------KDQTIGLSISANCFEDKKLLQIAYWFEQL
                                                     .         :  :          

GATA_AJECG       HG------------------------------
GATA_COCP7       NIQ-----------------------------
GATA_EMENI       --------------------------------
GATA_ASPFU       IF------------------------------
GATA_TUBMM       LGSGVGSKTQPTNPTVN---------------
GATA_MAGO7       LGRGLV--------------------------
GATA_NECH7       VA------------------------------
GATA_NEUCR       VREEL---------------------------
GATA_PODAN       VRT-----------------------------
GATA_ASHGO       QLN-----------------------------
GATA_YEAST       --------------------------------
GATA_YARLI       CKELHQD-------------------------
GATA_CANAW       --------------------------------
GATA_CANAL       --------------------------------
GATA_COPC7       ASV-----------------------------
GATA_USTMA       LGT-----------------------------
GATA_CAMJE       IKN-----------------------------
GATA_HELPY       LDLKLD--------------------------
GATA_BORBU       LGLNGI--------------------------
GATA_CHLTR       SQIKQLYPKAVNGLFDGGIE------------
GATA_FRATT       YGIEEFILQQARI-------------------
GATA_METJA       ME------------------------------
GATA_METMP       Y-------------------------------
GATA_METTH       --------------------------------
GATA_CENSY       SRMPEAPPWQ----------------------
GATA_THEMA       SPYNENGMFPLPEVKA----------------
GATA_ARCFU       FGEGD---------------------------
GATA_SACS2       ITKLYNLTASVKI-------------------
GATA_METAC       TDYHTKRPPEVA--------------------
GATA_METHJ       RA------------------------------
GATA_LEPIN       EGMNIQFPESIK--------------------
GATA_AQUAE       FKHYEKIPLT----------------------
GATA_FUSNN       IGRLNLPKLD----------------------
GATA_BACAN       TDHHTKKASL----------------------
GATA_BACCR       TDYHTKKASL----------------------
GATA_BACSU       TDHHKAKPEL----------------------
GATA_LISMO       TTFHKEKPNL----------------------
GATA_STAA8       YNLHDVYEKL----------------------
GATA_LACLA       TDFHKKQPIIFGK-------------------
GATA_STRR6       TGYHKQQPVIFGGDN-----------------
GATA_ENTFA       TDFHTKKPVILGGND-----------------
GATA_LACPL       TQVYKQTPKVGGAN------------------
GATA1_CLOAB      TKWHDKIANL----------------------
GATA_CLOBH       VDFHKMRADF----------------------
GATA2_CLOAB      R-------------------------------
GATA_KORVE       LAAV----------------------------
GATA_SALRD       --------------------------------
GATA_CHLTE       CQTAPSN-------------------------
GATA_CORGL       RK------------------------------
GATA_MYCTU       RGPLLSAI------------------------
GATA_STRCO       FVEKWGHPLIEEAPSL----------------
GATA_BIFLO       LEDSWNGPIWNDLKTPWLDGLGK---------
GATA_DEIRA       VGAVQLEMPQD---------------------
GATA_THET8       TARAHLKAPLGEAL------------------
GATA_RHOBA       SDFHTRRPPTFTANHSQ---------------
GATA_ARATH       LKGSSFVPPLLANVA-----------------
GATA_VITVI       LKGYKFIPPLLADGIAC---------------
GATA_ORYSI       LQNYSFVPPLLAES------------------
GATA_ORYSJ       LQNYSFVPPLLAES------------------
GATA_SORBI       LQNLSFVPPLLAES------------------
GATA_MAIZE       LQNLSFVPPLLAEGQL----------------
GATA_DESVH       LPPLGSPAGLR---------------------
GATA_CHLAA       TEWHTQRPRLVV--------------------
GATA_MOOTA       TEYHRRRPELGVA-------------------
GATA_GEOSL       TEWHRHTAQL----------------------
GATA_THEYD       TPWHKMKPLL----------------------
GATA_SYNY3       TTWHDRQPDLSA--------------------
GATA_THEEB       TPWHQQQPQL----------------------
GATA_GLOVI       TEWHKRTPALAAEALTR---------------
GATA_PROMA       AEIMNSAPESSLIN------------------
GATA_BORPE       TDWHQRAPVSQDA-------------------
GATA_BURPS       TDWHVQEPAGV---------------------
GATA_NEIG1       SDWHGKRPE-----------------------
GATA_NEIMB       SDWHGKRPE-----------------------
GATA_COXBU       TDWHKQSPKLR---------------------
GATA_PSEAE       SDWHTRTPAGF---------------------
GATA_AGRFC       AGKFTPAKWW----------------------
GATA_BRADU       AGRFTPARWW----------------------
GATA_CAUVC       AGFTAKAEKWW---------------------
GATA_RHOS4       AGFVEKPRKWW---------------------
GATA_RHORT       SAFTQKPAFLTGALEGQI--------------
GATA_RICPR       VKHIKFEPAGF---------------------
GATA_DICDI       DCYKDFTSLTPNYLK-----------------
GATA_HUMAN       VQFPVIQLQELMDDCSAVLENEKLASVSLKQ-
GATA_MACFA       VQFPFIQLQELMDDCSAVLENEKSASVSLKQ-
GATA_BOVIN       VQFPVIQLQELMDDCSSVFENEKLASVSLK--
GATA_CANLF       VQFPVTQLQELMDDCSSVFEIEKLASVSLKQ-
GATA_MOUSE       VQFPVIQLQGLMDDGSLVLENGKLTSASLTQR
GATA_RAT         VQFPVIQLQDLMDDGSLVPENGKLTSGSLTQ-
GATA_ORNAN       VRFPALCLEDLTEAGLVAARHEKSVSVS----
GATA_XENLA       MDFSPLQFNRDLGNGSIVLQYSKSASFV----
GATA_XENTR       IDFSPLQFNRDSENGNIVQQYSKSASSV----
GATA_DANRE       LHFPMIRFHRDLNENEREQNRSIRERTHTVGS
GATA_AEDAE       VKFETNYN------------------------
GATA_CULQU       VEFEHLCATND---------------------
GATA_ANOGA       VDFVANYS------------------------
GATA_DROME       VEFDSLEHSQQYKASL----------------
GATA_DROPS       VAFDSLDHRLEQKLS-----------------
GATA_IXOSC       LSFPRLDLQLHAHQESYATL------------
GATA_PEDHC       VNFKNMNEQ-----------------------
GATA_SCHPO       --------------------------------
GATA_MYCPN       FQIEHDD-------------------------
GATA_MYCGE       FDLNHD--------------------------