CLUSTAL format seed alignment for MF_00121

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

GATB_AGRFC       ------------------------------------------------MTLVDVRTPDPK
GATB_RHIME       ------------------------------------------------MSIVDVRTPDPK
GATB_BRUME       ------------------------------------------------MSIIDTRTPEPK
GATB_RHILO       ------------------------------------------------MTIIDTRTPDAK
GATB_CAUVC       -------------------------------------------------------MNENT
GATB_RICCN       -----------------------------------------------------------M
GATB_RICPR       -----------------------------------------------------------M
GATB_NEIMA       ------------------------------------------------------------
GATB_NEIMB       ------------------------------------------------------------
GATB_PSEAE       ------------------------------------------------------------
GATB_RALSO       ------------------------------------------------------------
GATB_MORCA       -----------------------------------------------------------M
GATB_HUMAN       -------MAAPMLRWGCRGRRWAFARVDGGSCHRRGAPTGSTSNQIRGESSVAQQPLHTA
GATB_BORBU       ------------------------------------------------------------
GATB_TREPA       --------------------------------------------MSDLQTGTVPSIAGAT
GATB_NOSS1       -----------------------------------------------------------M
GATB_SYNY3       ------------------------------------------------------------
GATB_ARATH       MSTTLLRTIQLNQFSLLGTSLLRRRRSNNFSVRSCGSQTTTTHEAKQSSPTRVAPKNHKS
GATB_AQUAE       ------------------------------------------------------------
GATB_THEMA       ------------------------------------------------------------
GATB_FUSNN       ------------------------------------------------------------
GATB_BACHD       ------------------------------------------------------------
GATB_BACSU       ------------------------------------------------------------
GATB_LISIN       ------------------------------------------------------------
GATB_LISMO       ------------------------------------------------------------
GATB_GEOSE       ------------------------------------------------------------
GATB_STAAM       ------------------------------------------------------------
GATB_STAAU       ------------------------------------------------------------
GATB_STASP       ------------------------------------------------------------
GATB_STRP1       ------------------------------------------------------------
GATB_STRP8       ------------------------------------------------------------
GATB_STRPN       ------------------------------------------------------------
GATB_LACLA       ------------------------------------------------------------
GATB1_CLOAB      ------------------------------------------------------------
GATB_CALS4       ------------------------------------------------------------
GATB2_CLOAB      ------------------------------------------------------------
GATB_CHLMU       ------------------------------------------------------------
GATB_CHLTR       ------------------------------------------------------------
GATB_CHLPN       ------------------------------------------------------------
GATB_HELPY       ------------------------------------------------------------
GATB_HELPJ       ------------------------------------------------------------
GATB_CAMJE       ------------------------------------------------------------
GATB_MYCLE       ---------------------------------------------MTVVSGASKASGADL
GATB_MYCTU       ---------------------------------------------MTVAAGAAKAAGAEL
GATB_CORGL       ------------------------------------------------------------
GATB_STRCO       -----------------------------------------------------MTTTTDL
GATB_DEIRA       ------------------------------------------------------------
GATB_THET8       ------------------------------------------------------------
GATB_SACS2       ------------------------------------------------------------
GATB_SULTO       ------------------------------------------------------------
GATB_AERPE       ------------------------------------------------------------
GATB_METJA       ------------------------------------------------------------
GATB_METTH       ------------------------------------------------------------
GATB_METKA       ------------------------------------------------------------
GATB_METAC       ------------------------------------------------------------
GATB_METMA       ------------------------------------------------------------
GATB_ARCFU       ------------------------------------------------------------
GATB_HALSA       ------------------------------------------------------------
GATB_MYCGA       ------------------------------------------------------------
GATB_MYCPE       ------------------------------------------------------------
GATB_UREPA       ------------------------------------------------------------
GATB_MYCGE       ------------------------------------------------------------
GATB_MYCPN       ------------------------------------------------------------
GATB_MYCPU       ------------------------------------------------------------
GATB_YEAST       -------------------------------------------MLRLARFYSLARTKAIH
                                                                             

GATB_AGRFC       RFIPGATGDWEIVIGLEVHAQVLS-NSKLFSGASTT---FGNAPNSNVSLVDAAMPGMLP
GATB_RHIME       RFIPGATGDWEVIIGMEVHAQVLS-NSKLFSSASTE---FGSEPNANVSLVDAAMPGMLP
GATB_BRUME       RFISGATGDWEVVIGMEVHAQVTS-ESKLFSGASTA---FGAEPNSNVSLVDAAMPGMLP
GATB_RHILO       RLIPGATGDWEIIIGLEVHAQVIS-EAKLFSGASTA---FGAAPNANVSLVDAAMPGMLP
GATB_CAUVC       KVIKGRTGDWEMVLGLEVHAQVAS-KSKLFSGAAVG---FGAGPNEQVSLVDAAMPGMLP
GATB_RICCN       AYIEGNTGKWEYVIGLEIHAQISS-KSKLFSGSSTI---FAANPNSQVSYVDAAMPGMLP
GATB_RICPR       EYIEGNTGKWEYVIGLEIHAQISS-KSKLFSGSSTL---FAASPNSQVSYVDAAMPGMLP
GATB_NEIMA       -------MTWETVIGLEIHVQLNT-KSKIFSGASTA---FGAEPNAHAGVVECALPGVLP
GATB_NEIMB       -------MTWETVIGLEIHVQLNT-KSKIFSGASTA---FGAEPNAHASVVECALPGVLP
GATB_PSEAE       -------MQWETVIGLEIHAQLAT-QSKIFSGSSTA---FGAAPNTQASLVDLAMPGTLP
GATB_RALSO       -------MQWEVVIGLETHAQLST-ASKIFSGASTA---FGAAPNTQAAPVDLALPGVLP
GATB_MORCA       TQQAPLIDGYEVVIGIEIHCQLNT-DSKIFSNAPTV---FGQEPNTQATIVDLGFPGVLP
GATB_HUMAN       QKTRKGEHKWAAVVGLEIHAQISS-NSKLFSGSQVR---FSAPPNSLVSFFDASLPGTLP
GATB_BORBU       -------MEYKLVIGLEIHVQLGL-KTKAFCGCKNE---FGGVPNSRVCPICLGLPGSLP
GATB_TREPA       DDTHAAPFFYEVIIGCEIHCQLLT-KTKAFCACANR---SGGMPNSRVCPVCLGLPGALP
GATB_NOSS1       TSATTVKTEYEAIIGLETHCQLST-NTKIFSSSSTA---FGADPNTNIDPVCMGLPGVLP
GATB_SYNY3       MTATAVKTDYEAIIGLETHCQLNT-ASKIFCNCSTD---FDSPPNTNVCPVCLGYPGVLP
GATB_ARATH       NQLDEILRDYEAVIGIETHVQLST-LTKAFCSCSNN---YGSYPNTSICPVCMGLPGALP
GATB_AQUAE       -----MNEKYEAVIGLEIHVQMDT-KTKMFCGCKVE---FGAEPNTNVCPVCLGMPGALP
GATB_THEMA       -------MRYRPVIGLEIHVQLST-KTKAFCSCPADV--FELPPNTAICPVCTGQPGALP
GATB_FUSNN       -----MIKEWESVIGLEVHLQLKT-GTKVWCGCKSDY--DESGINLHTCPICLGHPGALP
GATB_BACHD       -------MNFETVIGLEVHVELKT-ESKIFSASPNH---FGAEPNANTSVIDLGYPGVLP
GATB_BACSU       -------MNFETVIGLEVHVELKT-KSKIFSSSPTP---FGAEANTQTSVIDLGYPGVLP
GATB_LISIN       -------MNFETVIGLEVHVELKT-NSKIFSSAPAH---FGAEPNTNTTVVDLGMPGVLP
GATB_LISMO       -------MNFETVIGLEVHVELKT-NSKIFSSAPAH---FGAEPNTNTTVVDLGMPGVLP
GATB_GEOSE       -------MNYETVIGLEVHVELKT-KSKIFSSSPNA---FGAPPNTQTNVIDLGYPGVLP
GATB_STAAM       -------MHFETVIGLEVHVELKT-DSKMFSPSPAH---FGAEPNSNTNVIDLAYPGVLP
GATB_STAAU       -------MHFETVIGLEVHVELKT-DSKMFSPSPAH---FGAEPNSNTNVIDLAYPGVLP
GATB_STASP       -------MHFETVIGLEVHVELKT-DSKMFSPSPAH---FGAEPNSNTNVIDLAYPGVLP
GATB_STRP1       -------MNFETIIGLEVHVELNT-NSKIFSPSSAH---FGEDPNANTNVIDWSFPGVLP
GATB_STRP8       -------MNFETIIGLEVHVELNT-NSKIFSPSSAH---FGEDPNANTNVIDWSFPGVLP
GATB_STRPN       -------MNFETVIGLEVHVELNT-NSKIFSPTSAH---FGNDQNANTNVIDWSFPGVLP
GATB_LACLA       -------MNFETVIGLEVHVELST-NSKIFSPASTK---FGGDPNTNTNVIDWSLPGVLP
GATB1_CLOAB      -------MEYEIVIGLEVHAELAT-KTKMYCGCTAE---FGGQPNTHVCPVCMGLPGALP
GATB_CALS4       -------MKYEAVIGLEVHAELLT-DSKIFCGCSTK---FGSEPNTQVCPVCLGLPGTLP
GATB2_CLOAB      -------MSYETVIGLEVHAELST-KTKIFCNCSTK---FGAKPNENTCPICMGLPGTLP
GATB_CHLMU       --MGIAHTEWESVIGLEVHVELNT-ASKLFSPARNH---FGDEPNTNISPVCTGMPGALP
GATB_CHLTR       --MGIAHTEWESVIGLEVHVELNT-ESKLFSPARNH---FGDEPNTNISPVCTGMPGSLP
GATB_CHLPN       --MSAVYADWESVIGLEVHVELNT-ASKLFSSALNR---FGDEPNTNISTVCTGLPGSLP
GATB_HELPY       -------MPFEAVIGLEVHVQLNT-KTKIFCSCSTS---FGESPNSNTCPVCLGLPGALP
GATB_HELPJ       -------MPFEAVIGLEVHVQLNT-KTKIFCSCSTS---FGETPNSNTCPVCLGLPGALP
GATB_CAMJE       --------MFEVVIGLEVHAQLNT-KTKIFCSCATS---FGEAPNTNVCPTCLALPGALP
GATB_MYCLE       LDYDVVVARFDPVFGLEVHVELST-VTKMFCGCATTF---GAEPNTQVCPVCLGLPGSLP
GATB_MYCTU       LDYDEVVARFQPVLGLEVHVELST-ATKMFCGCTTTF---GGEPNTQVCPVCLGLPGSLP
GATB_CORGL       MDFDEVLEKYDPVMGLEVHVELGT-ETKMFSASSAHF---GAEPNSNVDPVSLGLPGALP
GATB_STRCO       VSYEDALASYDPVMGLEVHVELGT-KTKMFCGCSTAL---GADPNTQTCPVCLGMPGALP
GATB_DEIRA       -------MTYQAVIGLEVHLQLNT-RSKIFSACPADY--HGAGPNEFTDPLTLGLPGTLP
GATB_THET8       --------MYEAVIGLEVHLHLKT-RTKMFCGCRADY--FGAEPNTHTCPVCLGLPGALP
GATB_SACS2       ----------MVKIGLEVHVHITALKTKLFCSCPSDY--TGKDPNTVTCPVCLGLPGAIP
GATB_SULTO       ----------MVKIGLEVHVHLTSLKTKLFCSCPSDY--TGKDPNTNVCPICLGLPGAIP
GATB_AERPE       ----MNDRYTNVKIGLEIHVQLSNAGSKLFCGCDSEY--RGYKPNTNVCPVCLGLPGALP
GATB_METJA       --MGGNMEDVKMKCGLEIHVQIDT-KSKLFCNCSTNY--LDAEPNTNVCPVCLGLPGAKP
GATB_METTH       -----------MKCGLEIHVQLDT-RSKLFCRCPTDY--QEAPPNTNICPVCLNQPGAKP
GATB_METKA       --------MADVKIGFEVHVQLDT-RTKLFCDCPTDY--EDAEPNENTCPVCTGMPGAKP
GATB_METAC       ---MVYENPDGIRIGLEIHVQLNKLKTKMFCGCSTDY--HNAAPNTHTCPICLGLPGTLP
GATB_METMA       ---MVYENPDGIRIGLEIHVQLNKLKTKMFCGCSTDY--HNAAPNTHTCPVCLGLPGALP
GATB_ARCFU       --------MDDVVIGLEVHVQLNRLRTKLFCSCPLNY--HQSPPNTHVCPVCLGMPGAMP
GATB_HALSA       MSAQAAERDLTAIIGLEVHVQLET-DTKIFCGCSTDT--DDADPNTHTCPVCLGLPGALP
GATB_MYCGA       -MEETLMHNFQPIIGIEVHVVINS-KTKMFSPSANSH--RSD-PNINVHPIDLGLPGTMP
GATB_MYCPE       -MEIKMKNNFETVIGIEVHVVLSS-KTKMFSSSKSSH--TDP-KNTNISPIDLGHPGTMP
GATB_UREPA       ------MQNFEVIIGIEVHTALNT-KTKMFSNAATSH--KSI-PNTLINEIDLALPGTLP
GATB_MYCGE       ------MINFEAIIGIEVHVVLNT-ASKMFSKAPNRV--DNQKINHFIDPIDLGLPGTLP
GATB_MYCPN       ------MINFEAIIGIEVHVVLNT-ATKMFSPAPNQA--QNATPNQFINAIDLGLPGTMP
GATB_MYCPU       ------MNNFEVIIGIEIHLELNT-KTKFFSPSPIDF--EAE-ANTLVHPIDLGYPGTLP
GATB_YEAST       SHGAPFRPEYALKCGLEIHTQLNT-KNKLFSQSTNSATSLVDAPNHHTSYYDIALPGTQP
                               * * *  :     * :.             *          **  *

GATB_AGRFC       VI-NEECVKQAVRTGLGLKAKIN--NRSIFDRKNYFYPDLPQGYQISQF----KDPIVGE
GATB_RHIME       VI-NEECVKQAVRTGLGLKAKIN--NRSIFDRKNYFYPDLPQGYQISQY----KDPIVGE
GATB_BRUME       VI-NLECVRQAVRTGIGLNAQIN--LKSVFDRKNYFYPDLPQGYQISQF----KQPIVGE
GATB_RHILO       VI-NEECVKQAIRTGLGLKAQIN--HKSVFDRKNYFYPDLPQGYQISQF----KQPIVGE
GATB_CAUVC       VL-NRFCVEQAVKTGLGLRAQIN--LKSRFDRKNYFYPDLPQGYQISQF----DQPIVGE
GATB_RICCN       VL-NKHCVHQAIKTGLGLKAKIN--KYSVFDRKNYFYADLPQGYQISQF----YYPIVQN
GATB_RICPR       VL-NKHCVYQAIKTGLVLKAKIN--KYSVFDRKNYFYADLPQGYQISQF----YYPIVQD
GATB_NEIMA       VM-NREVVEKAIKLGLALDAKIN--RKNVFDRKNYFYPDLPKGYQISQL----DLPIVEH
GATB_NEIMB       VM-NREVVEKAIKLGLALDAKIN--QKNVFDRKNYFYPDLPKGYQISQL----DLPIVEH
GATB_PSEAE       VL-NEEAVRMACLFGLAIDARID--RQNVFARKNYFYPDLPKGYQTSQM----DHPIVGK
GATB_RALSO       VL-NKGAVERAITFGLAIGAKIA--SKSIFARKNYFYPDLPKGYQISQY----EIPVVQG
GATB_MORCA       VL-NAGVIERALKFGMGVNAKLG--TYNTFDRKNYFYPDLPKGYQITQM----ANPIVGE
GATB_HUMAN       VL-NRRCVEAAVMTGLALNCHIN--KKSLFDRKHYFYADLPAGYQITQQ----RLPIAVN
GATB_BORBU       SV-NVELINSAILAGHATNSKIR--NVVKFDRKHYYYPDLPKGYQISQN----DKPICEG
GATB_TREPA       VV-SEEYVRLGVRAGLALGCTIQ--LWSAFDRKHYFYPDLPKGYQITQY----DAPLCTD
GATB_NOSS1       VL-NEKVLEYAVKAGLALNCQIA--KYSKFDRKQYFYPDLPKNYQISQY----DLPIAEH
GATB_SYNY3       VL-NEEVLAAAVKLGLAINGQIA--PYSKFDRKQYFYPDLPKNYQISQF----DLPIVEH
GATB_ARATH       VL-NSKVVEFGVRLGLALNCDLS--LKSKFDRKQYFYPDLPKGYQISQF----DIPIASG
GATB_AQUAE       IV-NKRAVEYAIRASLALNCEVH--EESVFARKHYFYPDLPKGYQISQY----EKPLATN
GATB_THEMA       VP-NEEMIRFAVKTALALNCKIH--KYSRFDRKNYFYPDLPKGYQISQY----FYPIATE
GATB_FUSNN       KL-NKKVVDYAIKAALALNCQIN--NESGFDRKNYFYPDAPKNYQITQF----EKSYAEK
GATB_BACHD       VL-NKAAVEFAMKAAMALNCEVA--TDTKFDRKNYFYPDNPKAYQISQF----DKPIGEN
GATB_BACSU       VL-NKEAVEFAMKAAMALNCEIA--TDTKFDRKNYFYPDNPKAYQISQF----DKPIGEN
GATB_LISIN       VL-NKRAVEYGMKAAMAINCEIA--EHTKFDRKNYFYPDNPKAYQISQF----DKPIGEH
GATB_LISMO       VL-NKRAVEFGMKAAMAINCEIA--EHTKFDRKNYFYPDNPKAYQISQF----DKPIGEH
GATB_GEOSE       VL-NRQAVEFAMKAAMALNCEIA--TETKFDRKNYFYPDNPKAYQISQY----DQPLGKN
GATB_STAAM       VV-NKRAVDWAMRAAMALNMEIA--TESKFDRKNYFYPDNPKAYQISQF----DQPIGEN
GATB_STAAU       VV-NKRAVDWAMRAAMALNMEIA--TESKFDRKNYFYPDNPKAYQISQF----DQPIGEN
GATB_STASP       VV-NRRAVDWAMRASMALNMDIA--TNSKFDRKNYFYPDNPKAYQISQF----DQPIGEN
GATB_STRP1       VM-NKGVIDAGIKAALALNMDIH--KEMHFDRKNYFYPDNPKAYQISQF----DEPIGYN
GATB_STRP8       VM-NKGVIDAGIKAALALNMDIH--KEMHFDRKNYFYPDNPKAYQISQF----DEPIGYN
GATB_STRPN       VL-NKGVVDAGIKAALALNMDIH--KKMHFDRKNYFYPDNPKAYQISQF----DEPIGYN
GATB_LACLA       VM-NKGVIDSGIKAALALNMDIH--KSMHFDRKNYFYPDNPKAYQISQF----DEPIGYN
GATB1_CLOAB      HI-NKRAVDYGIKAGLALNCSIT--HIGRMDRKHIFYPDNSRNYQITQD----ELPLCTN
GATB_CALS4       VL-NKKVVEYAVRAGLALNCTIA--NFSKMDRKNYFYPDLPKAYQISQY----DLPLCSN
GATB2_CLOAB      VL-NEEVVHLAVKAGEALHCKIN--KLNKMDRKNYFYPDLPKAYQISQF----DIPICSG
GATB_CHLMU       VL-NKDAVRKAVLFGCAVEGDVA--LFSRFDRKSYFYPDSPRNFQITQY----EHPIVRG
GATB_CHLTR       VL-NKDAVRKAVLFGCAVEGDVA--LFSRFDRKSYFYPDSPRNFQITQY----EHPIVRG
GATB_CHLPN       VL-NQSAVEKAVLFGCAVEGEIS--LLSRFDRKSYFYPDSPRNFQITQF----EHPIIRG
GATB_HELPY       VL-NKEVVKKAIQLGTAIEANIN--QYSIFARKNYFYPDLPKAYQISQF----EVPIVSD
GATB_HELPJ       VL-NKEVVKKAIQLGTAIEAHIN--QYSIFARKNYFYPDLPKAYQISQF----EVPIVSD
GATB_CAMJE       VL-NEEAVKKAIAFGKAVNATIN--KKSVFNRKNYFYPDLPKAYQISQF----DIPIVEK
GATB_MYCLE       VL-NRAAVQSAIRIGLALNCEIV--PWCRFARKNYFYPDVPKNYQISQY----DEPIAIN
GATB_MYCTU       VL-NRAAVESAIRIGLALNCEIV--PWCRFARKNYFYPDMPKNYQISQY----DEPIAIN
GATB_CORGL       VV-NAKGVEWAIKIGLALNCSIA--ESSRFARKNYFYPDQPKNYQISQY----DEPIAYD
GATB_STRCO       AV-NATGVESAIKIGLALNCEIA--EWCRFARKNYFYPDMPKNFQTSQY----DEPIAFD
GATB_DEIRA       TL-NRRAVELAMMFGLGLGCDVS--GFTQFHRKNYFYPDAPKNFQLSQY----DRPIARD
GATB_THET8       VP-NRVAVEHGLRLALALGAEVP--ERLVFHRKNYFYPDLPKNYQISQY----DLPLGRG
GATB_SACS2       VL-NENAVKYGILTALALNCQIA--EKLIFDRKHYFYPDMSKNYQISQYDGPGSMAIAKD
GATB_SULTO       VL-NENAVKAAIMVALAINAEIA--NSLIMVRKHYFYPDMAKNYQISQYDGPGSIAISKG
GATB_AERPE       VP-SRRPIVLAIAASMALGCRVP--GTVVFTRKHYFYPDLPKNYQITQFEKAGGAPVCMG
GATB_METJA       LPPNKKAVEVAIMVAKMLGCKIVVDEDIYFQRKHYDYPDLPSGYQRT------STPIGVD
GATB_METTH       YPPNRSALEGALKIALMLDCRIN-PEITYFMRKHYNYPDLPSGYQRT------SIPVGLE
GATB_METKA       LPPNEEALLIALEIAHMLDCEPVLDRPLYFQRKHYDYPDLPSGYQRT------SVPIAVN
GATB_METAC       VL-NKKVVEAAIKVGLALEGEIA--EETQFHRKNYFYPDLPKGFQVTQY----DYPIVSK
GATB_METMA       VL-NKKAVEAAIKVGLALEGEIA--EETQFHRKNYFYPDLPKGFQVTQY----DYPIVSK
GATB_ARCFU       VI-NKEAVKAAVKVAMALNAEIQ--PFTVFDRKNYFYPDLPKGFQISQY----DRPLALG
GATB_HALSA       TL-NEGAVEAAVKLGKAIDADIP--ERTRFHRKNYFYPDLPKGFQITQY----DAPICQD
GATB_MYCGA       EP-NGFVVKKALVLAKALNMQNVDHHLR-FDRKNYFYQDLPKGYQITQQ----HHPIATN
GATB_MYCPE       LP-NKRCIEKAIVLAKALDME-IEKNIS-FDRKNYFYQDLPKGFQITQQ----FHPIGKN
GATB_UREPA       TV-NQEVVHKGLFLANALHMRTNHQFIA-FDRKHYYYLDLPKGYQITQN----YFPIGQN
GATB_MYCGE       QV-NELAVYKALLLADALKMKTVTNKLV-FDRKHYFYQDLPKGFQITQQ----NYPFAKN
GATB_MYCPN       QV-NEQAVQKALILADALNMQRVQPVLV-FDRKHYFYQDLPKGFQITQQ----NFPIAQN
GATB_MYCPU       RV-NKQAIINGIKLAKALNMT-IDSEIH-FDRKNYFYPDLPKGFQITQQ----FRPIGKN
GATB_YEAST       VL-NLEAILFAMKLSLALGSQVN--SISQFDRKHYFYGDQPQGYQLTQH----YRPFARG
                    .   :  .   .              : **   * * .  :* :        .    

GATB_AGRFC       GTITISLGPDRQG-NFEDIEIGIERLHLEQDAGKSMHDQHP-------TMSFVDLNRSGV
GATB_RHIME       GKIIISVGPDRQG-QFEDVEIGIERLHLEQDAGKSMHDQHP-------AMSYVDLNRSGV
GATB_BRUME       GKIMISVGPDNKG-QFEDVEIGIERLHLEQDAGKSMHDQHP-------TMSYVDLNRSGV
GATB_RHILO       GTVIVSVGPDRQG-EFEDIEVGIERLHLEQDAGKSMHDQHP-------TMSYVDLNRSGV
GATB_CAUVC       G--VVSVERDDG----TTFDVRIERLHLEQDAGKSLHDQDP-------NATYVDLNRAGT
GATB_RICCN       GTMEIPTSTGDL------KTIRINRLHLEQDAGKSMHDQSP-------HYSFIDLNRAGI
GATB_RICPR       GMIEIPTSTGDL------KTIRINRLHLEQDAGKSIHDQSP-------YYSLIDLNRAGI
GATB_NEIMA       GKLEIVVGD-------DVKTINVTRAHMEEDAGKSVHEGLN-------GATGIDLNRAGT
GATB_NEIMB       GKLEIVVGD-------DVKTINVTRAHMEEDAGKSVHEGLN-------GATGIDLNRAGT
GATB_PSEAE       GHLDITLED------GTTKRIGITRAHLEEDAGKSLHEDFQ-------GMSGIDLNRAGT
GATB_RALSO       GTLTIQVEGRNGQ-PGYEKTVNLTRAHLEEDAGKSLHEDFA-------GMTGIDLNRAGT
GATB_MORCA       GYIDILVNAGQ-K-DEYTKRIGITRAHLEEDAGKSVHDAVP-------QMTGVDLNRAGT
GATB_HUMAN       GSLIYGVCAGKKQSQVIPKTVRIKQIQLEQDSGKSLHDNLR-------SQTLIDLNRAGV
GATB_BORBU       GSLLIETP----S-GP--KKINIIRIHMEEDSGKSLHLLDSE------NQSYVDFNRSGA
GATB_TREPA       GAVDVQGV----D-MPVQRRVRIERIHLEEDAGKSLHAADA--------YSYIDFNRCGV
GATB_NOSS1       GWLEIELLDADGN-P-KRKRIGITRLHMEEDAGKLVHAGSDR--ISGSTYSLVDYNRAGV
GATB_SYNY3       GSLEIELVDKKTK-EITRKTIGITRLHMEEDAGKLVHAGSDR--LAGSTHSLVDFNRTGV
GATB_ARATH       GYVDVDIPLEFGG-G--HRRFGITRVHMEEDAGKLLHSDT-------GDYSQVDLNRAGV
GATB_AQUAE       GWVELNLPN------GEKKKVRIRRLHIEEDAGKNIHEGD---------KTLVDLNRAGT
GATB_THEMA       GFLEIDGDE------G-RKKVRIRRLHLEEDAGKLVHEGDSI---TRASYSLVDMNRCGV
GATB_FUSNN       GYLEFKLNS------GRQVKIGITKIQIEEDTAKAVHGKN---------ESYLNFNRASI
GATB_BACHD       GWIEIEVD-------GTKKKIGITRLHLEEDAGKLTHSGN--------GYSLVDFNRQGT
GATB_BACSU       GWIEIEVG-------GKTKRIGITRLHLEEDAGKLTHTGD--------GYSLVDFNRQGT
GATB_LISIN       GWIEIEVG-------GKKKKIGITRLHLEEDAGKNTHTSH--------GYSLVDINRQGT
GATB_LISMO       GWIEIEVG-------GKKKKIGITRLHLEEDAGKNTHTSH--------GYSLVDINRQGT
GATB_GEOSE       GWIEIEVN-------GKKKKIGITRIHLEEDAGKLTHTGD--------GYSLVDFNRQGT
GATB_STAAM       GYIDIEVD-------GETKRIGITRLHMEEDAGKSTHKG---------EYSLVDLNRQGT
GATB_STAAU       GYIDIEVD-------GETKRIGITRLHMEEDAGKSTHKG---------EYSLVDLNRQGT
GATB_STASP       GYIDIEVD-------GETKRIGITRLHMEEDAGKSTHKD---------GYSLVDLNRQGT
GATB_STRP1       GWIDIKLED------GSTKKIRIERAHLEEDAGKNTHGTD--------GYSYVDLNRQGV
GATB_STRP8       GWIEIKLED------GSTKKIRIERAHLEEDAGKNTHGTD--------GYSYVDLNRQGV
GATB_STRPN       GWIEVKLED------GTTKKIGIERAHLEEDAGKNTHGTD--------GYSYVDLNRQGV
GATB_LACLA       GSIEIELED------GHKATIRIERAHLEEDAGKNTHGTD--------GYSYVDLNRQGV
GATB1_CLOAB      GYIEIELED------GSKKKIGVERIHIEEDAGKLLHTNA---------GTLVDFNRCGV
GATB_CALS4       GYIEIEVEG------GTKR-IGIKRIHIEEDAGKLLHEGT--------DGSLVDYNRAGV
GATB2_CLOAB      GYVEIPTKD------G-VKKVRLNRIHIEEDAGKLVHLEYE-------PHSLIDYNRVGV
GATB_CHLMU       GCVRAIVE-------GEEKTFELAQTHLEDDAGMLKHFGD---------FAGVDYNRAGV
GATB_CHLTR       GCIRAVVE-------GEEKTFELAQTHLEDDAGMLKHFGD---------FAGVDYNRAGV
GATB_CHLPN       GRIKAIVQ-------GEERYFELAQTHIEDDAGMLKHFGE---------FAGVDYNRAGV
GATB_HELPY       GKLEIDTK-------EGAKIVRIERAHMEEDAGKNIHEGS---------YSLVDLNRACT
GATB_HELPJ       GKLEIDTK-------EGAKIVRIERAHMEEDAGKNIHEGS---------YSLVDLNRACT
GATB_CAMJE       GELFINVK-------GENKRIGITRAHLEEDAGKNIHESN---------FSKVDLNRAGT
GATB_MYCLE       GYLEVPLED------DTTWRVEIERAHMEEDTGKLTHLGSETGRIYGATTSLIDYNRAGV
GATB_MYCTU       GYLDAPLED------GTTWRVEIERAHMEEDTGKLTHIGSETGRIHGATGSLIDYNRAGV
GATB_CORGL       GYLDVVLED------GTEWRVEIERAHMEEDTGKLTHLGGTSGRIHGATASLVDCNRAGV
GATB_STRCO       GYLDVQLED------GETFRVQIERAHMEEDTGKSLHVGGATGRIHGASHSLLDYNRAGI
GATB_DEIRA       GYLDVPGE-------GGPERIRIKRAHLEDDAGKLVHP-------TYAPYSLLDLNRAGS
GATB_THET8       GSLPL-----------GERRVRIKRLHLEEDAGKSLH---------LEGRTLLDLNRAGS
GATB_SACS2       GYIKLND-----------KIIRIRRINIEEDPAKIVYPTG---SILTSKYTLLDYNRSGT
GATB_SULTO       GYLKLREG----------KTVRIRRINIEEDPAKIIYPTGS---MLTSKYTLLDYNRSGM
GATB_AERPE       GVLEYLNTDS-----WRWERARIRRINLEEDPGK-TYYEG---SILTSRYALVDYNRSGV
GATB_METJA       GEF---------------MGIGIHEVHLEEDPGQ-----------YNPSFGIVDYNRSGT
GATB_METTH       GEL---------------NGVRIREVHIEEDPGQ-----------YKPDQGTVDFNRSGI
GATB_METKA       GEL---------------DGVRIREIHVEEDPGR-----------WEPSTGRVDYNRSGV
GATB_METAC       GKVVIEGEDG-----E--HVVGITRAHMEEDPGKLVHIG----SIGKSKGVLIDYNRSGM
GATB_METMA       GKVVIEGEDG-----E--HVVGITRAHMEEDPGKLVHIG----SIEKSKGVLIDYNRSGM
GATB_ARCFU       GYVTIELDGQ-----E--KRIQLKRVHMEEDPGKLSYKG----SITTAKYSLIDYNRSGA
GATB_HALSA       GELEVGTADD-----R--RAIGIERAHLEEDPGSLQHVGG---SIEDADYTLVDYNRAGT
GATB_MYCGA       GYLDIS-----------NKRVPIQRFHIEEDTAKQLNEDN---------HILLDYNRAGS
GATB_MYCPE       GKIYLDE----------NNFVDIERIHLEEDTAKQTKEDDG--------TILLDYNRSGI
GATB_UREPA       GYIQIIDEY------NNLKRIRIKQIHLEEDTAKQTNIGN---------QIYLDYNRAGW
GATB_MYCGE       GVVTINVD-------AIEKPIYIDRFHLEEDTAKQHFNHD---------QILLDFNRCGA
GATB_MYCPN       GYVEIVEN-------NKAQRIIIERFHLEEDTAKQHFVDG---------QILLDFNRCGA
GATB_MYCPU       GSLVLYID-------DESVKIDIERIHLEEDTARQYIKEN---------EIWYDFNRAGI
GATB_YEAST       GKINLSKELDDID--ESAKEIGILQLQIEQDTGKSHYTETDK-----DVITLVDLNRSNV
                 *                     : . ::*:*..                    : **   

GATB_AGRFC       ALMEIVSKP----DMRSSDEAKGYLTKLRSIVRYLGTCDGNMDEGSMRADVNVSVRRPG-
GATB_RHIME       ALMEIVSKP----DLRSSDEAKAYLTKLRSILRYLGTCDGNMDEGSMRADVNVSVRRPG-
GATB_BRUME       ALMEIVSKP----DLRSSDEARAYLTKLRTIVRYLGTCDGNMDEGSMRADVNVSVRRPG-
GATB_RHILO       ALMEIVSKP----DLRSGDEAKAYVTKLRTIMRYLGTCDGNMDEGSLRADVNVSVRRPG-
GATB_CAUVC       ALMEIVSKP----DMRTSEEAAAYVKKLRTILVYLGTCDGDMEKGNLRADVNVSVCRPGD
GATB_RICCN       GLMEIVTEP----DISSPEEAAEFVKKLRNLLRYIGSCDGDMEKGSMRCDANISVRRSG-
GATB_RICPR       GLMEIVTEP----DISSPEEAAEFVKKLRNLLRYIGSCDGDMEKGSMRCDANISVRRIG-
GATB_NEIMA       PLLEVVSEP----EMRSAAEAVAYAKALHSLVTWLNICDGNMAEGSFRVDANVSVRPKGQ
GATB_NEIMB       PLLEVVSEP----EMRSAAEAVAYAKALHSLVTWLDICDGNMAEGSFRVDANVSVRPKGQ
GATB_PSEAE       PLLEIVSEP----DIRSAKEAVAYVKAIHALVRYLGICDGNMAEGSLRCDCNVSVRPKGQ
GATB_RALSO       PLLEIVTEP----DMRSAAEAVAYARALHALVMWLGICDGNMQEGSFRCDANVSVRRGPD
GATB_MORCA       PLIEIVSEP----DMRSVDEAVAYVKTIHELVTWLGISDAIMAEGSFRADINVSVH-KPN
GATB_HUMAN       GLLEVVLEP----DMSCGEEAATAVRELQLILQALGTSQANMAEGQLRVDANISVHHPG-
GATB_BORBU       PLLEIVSAP----DINSGDEAVAFLSSLREIFRYLDLSECNMENGSFRCDVNVNLIVKEN
GATB_TREPA       PLIEIVSRP----DLRSAEEAACFMQTIREILTFIEVTDGNLEEGALRCDANVNVRILYK
GATB_NOSS1       PLVEIVSEP----DIRTGQEAAEYAQELRRVMRYLGVSDGNMQEGSLRCDVNISVRPV--
GATB_SYNY3       PLLEIVSEP----DLRTGQEAAEYAQSLRQLVRYLGISDGNMQEGSLRCDVNISVRPV--
GATB_ARATH       PLLEIVSEP----DMRSGIEAAEYACEMQRIARYLGVSNGNMQEGSLRCDVNISIRPI--
GATB_AQUAE       PLMEIVTEP----DIRTPEEARLFLEKLRNIMRYAGVSKADMEKGQLRCDINVSIRPK--
GATB_THEMA       PLIEIVTEP----DISSPREARVFMEKLRSIVRYLGVSTGDMEKGALRCDANISVVDT--
GATB_FUSNN       PLIEIISEP----DMRNSEEAYEYLNTLKNIIKYTKISDVSMETGSLRCDANISVMEK--
GATB_BACHD       PLIEIVSEP----DIRTPQEAYAYLEKLKSIIQYTGVSDCKMEEGSLRCDANISLRPV--
GATB_BACSU       PLVEIVSEP----DIRTPEEAYAYLEKLKSIIQYTGVSDCKMEEGSLRCDANISLRPI--
GATB_LISIN       PLIEIVSEP----DIRSAEEAYAYLEKLKSIIQYTGVSDVKMEEGSMRCDANISIRPI--
GATB_LISMO       PLIEIVSEP----DIRSAEEAYAYLEKLKSIIQYTGVSDVKMEEGSMRCDANISIRPI--
GATB_GEOSE       PLIEIVSEP----DIRSPEEAYAYLEKLKAIIQYTGVSDCKMEEGSLRCDANISLRPI--
GATB_STAAM       PLIEIVSEP----DIRSPKEAYAYLEKLRSIIQYTGVSDVKMEEGSLRCDANISLRPY--
GATB_STAAU       PLIEIVSEP----DIRSPKEAYAYLEKLRSIIQYTGVSDVKMEEGSLRCDANISLRPY--
GATB_STASP       PLIEIVSEP----DIRSPKEAYAYLEKLRSIIQYTGVSDCKMEEGSLRCDANISLRPY--
GATB_STRP1       PLIEIVSEA----DMRSPEEAYAYLTALKEIIQYTGISDVKMEEGSMRVDANISLRPY--
GATB_STRP8       PLIEIVSEA----DMRSPEEAYAYLTALKEIIQYTGISDVKMEEGSMRVDANISLRPY--
GATB_STRPN       PLIEIVSEA----DMRSPEEAYAYLTALKEVIQYAGISDVKMEEGSMRVDANISLRPY--
GATB_LACLA       PLIEIVSEA----DMRTPEEAYAYLTALKEAILYTGISDVKMEEGSMRCDANVSLRPY--
GATB1_CLOAB      PLAEIVSKP----DMRSPREAVTYLEELKSILSCVGVSDCKMEEGSLRCDANISVMKK--
GATB_CALS4       PLIEIVSEP----DISTPEEAYQYLVKLKSILEYTEVSDCKMQEGSLRVDTNVSVRPV--
GATB2_CLOAB      PLVEIVSEP----DMRSPEEAVEFMKTLRAMLQYANISDCRMDQGSMRCDANISLREV--
GATB_CHLMU       PLIEIVSKP----CMFSAEDAVAYANALVSILSYIGISDCNMEEGSVRFDVNISVRPK--
GATB_CHLTR       PLIEIVSKP----CMFSAEDAVAYANALVSILGYIGISDCNMEEGSIRFDVNISVRPR--
GATB_CHLPN       PLIEIVSKP----CMFCPEDAVAYATSLVSLLDYIGISDCNMEEGSIRFDVNVSVRPK--
GATB_HELPY       PLLEIVSKP----DMRNSEEAIAYLKKLHAIVRFIGISDANMQEGNFRCDANVSIRPK--
GATB_HELPJ       PLLEIVSKP----DMKNSEEAIAYLKKLHAIVRFIGISDANMQEGNFRCDANVSIRPK--
GATB_CAMJE       PLLEIVSEP----ELRSSDEAVAYLKKLHSIIRFLDISDANMQEGSFRCDANVSIRPK--
GATB_MYCLE       PLIEIVTKPIEGAGVRAPQIARAYVKALQDLLRTLDVSDVRMDQGSMRCDANVSLKPIGT
GATB_MYCTU       PLIEIVTKPIVGAGARAPQIARSYVTALRDLLRALDVSDVRMDQGSMRCDANVSLKPAGT
GATB_CORGL       PLIEVVTKPIEGAGARAPEIAKAYVSALRDLVKALGVSDGRLDQGSMRVDANLSLRPIGQ
GATB_STRCO       PLIEIVTKPIEGAGERAPEVARAYVRELRELIRALGVSEARMEMGQMRCDVNLSLRPHGR
GATB_DEIRA       ALIEMVTEA----DITGPEQARAFLESVQAIAQSLGVSDATPEEGKMRCDVNISIHKPG-
GATB_THET8       PLIELVTEP----DLKTPEEARLFLQRIQALVQTLGISDASPEEGKLRADVNVSVRRVG-
GATB_SACS2       PLLEIVTEP----DLRSAKEARFFLEKLRSILEHLGVCDCGI-EGAMKADVNISVK----
GATB_SULTO       GLLEIVTEP----DMTEPKEAREFLEKLRSILEHLGVCNCDL-EGAMRADANVSVEG---
GATB_AERPE       PLLEIVTEP----DIPSPRHARMLIDYLLLTLEYIGATNPRL-EGVFRVDANISIE----
GATB_METJA       PLIEIVTKP----DIKSPEEAREFLKQLMTLFRYLGCLRG---EGTMRADVNISIEYMGV
GATB_METTH       PLIEIVTEP----DMTSPEEARNFLRELIRVLEYSGCARG---EGTMRADVNISLE----
GATB_METKA       PLIEIVTEP----DMRSPEEARDFLRRLMQVLRYSGKVKG---DGGIRVDANVSVE----
GATB_METAC       PLIETVTEP----DMRSPKEARRFLDKFRNILEYLDVFDGNL-EGAMRVDANVSVHWGT-
GATB_METMA       PLIETVTEP----DMRSPKEARRFLDKFRNILEYLDVFDGNL-EGAMRVDANVSVHWGT-
GATB_ARCFU       PLLEIVTEP----VMNSPKEARLFLNKLRMILEYLEVFDGDL-EGAMRVDANISIRGSG-
GATB_HALSA       PLMEIVTRP----DFRAAEEVRSFLAKLTSVLEYLGVFDAER-DGSLRVDANISMVDSAE
GATB_MYCGA       PLIEIVTDP----VFDSGKEVKEYLTNLRRILIFNDISDAKLEEGSMRVDVNVSIRPMGA
GATB_MYCPE       PLIEIVTKP----CIKSSTEAGLFLKKLRRILTFNDISDAKMEEGSLRVDVNISVKPIGS
GATB_UREPA       PLIEIVSEA----DLRSAQETVLFLEELRKILLFNDISDAKMEDGSLRVDVNVSIRPQGA
GATB_MYCGE       PLIEVVTLP----VINTAKEAKAYLQKLRQILIVNNISNAKLEDGSMRSDCNVSVRLKGQ
GATB_MYCPN       PLIEVVTAP----VIKSAKQSKAYLQKLRQILIVNNISNAKLEDGSMRSDCNVSVRLKGQ
GATB_MYCPU       PLIEIVTRP----TIKSSKQASSYIDEIRKIALLLEISDARMDRGSLRADINVSLRPYGS
GATB_YEAST       PLIELVTKP----DFSDIKQVRAFIKKYQNLVRHLHISSGDLETGAMRVDVNLSINEY--
                  * * :  .                                   * .: * *:.:     

GATB_AGRFC       -----------EGFGTRCEIKNVNSIRFVGQAIEYEARRQVAI--LEDGG------VIDQ
GATB_RHIME       -----------EAFGTRCEIKNVNSIRFVGQSIEYEARRQIAI--LEDGG------AIDQ
GATB_BRUME       -----------GEFGTRCEIKNVNSIRFVGQAIEYEARRQIAI--LEDGG------VIDQ
GATB_RHILO       -----------GEFGTRCEIKNMNSIRFIGQAIDYEARRQIAI--LEDGG------KIDQ
GATB_CAUVC       YEKFRATG-DFKHLGTRCEIKNVNSYRYIQQAIEYEARRQIEI--LEDGG------KVDQ
GATB_RICCN       -----------EPLGTRCEIKNINSIRNIIKAIEFEAKRQVDL--LESGE------KIIQ
GATB_RICPR       -----------EALGTRCEIKNINSIRNIIKAIEFEAKRQVDL--LESGE------TIIQ
GATB_NEIMA       -----------AEFGTRREIKNLNSFRFLEQAINYEAEAQIEI--LEDGG------KVQQ
GATB_NEIMB       -----------EEFGTRREIKNLNSFRFLEQAINYEAEAQIEI--LEDGG------KVQQ
GATB_PSEAE       -----------AEFGTRAEIKNVNSFRFIEKAINHEIQRQIEL--IEDGG------KVVQ
GATB_RALSO       -----------APFGTRCEIKNLNSFRFLEEAINYEVRRQIEL--IEDGG------TVVQ
GATB_MORCA       -----------TPFGTRCELKNLNSFRFIHRAIKSEIERQIDV--IEDGG------KVVQ
GATB_HUMAN       -----------EPLGVRTEVKNLNSIRFLAKAIDYEIQRQINE--LENGG------EILN
GATB_BORBU       ---------GVEHKTPIAEIKNLNSFKSIKAAIEYEELRQQQE--WIQFKKTLNS--CGK
GATB_TREPA       ---------GQEHHTPISEIKNMNSYRMVRDACTYEVQRQLQE--FWQKGPASKEEMQRK
GATB_NOSS1       ---------GQEKFGTKVEIKNMNSFSAIQKAIEHEIERQIEA--IESG------EKIIQ
GATB_SYNY3       ---------GQKEFGTKVEIKNMNSFSAIQKAIEYEIERQIKA--IADG------EEIYQ
GATB_ARATH       ---------GQAEFGTKVEIKNLNAFSAISRAIDFEISRQALL--YNQGK----ADQIVT
GATB_AQUAE       ---------GSKEFGTRVEIKNVNSFRFVQKALEYEIERQINV--VEEGG------EVVQ
GATB_THEMA       ---------ETGRQSNRVEVKNMNSFRFVERALEYEFERIVKA--MERGE------DVER
GATB_FUSNN       ---------GSKVFGTRVEVKNLNSFKAVARAIDYEIGRQIEL--IQNGG------KVDQ
GATB_BACHD       ---------GQEEFGTKTELKNLNSFNFVRKGLEYEEKRQAQV--LLSGG------EILQ
GATB_BACSU       ---------GQEEFGTKTELKNLNSFAFVQKGLEHEEKRQEQV--LLSGF------FIQQ
GATB_LISIN       ---------GQEEFGVKTELKNLNSFNNVRKGIEYEEKRQAEV--LKSGG------IIEQ
GATB_LISMO       ---------GQEEFGVKTELKNLNSFNNVRKGIEYEEKRQAEV--LKSGG------IIEQ
GATB_GEOSE       ---------GSDQFGTKTELKNLNSFNFVRMGLEYEAKRQGKI--LLSGG------VIRQ
GATB_STAAM       ---------GQEKFGTKAELKNLNSFNYVRKGLEYEEKRQEEE--LLNGG------EIGQ
GATB_STAAU       ---------GQEKFGTKAELKNLNSFNYVRKGLEYEEKRQEEE--LLSGG------EIGQ
GATB_STASP       ---------GQKEFGTKTELKNLNSFNYVKKGLEYEEKRQEEE--LLNGG------EIGQ
GATB_STRP1       ---------GQEQFGTKTELKNLNSFSNVRKGLEFEVERQAKL--LRSGG------VIRQ
GATB_STRP8       ---------GQEQFGTKTELKNLNSFSNVRKGLEFEVERQAKL--LRSGG------VIRQ
GATB_STRPN       ---------GQEKFGTKTELKNLNSFSNVRKGLEYEVQRQAEI--LRSGG------QIRQ
GATB_LACLA       ---------GQEAFGVKTEVKNMNSFSNVKKALDFEVDRQAKI--LRAGG------EIRQ
GATB1_CLOAB      ---------GAKEFGVRTEIKNMNSFKAVEKALNYEYERHIKA--IESGE------KLTQ
GATB_CALS4       ---------GTTELGTKIELKNLNSFKAVQKALEYEIKRQIKV--LEEGG------TIVQ
GATB2_CLOAB      ---------GSTEYNTKVEIKNINSFRELQKALEKEEKRQKELYDFNEGF------RIKQ
GATB_CHLMU       ---------GSKELRNKVEIKNMNSFTFMAQALEAEKHRQIEEYLSHPNEDPK--KVVPA
GATB_CHLTR       ---------GSRELRNKVEIKNMNSFTFMAQALEAEKRRQIEEYLSYPNEDPK--KVVPA
GATB_CHLPN       ---------GSPELRNKVEIKNMNSFAFMAQALEAEKQRQIDEYLNQPNKDPK--LVIPA
GATB_HELPY       ---------GDEKLYTRVEIKNLNSFRFIAKAIEYEIERQSAAWE---NGRYN--EEVVQ
GATB_HELPJ       ---------GDEKLYTRVEIKNLNSFRFIAKAIEYEIERQSVAWE---NGRYN--EEVVQ
GATB_CAMJE       ---------GDTKLYTRVEIKNLNSFRFIQKAIEYEVKRQSEAWE---DGTYE--QEVVQ
GATB_MYCLE       -----------VEFGTRSEIKNVNSLKSVEMAVRYEMQRQGAI--LVSGG------RIAQ
GATB_MYCTU       -----------TEFGTRTETKNVNSLKSVEVAVRYEMQRQGAI--LASGG------RITQ
GATB_CORGL       -----------EEFGTRTETKNINSLKSVEQAITFEMQRQAQV--LDDGG------VIDQ
GATB_STRCO       -----------EKFGTRSETKNVNSLRSVERAARFEIQRHAAV--LNDGG------TIIQ
GATB_DEIRA       -----------EPWGTKVEVKNLNSFRSVARAIEYEAARQAKV--LDAGG------IITQ
GATB_THET8       -----------EPLGTKVEIKNLNSFKSVQRALEYEIRRQTEI--LRRGE------KVKQ
GATB_SACS2       -------------GGERVEVKNVGSPKDVEDAINYEIARQRAS--ILQGI------KIER
GATB_SULTO       --------------GERVEIKNIGSPREVEEALKYEIARQKAA--IAQGL------PVKR
GATB_AERPE       -------------GGERVEVKNIGSTQDVEKALKFEISRQRLI--VERGG------KVER
GATB_METJA       -------------QGNRVEVKNVNSIKGVYKVLKYELIRQKNI--IKRGG------EVKR
GATB_METTH       -------------GGKRVEIKNINSIKGAYKALKFEMIRQKNL--LKRGV------EVKQ
GATB_METKA       -------------GGARVEIKNINSIKGVYRALRFEIQRQLNL--MKHGR------EVRR
GATB_METAC       ----------------RVEVKNISSHKGVERALLYEIMRQKNV--IRRGG------TIVQ
GATB_METMA       ----------------RVEVKNISSHKGVERALLYEIMRQKNV--IRRGG------KITQ
GATB_ARCFU       ----------------RVEIKNISSFKGVEKALSYEIMRQKNL--LQRGR------SVVR
GATB_HALSA       LAGEGGPSDDVLEAANRTEVKNISSHRAAQKALAYETTRQRNQ--LERGM------AVAQ
GATB_MYCGA       -----------PNYGTRVEIKNINSINNVEKAINFEISRQQELLLSNK--------KVVQ
GATB_MYCPE       -----------KEFGTRVEIKNINSINNVEKAIEYESNLQAEQILKQE--------EVLM
GATB_UREPA       -----------KKFGTKVEIKNINSISNVAKAIDYEIRRQLNLILLNQ--------NVEQ
GATB_MYCGE       -----------RQLGTKIEIKNINSLNNVEKAIDLEINRQVKALINGE--------TLSQ
GATB_MYCPN       -----------TAFGTKVEIKNINSLNNVEKAIDLEIARQVKALIKGE--------PVQQ
GATB_MYCPU       -----------DKLGTKVEIKNLNSLNNVKKAIDLEIKDQFQKLINNQ--------EIIQ
GATB_YEAST       ---------------ARVELKNLPNTSSIINAIKYEYQRQVELISVGDTS-------SLM
                                   * **:            *                        

GATB_AGRFC       ETRLFDPGKGETRSMRSKEDAHDYRYFPDPDLLPLEFDDAF-------------VEALKV
GATB_RHIME       ETRLFDANKGETRSMRSKEEAHDYRYFPDPDLLPLEFDDAF-------------VEALKA
GATB_BRUME       ETRLFDPVKGETRSMRSKEEAHDYRYFPDPDLLPLEFDQAF-------------VDALAA
GATB_RHILO       ETRLYDAVKGETRSMRSKEEAHDYRYFPDPDLLPLEFDQAY-------------VDALAK
GATB_CAUVC       ETRLFDPTKGETRSMRSKEEAHDYRYFPDPDLLPLVLDPAW-------------VKSIEE
GATB_RICCN       ETRLFNADSGETRTMRLKEEALDYRYFPDPDLLPLVISDEL-------------INELKA
GATB_RICPR       ETRLFNVDSCETKTMRLKEEALDYRYFPDPDLLPLIIPDEL-------------INELKA
GATB_NEIMA       ATMLFDPEKGETRVMRLKEDAHDYRYFPDPDLLPVIISDDR-------------LQKAKA
GATB_NEIMB       ATMLFDPEKGETRVMRLKEDAHDYRYFPDPDLLPVIISDAQ-------------MQKAKA
GATB_PSEAE       ETRLYDPNKDETRSMRGKEEANDYRYFPCPDLLPVVIEPEY-------------LAKLRE
GATB_RALSO       ETRLYDPDRKETRSMRSKEDAHDYRYFPDPDLLPLMIGADW-------------VDAVRA
GATB_MORCA       ATRLYDPERDETRAMRTKEEANDYRYFPDPDLLPVIISDET-------------LAKVRA
GATB_HUMAN       ETRSFHHKLGCTMSMRDKEGKQDYRFMPEPNLPPLVLYDATSLPAGADPQQVINIDQIRE
GATB_BORBU       HTRGFDDRSGVTVIQRNKETVSDYRYFQEPDLPLIEIDDSYIDNIK------------NL
GATB_TREPA       RTMGWDPVEGVTLLQRTKHSLRDYRFMRDPDLPDLHLTPAYVQHL-------------SY
GATB_NOSS1       ETRLWEEGSQRTISMRIKEGSSDYRYFPEPDLAPIEVTEAQLSQW-------------RS
GATB_SYNY3       ETRLWEEGSQRTISMRKKEGSSDYRYFPEPDLPPLEVSEQQKQTW-------------FA
GATB_ARATH       ETRLWEEGAQKTVTMRKKEGLADYRYFPEPDLPEVILTQEYVDSI-------------RA
GATB_AQUAE       ETRTFDPQTGKTYPMRTKEEAEDYRYFPDPDLVPLKVKKEWIEEI-------------KK
GATB_THEMA       ETRGWDMATKITVSMRGKEEESDYRYFPEPDIPPVVLSDEYLEEV-------------KK
GATB_FUSNN       ETRLWDEENQITRVMRSKEEAMDYRYFNEPDLLKLVISDEEIEEI-------------KK
GATB_BACHD       ETRRYDEAANKTVLMRVKEGSDDYRYFPEPDLVALHIDDEWKARI-------------RS
GATB_BACSU       ETRRYDEATKKTILMRVKEGSDDYRYFPEPDLVELYIDDEWKERV-------------KA
GATB_LISIN       ETRRFEEATGKTSLMRIKEGSDDYRYFPEPDLVDLFIDDAWKERI-------------RA
GATB_LISMO       ETRRFEEATGKTSLMRIKEGSDDYRYFPEPDLVDLFIDDAWKERI-------------RA
GATB_GEOSE       ETRRFDEATKTTILMRVKEGSEDYRYFPEPDLVMLYNDDEWKERV-------------RA
GATB_STAAM       ETRRFDESTGKTILMRVKEGSDDYRYFPEPDIVPLYIDDAWKERV-------------RQ
GATB_STAAU       ETRRFDESTGKTILMRVKEGSDDYRYFPEPDIVPLYIDDAWKERV-------------RQ
GATB_STASP       ETRRFDESTGKTILMRVKEGSDDYRYFLEPDIVPLYVDEDWKARV-------------RE
GATB_STRP1       ETRRYDEANKGTILMRVKEGAADYRYFPEPDLPLYEIDDAWIDEM-------------RA
GATB_STRP8       ETRRYDEANKGTILMRVKEGAADYRYFPEPDLPLYEIDDAWIDEM-------------RA
GATB_STRPN       ETRRYDEANKATILMRVKEGAADYRYFPEPDLPLFEISDEWIEEM-------------RT
GATB_LACLA       ETRRFNDKTGETILMRVKEGASDYRYFPEPDVPRFEISEEWVEQM-------------RE
GATB1_CLOAB      ETRRWDDAKNETAPMRSKEEANDYRYFPEGDLVTLNIDDEWIESI-------------RK
GATB_CALS4       ETRRWNEAKGITEPMRTKEEAHDYRYFPEPDLVPIIVTEEWKEEI-------------RK
GATB2_CLOAB      ETRRWDSGKGKTVTMRTKEDANDYRYFPEPDIIPIVVKDELLEKV-------------KE
GATB_CHLMU       ATYRWDPEKKKTVLMRLKERAEDYMYFVEPDLPVLQITESYIDEV-------------RQ
GATB_CHLTR       ATYRWDPEKKKTVLMRLKERAEDYMYFVEPDLPVLQITETYIDEV-------------RQ
GATB_CHLPN       ATYRWDPEKKKTVLMRLKESAEDYKYFPEPDLPTLQLTESYIERI-------------RK
GATB_HELPY       ETRLFDTHKGITLSMRNKEESADYRYFKDPDLYPVFIDEKLLKEA--------------Q
GATB_HELPJ       ETRLFDTAKGITLSMRNKEESADYRYFKDPDLYPVFIDEKLLKEA--------------Q
GATB_CAMJE       ETRLFDTTNLVTRSMRGKEEAAEYRYFPDPDLLPVLLKDEFLD----------------I
GATB_MYCLE       ETRHFHE-DGYTSPGRAKETAQDYRYFPDPDLEPVAPSRELVEQLR-------------Q
GATB_MYCTU       ETRHFHE-AGYTSAGRTKETAEDYRYFPEPDLEPVAPSRELVERLR-------------Q
GATB_CORGL       ETRHYQEADGSTSKGRPKETAEDYRYFNDPDLPPVIAPREWVEEIR-------------A
GATB_STRCO       ETRHFHEDTGSTTSGRVKEEAEDYRYFPEPDLVPVAPSRQWVEEIR-------------S
GATB_DEIRA       DTLGWDEGGQKTFLMRTKEGEADYRYFPEPDLPPLDITPEWIAEVR-------------A
GATB_THET8       ATMGFEEGSGKTYPMRTKEEEADYRYFPEPDLPPVAIPRDWLEEVR-------------R
GATB_SACS2       ETRHWDNERRVTVPLRTKETEEDYRYFPDPDLPPYSITPELIEKFK-------------R
GATB_SULTO       ETRHWDSERKVTVPTRTKETEEDYRYFPDPDLPPYPITQDLIEEIR-------------K
GATB_AERPE       ETRHWDAERGMTKPLRLKEEEADYLYFPDPDLPPVEITEDMLAEAE-------------K
GATB_METJA       ETRAFLESQMITKAMRSKETAEDYRYIPDPDIQPIVISEKWVKEIE-------------E
GATB_METTH       ETRAFLESQMITVSMRLKEEAEDYRYIPDPDLPPMKFTDEVVEGLR-------------E
GATB_METKA       ETRAFREDQGTTVAMRSKETAEDYRYIPDPDIPVFEITEDLWEKAV-------------A
GATB_METAC       ETRHFDEGRGVTLSMRTKEEAEDYRYFREPDLMPMRIT-DWIPAIK-------------E
GATB_METMA       ETRHFDEGRGVTISMRTKEEAEDYRYFREPDLMPMRVT-GWIPAIK-------------E
GATB_ARCFU       ETRHFDEARNITVSLRSKEEEQDYRYFPEPDLVPVLTE-EIVREVE-------------G
GATB_HALSA       ETRHWDEARGVTVSMRSKEEEKDYRYFREADIPPLEVS-DWKDEI---------------
GATB_MYCGA       ATMRYDDQLNQTVFMREKTNAIDYRYMFEPNIIGINLDQQFLSEVD--------------
GATB_MYCPE       ATKRFNDKTLTTEFMRLKTTNVDYHYMVEPNIFVRKISDDFITDVI--------------
GATB_UREPA       QTRRFDDNTNTTVFMRSKNDAINYRYIREANIAPIHLSDDYVKKMF--------------
GATB_MYCGE       ATLSFDDKTNNNVFMRKKDNTIDYRYFIEPNIMTSNIDDLLLEK----------------
GATB_MYCPN       VTLTYDDKTNTNVFMRKKDNSVDYRYFIEPNIMSSNIDELLQKP----------------
GATB_MYCPU       VTKRFNEKDQVLETMRKKESTINYMYFPEPNIPIIKLEQDFIDKVQ--------------
GATB_YEAST       EPETRGWTGSSTVKLRSKETTIDYRYMPDPELPYINLAPDVISGVRGLMPQ--LPDDIMR
                  .             * *    :* ::   ::                            

GATB_AGRFC       DLPELPDDKKARFVADLGLSVYDASILVSEKAIADYYEAVAAGRD-------AKTAANWV
GATB_RHIME       DLPELPDDKKERFVRDLGLSVYDASVLVSEKAIADYFEAVAEGRD-------GKAAANWV
GATB_BRUME       KLPELPDVKKQRLVETLGISVYDASILVTEKAIADYYEAVAEGRD-------GKAAANWV
GATB_RHILO       ELPELPDDKKARLITSLGLSTYDASILVSEKSVADYFEKVAAGRD-------GKLAANWV
GATB_CAUVC       TLPELPDAKKARLQSQYGLSAYDAGVLIIDADRADYFEAAAKGRD-------AKLVANWV
GATB_RICCN       NLPELPDQKIEKYTKEFSLSKYDAEVIVADESVAEYFEKAANECN-------PKMLTNWL
GATB_RICPR       SLPELPDQKIEKYIKKFGLSQYDAGIIVSDEAVAEYFEKAANECN-------PKMLTNWL
GATB_NEIMA       EMPELPKEMAARFVADYGVSDYDARLLTASRVQAAYFEEAAKESG------QGKLTANWM
GATB_NEIMB       EMPELPKEMAARFVADYGVSEYDARLLTASRAQAAYFEEAAKESG------QGKLTANWM
GATB_PSEAE       QLPELPVQKRERFESQYGLSAYDASVLSASREMADYFEKVQGICG------DAKLAANWV
GATB_RALSO       TLPELPAAMAARFESAYGLPRYDASILTATKATAAYFEAVVAAAGAA----NAKAAANWI
GATB_MORCA       DMPELPSVRKERFVNEFGLTAYDANVLNGSRELSDYFLQVLDIIGKN----NAKIAANWV
GATB_HUMAN       TLPELPSVTREKLVQQYGMLLEHSFTLLNEVGLLEFFQNVIKETRAE-----PKKVTSWV
GATB_BORBU       KLIELPFHARIRLKGQYGLSDFDVITLTADKHLLKYFEEAVINSS------DPKKVANWI
GATB_TREPA       TVGELPAARRARFKLDLGLSAFAAQTLTGSRMLADWFEKAAHASK------NARRVANWI
GATB_NOSS1       ELPELPAQKRHRYENELGLSAYDTRVLTEDVIVSQYFEVAIASGA------NPKAAANWI
GATB_SYNY3       TLPELPSAKRARYEQKLGLSAYDARVLTEDRDVALYFEEAVNAGA------DPKAVANWV
GATB_ARATH       SLPELPEAKRRRYE-AMGLGMQDVLFLANDVSVAEYFDAVIGKGA------EVKLAANWI
GATB_AQUAE       NMPELPDQRFERLIKEYGLSEYEAGILVNHKEVGDFFEEAVRHFK------EPKGIVNWL
GATB_THEMA       ELPELPDEKAERFMREYGLPEYDAKVLTSSKELAEFFEECVKVVN------RPKDLSNWI
GATB_FUSNN       DMPETRLAKIERFKNNYSLDEKDAFILTEEVELSDYFEEVVKYSN------NAKLSSNWI
GATB_BACHD       EIPELPDARKKRYVEELGLPAYDAMVLTLTKEMSDFFEETIAKGA------DPKLASNWL
GATB_BACSU       SIPELPDERRKRYIEELGFAAYDAMVLTLTKEMADFFEETVQKGA------EAKQASNWL
GATB_LISIN       EIPELPDKRQIRYINDLGLPAYDAMVLTLTKEMSDFFEATLAAGA------DAKQASNWL
GATB_LISMO       EIPELPDKRQIRYINDLGLPAYDAMVLTLTKEMSDFFEATLVAGA------DAKQASNWL
GATB_GEOSE       SIPELPDARQKRYVEEWGLPEYDAKVLTLTKEMADFFXATVANGA------DPKLASNWL
GATB_STAAM       TIPELPDERKAKYVNELGLPAYDAHVLTLTKEMSDFFESTIEHGA------DVKLTSNWL
GATB_STAAU       TIPELPDERKAKYVNELGLPAYDAHVLTLTKEMSDFFESTIEHGA------DVKLTSNWL
GATB_STASP       TIPELPDERKAKYVNDLGLPEYDAHVLTLTKEMSDFFEGAIDHGA------DVKLTSNWL
GATB_STRP1       QLPQFPAQRRAKYEEELGLSAYDASQLTATKVLSDFFETAVSLGG------DAKQVSNWL
GATB_STRP8       QLPQFPAQRRAKYEEELGLSAYDASQLTATKVLSDFFETAVSLGG------DAKQVSNWL
GATB_STRPN       ELPEFPKERRARYVSDLGLSDYDASQLTANKVTSDFFEKAVALGG------DAKQVSNWL
GATB_LACLA       SLPMTAKARRAHYINDLALSDYDARQLTATKEVSDFFDQAIKFDT------DPKLVSNWL
GATB1_CLOAB      TIPELPYQKRERFIKEFGIPKYDASVLTLTMSMADFFEKTAKISG------DAKSASNWL
GATB_CALS4       TLPEMPDAKRERFITQYGLPEYDAKVITSSKKMADFFEKCASNYH------SPKIVSNWL
GATB2_CLOAB      EMPELPVERKARFEDQYKLGSKEIEILIEDKALADYFEKLVEAGC------ESKTASNWI
GATB_CHLMU       TLPELPHSKYMRYITDFDLAEDLAMILVSDRHTAHFFETATMSCK------NYRALSNWI
GATB_CHLTR       TLPELPHSKYMRYITDFDIAEDLAMILVGDRHTAHFFETATMSCK------NYRALSNWI
GATB_CHLPN       TLPELPYDKYHRYIQEYGLSEDIASILISDKNIATFFEVACKDCK------NFRSLSNWV
GATB_HELPY       KINELPSAKKIRYMKDFNLKEDDANLLVSDPLLAQYFESMLHLGV------KAKTSVTWL
GATB_HELPJ       KINELPGAKKIRYMKDFNLKEDDANLLVSDPLLAEYFESMLNLGV------KAKTSVTWL
GATB_CAMJE       KIPELPDEKKVRFIDKLGIKESDAEVLISSLEMSRFFESLISQNL------NPKLCVNWL
GATB_MYCLE       TIPELPWLSRKRIQQEWGISDEVMRDLVNAGAVELVAATVKNGASS-------EQARAWW
GATB_MYCTU       TIPELPWLSRRRIQQEWGVSDEVMRDLVNAGAVELVAATVEHGASS-------EAARAWW
GATB_CORGL       TLPELPWVRRARIQEEWKLSDAEMRDLINANALDLIIETVEAGTTP-------DEARAWW
GATB_STRCO       GLPELPLVRRNRLREEWGISGNDMQSILNAGALDPIVATIDAGADA-------ASARKWW
GATB_DEIRA       RMPELPAQKLERYRAAGVRESDAQTLSLSVSLSKFYDEALKSGSDTQKP--DAQKLANWL
GATB_THET8       SLPELPWEKEARYRALGIKEKDAEVLAYTPSLARFLDQALPLGLAS------PQALANWL
GATB_SACS2       EMPELPDQRAERFVKQYNVTPYQAQVLVNEKALADLFEEITNNYKNYAK------VANLL
GATB_SULTO       TLPELPDLRIKRLVTQYGISDYDATVLVMDKALADLFEETAKHYSN------YKKLVNLL
GATB_AERPE       LASKTPG-TIYREIESMGVRREIAWSITSTLPAARLFLEAVKLGADPRI------AARLV
GATB_METJA       KMPETPLAKKKRFVEEYGIDEEDAKVLVSDLDMAEMFEEVVKSLGVNKE--NVDLAVTWI
GATB_METTH       RIPEAPHLKVKRFMEEYGLREEDARVLTSELELADAFEEVAGSIDP-------EFAALWM
GATB_METKA       RAPEPPHHRARRMAEEYGISLEAAEALVTEREWADFFEEVVEKAPDDWD---IEFIDQWV
GATB_METAC       TLPELPDAKRTRFIEQYGITDMHARALTSKIMLADFYEGVCAKGVDPKI------AATWT
GATB_METMA       TLPELPDAKRARFMEQYGITDMHARALTSKIMLADFYEGVCAKGVDPKV------AATWT
GATB_ARCFU       TLPEMPEEKRERLKRQYGIGDNFAKVLILDVKMADYFEEV-AKLVDPKL------AASWI
GATB_HALSA       PIPELPDARRERFRTEYGVGDETASKLTSRKAVADLFEEL-ADEYDAAL------AATWV
GATB_MYCGA       QIQVFNIKELESKLLSEGVDQQFVELLLDNFFLYQKINEINQRINDL------AFVSKWL
GATB_MYCPE       KNNYTDIKSIEADLLKNNVSQEFINLLMDDYELFQKFKFINDEIKDC------NEVIKWL
GATB_UREPA       LTKSCSINDLRQQLAQKGLVSSAIEQLLSDGPLFKAFKYVDKIVNNP------LSVYKWL
GATB_MYCGE       -PVAFQLEQFQKELIDSNVNPQLVQLVVDDATIFSAFQTINSVIKNP------QETIRWL
GATB_MYCPN       -NKAFNLTEFFTKLKEAGVNEQLNQLVVDDLTLFNAYTKINSVINSP------QDTIRWL
GATB_MYCPU       INELPNEKKLRYQ--KANINKIYINLLINDPKLSKYFDKINYDDKE--------KISNIF
GATB_YEAST       ILMKKPYQLSLKDAKILTYNSNQNDMYNHEALRSYYLDTFREFSKLAGERSNAKLPTNWI
                                                                             

GATB_AGRFC       INDLLGALNKFGKDIET-----------------------TPVSPDQLGGIIDLIKAETI
GATB_RHIME       INDLLGALNKAGKTIEE-----------------------TPVSPAQLGGIIDLIKDGTI
GATB_BRUME       INDLLGALNKAGKDIEE-----------------------SPISPAQLGAIIDLIKEGTI
GATB_RHILO       INDLLGQLNKVGKDIEN-----------------------APVSPDQLGAIIDLIKDGTI
GATB_CAUVC       TNELLAKLSAAGTEFTN-----------------------SPLPHTDIAQLVELIENGTI
GATB_RICCN       TSELFGQLNKASIGINE-----------------------CKITPSNFAKLVKLIENDTI
GATB_RICPR       ITELFGQLNKASIGIRE-----------------------CKITPSDFAKLIKLIEHDTI
GATB_NEIMA       NGELAATLNKEGMELAD-----------------------SPITAPRLAALVGKIADGTL
GATB_NEIMB       NGELAAALNKEGMELAD-----------------------SPITAPRLAALVGKIADGTL
GATB_PSEAE       MVELGSLLNKDGLEIEQ-----------------------SPVSAEQLGGMILRIKDNTI
GATB_RALSO       MGEVASNLNRAGLEIDA-----------------------APVSPVQLAGLLARIADGTI
GATB_MORCA       MGELSGSLNKNELTIDQ-----------------------SPISAKRLAGLIVRILDDTI
GATB_HUMAN       LNTFLGYLKQQNLAVSE-----------------------SPVTPSALAELLDLLDSRTI
GATB_BORBU       LSEVLSVLNDKGISVLE-----------------------FNLLPSYITELVEFIVAGKI
GATB_TREPA       LSEVLAVVNEKNICIAE-----------------------LNLSPEAIAELMDAVEDQRI
GATB_NOSS1       TQDIAAYLNKQKLSITE-----------------------IGLTPANLADVITRIETGKI
GATB_SYNY3       TQDIAAYLNNNRLTISG-----------------------LALKPSALAELIDLITKGTI
GATB_ARATH       MSDIAAYLKNEKLSIND-----------------------IKLTPQELAELIAAIKDGTI
GATB_AQUAE       INDLLGLLRDKGISIEE-----------------------SPVKPEHLAELVKLIKEKVI
GATB_THEMA       MTEVLRELNERNIEITE-----------------------SKLTPQHFADLFKLMDEGKI
GATB_FUSNN       LTEVLRILKHKNIDIEK-----------------------FTISSENLAKIIKLIDKNTI
GATB_BACHD       MGEVSGYLNAEQKELDE-----------------------VALTPDGLAKMIQLIEKGTI
GATB_BACSU       MGEVSAYLNAEQKELAD-----------------------VALTPEGLAGMIKLIEKGTI
GATB_LISIN       MGEVSAYLNAEQKELHD-----------------------TGLTPENLAGMIKLIEAGTI
GATB_LISMO       MGEVSAYLNAEQKELHE-----------------------TGLTPENLAGMIKLIEAGTI
GATB_GEOSE       MVEVSGYLNAKQKELHD-----------------------IALTPESLASMIKLIQNGTI
GATB_STAAM       MGGVNEYLNKNQVELLD-----------------------TKLTPENLAGMIKLIEDGTM
GATB_STAAU       MGGVNEYLNKNQVELLD-----------------------TKLTPENLAGMIKLIEDGTM
GATB_STASP       MGGVNEYLNKNQVELKD-----------------------TQLTPENLAGMIKLIEDGTM
GATB_STRP1       QGEVAQFLNAEGKTIEE-----------------------IALTPENLVEMIAIIADGTI
GATB_STRP8       QGEIAQFLNAEGKTIEE-----------------------IALTPENLVEMIAIIADGTI
GATB_STRPN       QGEVAQFLNAEGKTLEQ-----------------------IELTPENLVEMIAIIEDGTI
GATB_LACLA       QGEVAQYLNSEKKELHE-----------------------IGLTPENLTEMIRLISDGTI
GATB1_CLOAB      MGDISKIMKENYVWIED-----------------------LKFTPEQLSELIKLINEGTV
GATB_CALS4       MGEFARLLNDTGKEIDE-----------------------VPITPDMLIELLKLVDDNVI
GATB2_CLOAB      LGDMLRLMRETETDSKA-----------------------IPVPVEHMNQLIEMIKTKEI
GATB_CHLMU       TVEFAGRCKATGKTLPF-----------------------TGILPEWVAQLVNFIDRGVI
GATB_CHLTR       TVEFAGRCKARGKTLPF-----------------------TGILPEWVAQLVNFIDRGVI
GATB_CHLPN       TVEFGGRCKTLGVKLPS-----------------------SGIFPEGVAQLVNAIDQGVI
GATB_HELPY       CVELLGRLKAE-ITLEN-----------------------CGVSTHMLGALAKRIDEGKI
GATB_HELPJ       CVELLGRLKAE-VTLEN-----------------------CGISAHALGALAKRIDEGKI
GATB_CAMJE       NTELMGLLKGE-LTIEN-----------------------SPVDAQKLGVLIKRIEDGTI
GATB_MYCLE       GNFLVQKANEANITLD-----------------------ELAITPAQVAVVVALVDEGKL
GATB_MYCTU       GNFLAQKANEAGIGLD-----------------------ELAITPAQVAAVVALVDEGKL
GATB_CORGL       VSYISQKANESGVELD-----------------------ALGVAPAHVARVVALVSEGKL
GATB_STRCO       MGELARSANESGKALD-----------------------ELAITPVQVARVAELVTKGEL
GATB_DEIRA       LTDVAGALAAQEKGVE-----------------------DSDLQPAHLAALVGLIDAGTI
GATB_THET8       LADVAGLLHERGLRLE-----------------------ETRLSPEGLARLVGLFERGEV
GATB_SACS2       INDYMRWLNE------NNITVT-----------------QSKAKANHIIELFEYLDSGLI
GATB_SULTO       INDYLRWLNDKNLRPSQ-----------------------SKAGSQHLVELLKLLDDGVI
GATB_AERPE       GVDLKGELKEMG----KDLYSP-----------------NNWPPPQSIAILSNLVARGDY
GATB_METJA       RNELRRSLQY------HKVDLY-----------------ESGVKAEHIVELIKLIKEGVI
GATB_METTH       RDELKRVLYY------NKISFA-----------------ESMITPGDIIELLAMIRKKEI
GATB_METKA       RKEIKKILNK------KEMTFR-----------------EAKITPEEFIELLELVREDKI
GATB_METAC       ADVFLGELNY------RDLAISSYGGKTIGFIHAKDPEVENSFKGSDMVELVTLFAEGKI
GATB_METMA       ADVLLGELNY------RDLAISSYDGRTIGFIHAKDPEVENSFKVSDMVELVTLFAEGKV
GATB_ARCFU       VDVLRGELNY------RDWSFA---------------KCWEVFKPEEFAKLLKYFEEDRI
GATB_HALSA       ADNVLGELNY------RDLSLD-----------------DVADRDDEFERLVELVAEDEI
GATB_MYCGA       LIEFMGRINKQKLQLEL----------------------INPKWFDNLTDLL-VLVKSED
GATB_MYCPE       CVEFVGSLNKVNLKLKD----------------------ATDFQLNQLLKMMKYLLKDAS
GATB_UREPA       CLEFIGLINKNTQNIEE----------------------ITPELLQKIARMI-LLFDQTL
GATB_MYCGE       CIELIGQLNKTNSSLTA----------------------NLIQDLITLIEML----KAAK
GATB_MYCPN       CIELMGQLNKLQKPLKD----------------------KTIDHLIILIQMV----QKGT
GATB_MYCPU       FSEIVALANKQNRHATD----------------------LNIKASDIEDLLK--ELEQGN
GATB_YEAST       IHEFLGDLNKLQIPLAKA---------------------KEILPPPVFAQFLKLLHEEVI
                                                                   .         

GATB_AGRFC       SGKIAKD-LFEIVWNEGG---------NPAEIVEARGMKQVTDTG--AIEKAVDDIIAAN
GATB_RHIME       SGKLAKD-VFEILWNEGG---------DPAEIVESRGMKQVTDTG--AIEKAVDEIIAAN
GATB_BRUME       SGKIAKD-LFEIVWNEGG---------DPKKLVEERGMKQVTDTG--AIEKAVDDVIAAN
GATB_RHILO       SGKIAKD-LFEIVWSEGG---------DPRALVESRGMKQVTDTG--AIEKAVDEVIAAN
GATB_CAUVC       SSKIAKE-VFEHMWAGEG---------RPAEIVEKRGLVQINDTG--AIEKAIDDLIAGN
GATB_RICCN       SGKIAKT-VFEIMFETGK---------APDKIVEEKGLVQVSDNN--VLNTVIDEVIAEN
GATB_RICPR       SGKIAKT-VFEIMFETGK---------APDKIVEEKRLVQISDNK--ILNTVIDEVIAEN
GATB_NEIMA       SSKLAKK-AFEAMWAEPE--------ASIAEIIEKHGLQQMTDTG--AIEAMVDEVLANN
GATB_NEIMB       SSKLAKK-AFEAMWAEPE--------ATIAEIIEKHGLQQMTDTG--EIEAMVDEVLANN
GATB_PSEAE       SGKLAKM-VFEAMANGE---------GSADQIIEAKGLKQVTDSG--AIEKMLDEVLAAN
GATB_RALSO       SNNTAKKDVFPAMWAGEHG-------GDADAIIAEKGLKQMSDSG--ELEKIIDEVLAAN
GATB_MORCA       SGKIAKE-VFGHLWESDK---------SADEIITEKGLKQETDTG--AIEAIIVDVLANN
GATB_HUMAN       SSSAAKQ-VFEELWKREG--------KTPGQIVSEKQLELMQDQG--ALEQLCHSVMEAH
GATB_BORBU       SGKMAKR-VFSEMMTRGVS-------A--SVVISENQLEQVSDKF--VIKQIVLEVLDEN
GATB_TREPA       TGKQAKD-IFAQMLATGAR-------A--QDIISAQGLAQLSDEE--EIATLVQTVFQEH
GATB_NOSS1       SNAQAKQ-KLPELL-TGLS-------P--EKAFAGQEL--ISDPS--VLEPIVDEVIAAN
GATB_SYNY3       SGKIAKD-ILPELLEKGGS-------P--QKIIEARGLVQISDPD--ELTAIIQAVIADH
GATB_ARATH       SGKIGKE-ILFELLAKGGT-------V--KGMIKAKDLVQITDPA--EIEKMVIQVVSEN
GATB_AQUAE       STKIGKE-VIKEMVETGKT-------P--SQIVEEKGLKQITDEN--QIKELVKKIFEKH
GATB_THEMA       SIKIAKE-IFPEVFETGKM-------P--SQIVEEKGLTQINDEK--LIEELVKKAMEQN
GATB_FUSNN       SSKIAKE-VFEIALDDSRD-------P--EIIVKEKGLVQLSDTS--EIEKMVDEVLANN
GATB_BACHD       SSKIAKK-VFKDLIEKGGD-------P--EEIVKAKGLVQISDEG--ELRKYVVEVLDNN
GATB_BACSU       SSKIAKK-VFKELIEKGGD-------A--EKIVKEKGLVQISDEG--VLLKLVTEALDNN
GATB_LISIN       SSKIAKK-VFRELAQNGGD-------A--EQVVKDKGLVQISDEG--ALRTIIGEILDNN
GATB_LISMO       SSKIAKK-VFRELAQNGGD-------A--EQVVKDKGLVQISDEG--ALRTIISEILDNN
GATB_GEOSE       SSKIAKK-VFKELVEHSGD-------P--EKIVKEKGLVQISDEG--ALRKIVLEVLDAN
GATB_STAAM       SSKIAKK-VFPELAAKGGN-------A--KQIMEDNGLVQISDEA--TLLKFVNEALDNN
GATB_STAAU       SSKIAKK-VFPELAAKGGN-------A--KQIMEDNGLVQISDEA--TLLKFVNEALDNN
GATB_STASP       SSKIAKK-VFPELAENGGD-------A--KQIMEDKGLVQISDEA--TLLKFVTDALDNN
GATB_STRP1       SSKMAKK-VFVHLAKNGGS-------A--RAYVEKAGLVQISDPA--VLVPIIHQVFADN
GATB_STRP8       SSKMAKK-VFVHLAKNGGS-------A--RAYVEKAGLVQISDPA--VLVPIIHQVFADN
GATB_STRPN       SSKIAKK-VFVHLAKNGGG-------A--REYVEKAGMVQISDPA--ILIPIIHQVFADN
GATB_LACLA       SSKIAKK-VFIELAKNGGS-------A--EEFVKKAGLVQISDPA--VLLPIIHDVFAKN
GATB1_CLOAB      SNAIGKK-VIIKMFETGKS-------P--KNIIEEEGLIQNSNED--EILNIVKEVLSEN
GATB_CALS4       SGSIAKT-VFEEMFFTGKN-------P--QIIVEEKGLRQIADEG--ELRRIVRKVIEEN
GATB2_CLOAB      SNTAAKE-VFEEMFKTSKE-------P--KVVVKEKGLSQISDES--ALQKMVEDVINNN
GATB_CHLMU       TGKIAKE-IADKMVSSFGE-------SPEDILRRHPSLLPMTDDH--ALRAIVKEVVAQN
GATB_CHLTR       TGKIAKE-IADRMVSSFGE-------SPEDILRRHPSLLPMTDDH--ALRAIVKEVVAQN
GATB_CHLPN       TGKIAKE-IADLMMESPGK-------NPEEILKEKPELLPMSDEG--ELQKIIAEVVLAN
GATB_HELPY       SGKSAKD-VLDKLLEEQGG-------D-VDALIEQMGLSQVNDTE--AIVKVIEEVLKNN
GATB_HELPJ       SGKSAKD-VLDRLLEEQGG-------D-VDTLIEQMGLSQVNDTE--AIVKVIEEVLKNN
GATB_CAMJE       SAKAAKD-VLAFVFENTSV-------E-IDEAIEKLGLKQVSDDS--AIEAVIEQILNAN
GATB_MYCLE       SIRLARQVVEGVLAGEG----------EPEQVMVDRDLALVRDDS--VMQAAVDEALAAD
GATB_MYCTU       SNSLARQVVEGVLAGEG----------EPEQVMTARGLALVRDDS--LTQAAVDEALAAN
GATB_CORGL       TNKLARQAIDGVIAGEG----------DVDAVVAARGLEVVRDDG--AIEKAVDDALAAN
GATB_STRCO       NDKLARQVILGVLAGEG----------TPDEVVDKRGLKVVSDEG--ALTTAVDEAIAGN
GATB_DEIRA       SGKIAKDLLPDVLAGH-----------DPAQLVQERGLSVVTDTG--AIDAAIDAAMEAD
GATB_THET8       TSRVAKSLLPEVLEGQ-----------DPEALVRERGLKVVADEG--ALKALVAEAIAAM
GATB_SACS2       SIKIVKELLPEMILTG----------KTPGQLIKEKGMTNIKDEN--YLERIIDEVLNEE
GATB_SULTO       TIKIAKEILPEIVLEGKMP----------SSIIKERGLVAIKDED--YLINVIKEVINEE
GATB_AERPE       TYDSIKGLVVPKLAAN------------PGSDVKSLLPEKVKD-----IERLVEEVLNRE
GATB_METJA       SQKIAKEIVDLLVINRGKK--------MPKELVEELGLTVIRDED--ALVKAVEEAIKNN
GATB_METTH       TSKAAKKIIEEMPLN--KK--------GPREIATEMGLIGIIDES--EVIRAVEQAIREN
GATB_METKA       TRQNALNALWEAVDS--DK--------SPVEIIEENGLLKVSDED--RLARVVEEVIEEN
GATB_METAC       SDRAAVEVI-RTILDGTEE-------KTPSQIIEEKGLFKAEDD---LVTKAVAETIAEN
GATB_METMA       SDRAAVEVI-RTILDGNEE-------KSPSQIIEEKGLFKAEDD---LVTRAVAETIAEN
GATB_ARCFU       TEKGVVEVI-RTKLD--EG-------GEIDAIIQKKGLFAIPKE---EIIKFCKEAIEEN
GATB_HALSA       TAKNAEEVVLRTMLD--ED-------RAPDEIVDAEGLGKTSGD---AVADAVAEAIAEN
GATB_MYCGA       LNQKQAKVVLDEIIKTDET-------V--AEIVDRLKMKQIKDEQ--EIIALLEPIVLEN
GATB_MYCPE       INAKQGKEIVKLLIETNKD-------I--DTLIEENNFKQITDKN--VLRPILEKYVEAN
GATB_UREPA       INGKQTKIILEKIYLTNKD-------P--QILIKELGFEQITNEN--EITKLWHQILAKN
GATB_MYCGE       VNQKQAKQLITLMIETKKD-------P--KSLAKLHNLEQITDPK--ELQKIIKKIFQEN
GATB_MYCPN       VNQKQAKQLIELMLDNGQD-------P--QSLAKLHNLEQITDEK--QLTQIIQQIFKEN
GATB_MYCPU       ISGKHLKKLIPLLVDNQKE-------I--KELLEENKMILISDQS--YLRAKILEIIEAN
GATB_YEAST       SATSGKMLLFHILENFEQSNCQDLSIPDFSKLIEKFELHAINQVDPQELMDLCNDVIAQH
                                                                         .   

GATB_AGRFC       PDQ--VEKVKA-KP----TLAGWFVGQVMKATGGKA-NPQAVQALVKAKLGIEDE---
GATB_RHIME       PDQ--VEKAKA-KP----SLAGWFVGQVMKATGGKA-NPQAVQALVKSKLGIEE----
GATB_BRUME       PDK--VEQAKA-KP----TLAGWFVGQVMKATGGKA-NPQAVNELVKSKLGIEE----
GATB_RHILO       PDK--VEQARA-KP----TMAGWFVGQVMKATGGKA-NPQAVNDLVKAKLGIE-----
GATB_CAUVC       PDK--AEAVKD-KP----QALGWFVGQVMKATGGKA-NPGTVNELLRKKLGVE-----
GATB_RICCN       PES--VEGYRSGKD----KLFGFFVGQVMKKTGGKA-NPTLVNQLLKEKLSS------
GATB_RICPR       SKS--VKCYKSGKD----KLFGFFVGQVMKKTECKA-NPTLVNKLLKDKLDS------
GATB_NEIMA       AKA--VEQFKSGNE----KALNAIVGQVMKASKGKA-NPAQVQELIKAKLA-------
GATB_NEIMB       AKA--VEQFKSGNE----KALNAIVGQVMKASKGKA-NPAQVQELIKAKLA-------
GATB_PSEAE       AEQ--VEQYRAADEAKRGKMFGFFVGQAMKASKGKA-NPQQVNELLKKKLEA------
GATB_RALSO       AKS--VEEFRAGKD----KAFNALVGQAMKATRGKA-NPSQVNELLKKKLGAA-----
GATB_MORCA       QAM--VDEYKGGKE----KAFNGLVGQVMKASRGKA-NPAQVNALLKQMIGA------
GATB_HUMAN       PQV--VMDVKNRNP----RAINKLIGLVRKATQSRA-DPVMIKEILEKKLSL------
GATB_BORBU       PKS--IELYKKGKD----HAIKFMMGQIMKKSSGKI-NPILANEILLESLSNV-----
GATB_TREPA       PKA--LRDWQHGKT----NVAAWLMGQVMKRSRGRA-HPARVATLVHQALSQL-----
GATB_NOSS1       PKE--LEKYRNGNI----NLKGFFVGQVLKKTNKRA-DPKLTNELVENKLNG------
GATB_SYNY3       PKE--LEKFRSGKG----NMQGFFVGQVMKRTGGKA-DPKLTNQLIGKLLAQA-----
GATB_ARATH       PKQ--LEQYRSGKT----KLQGYFAGQVMKMSKGKA-NPGLLNKILLEKLNAKD----
GATB_AQUAE       PKE--VERLKQGEE----KLIGFFVGQVMRETRGKA-NPQVVNKVIRELVKEV-----
GATB_THEMA       PKA--VQDYKSGKK----KAAGFFVGYVMRETKGKA-NPELTNRIIQKLLEGE-----
GATB_FUSNN       QKM--VDDYKSADEGRKPRVLKGIVGQVMKISKGKA-NPEIVNDLIMEKLK-------
GATB_BACHD       QQS--IDDFKNGKD----RAIGFLVGQIMKATKGKA-NPPMVNKLLLEEINKR-----
GATB_BACSU       PQS--IEDFKNGKD----RAIGFLVGQIMKASKGQA-NPPMVNKILLEEIKKR-----
GATB_LISIN       EQS--IIDYKNGKD----RAVGFLVGQVMKATKGQA-NPPMVNKILLEEMNKR-----
GATB_LISMO       EQS--IVDFKNGKD----RAVGFLVGQVMKATKGQA-NPPMVNKLLLEEMNKR-----
GATB_GEOSE       PQS--VEDYKNGKD----RALGFLVGQVMKATKGQA-NPPLVNKLLVEEIKKR-----
GATB_STAAM       EQS--VEDYKNGKG----KAMGFLVGQIMKASKGQA-NPQLVNQLLKQELDKR-----
GATB_STAAU       EQS--VEDYKNGKG----KAMGFLVGQIMKASKGQA-NPQLVNQLLKQELDKR-----
GATB_STASP       PQS--IEDYKNGKG----KAMGFLVGQIMKASKGQA-NPQKVNSLLKQELDNR-----
GATB_STRP1       EAA--VADFKSGKR----NADKAFTGFLMKATKGQA-NPQVAQQLLAQELQKLRD---
GATB_STRP8       EAA--VADFKSGKR----NADKAFTGFLMKATKGQA-NPQVAQQLLAQELQKLRD---
GATB_STRPN       EAA--VADFKSGKR----NADKAFTGFLMKATKGQA-NPQVALKLLAQELAKLKEN--
GATB_LACLA       EQS--VADYRGGKQ----NAAKALVGQLMKATKGQA-NPTVAQKLLYQELDNF-----
GATB1_CLOAB      EKS--IEDYKNGKN----RVVGFLIGLVMKKTKGKA-NPKIVNKLMIDELNKQ-----
GATB_CALS4       PKS--VEDYKKGKE----KALGFLVGQVMKETKGKA-NPQLTNQLLREELSK------
GATB2_CLOAB      EKS--VLDYKAGKK----QAIGYLVGQVMKQSKGKA-NPPMVKELLEKVLSE------
GATB_CHLMU       AAS--VEDYKNGKA----KALGFLVGQIMKRTEGKA-PPKRVNELLLAAMRDA-----
GATB_CHLTR       TAS--VADYKNGKA----KALGFLVGQIMKRTEGKA-PPKRVNELLLAAMRDM-----
GATB_CHLPN       PES--IVDYKNGKT----KALGFLVGQIMKRTAGKA-PPKRVNELLLLELDKG-----
GATB_HELPY       ADK--VLEYKSGKD----KLFGFFVGQAMKNLKGA--NPSVVNAILKEKLG-------
GATB_HELPJ       ADK--VLEYKSGKD----KLFGFFVGQAMKNLKGA--NPSVVNAILKEKLD-------
GATB_CAMJE       ADK--VAEYKSGKD----KLFGFFVGQTMKEGKGAF-NPAKVNEILKTKLG-------
GATB_MYCLE       PDV--AEKIRGGKV----AAAGAIVGAVMKTTRGQA-DAARVRELVLAICGQG-----
GATB_MYCTU       PDV--ADKIRGGKV----AAAGAIVGAVMKATRGQA-DAARVRELVLEACGQG-----
GATB_CORGL       PDI--VEKYRAGNT----KVTGAIVGAVMKATRGKA-DPAQVNQLIAKKLA-------
GATB_STRCO       PGV--ADKIRGGKV----AAAGALVGAVMKATRGQA-DAARVKELILEKLGVAEG---
GATB_DEIRA       PAT--VEKVRGGNA----KAMNALFGPVMKAMGGKA-KPEVVRERLTAKLGL------
GATB_THET8       PEA--AESVRQGKV----KALDALVGQVMRKTRGQA-RPDLVRRLLLEALGVG-----
GATB_SACS2       KEA--VEKAKR-DP----KVVNYLVGMVMKKTGKRA-DPQMTVEIIKKKLGLT-----
GATB_SULTO       PDA--AEKAKNDPK-----VINYLVGKVMKKTGKRA-DPQLTNELIKKILGIK-----
GATB_AERPE       KRA--VQDYLAGKK----KALNYLVGQVMRAAKGRALDPRQAREILLRRLSTVKEEDR
GATB_METJA       PKA--VEDYLNGKK----EALNFLMGQVMRLTRGRA-DPKRVIELLKERLDK------
GATB_METTH       PGA--VEDYHAGKE----AAINFLVGQVMRMTRGKA-EPERTVELIKERI--------
GATB_METKA       PQA--VEDYKSGKE----EAIHYLMGQVMRKTRGQA-DPEVTMRLLRERLDSDG----
GATB_METAC       AAA--VQDYLGGTE----KSLNFLVGQVMKKTKGTA-DAKTARELILKELKG------
GATB_METMA       EAA--VQDYLGGTE----KSLNFLVGQVMKKTKGTA-DAKTARELIVKELKG------
GATB_ARCFU       PKA--VEDYLSGKR----QALNFLVGQVMKKTRGRA-DPADTAKLIEEMLS-------
GATB_HALSA       PDA--VADYHDGEG----DALNFLVGQVMAKTGGSA-DPGQVNELLRDELAQA-----
GATB_MYCGA       LAI--LKDYDQRKE----RVEKLLIGLLMKKTNGQA-NPNVSIKVLTDLIQKHR----
GATB_MYCPE       KPM--LDQYDSRPE----RVEKFFIGMVMKDTNGQA-NPNVVTEIFNEILKLNK----
GATB_UREPA       QEM--LLQYNERPD----RVEKFFMGEIMKLTKAQA-NPTISFNVLKKILQK------
GATB_MYCGE       EKE--ILKNIDRIE----RIQKLIIGQVMHKTNNRA-NPQQVFIIVENMLHEVRERDS
GATB_MYCPN       EGE--ILKNLDRVE----RIQKLIIGQVMQRTHNRA-NPQQVFIIVEKLLHDFSERAS
GATB_MYCPU       SKI--VEEYNQRAE----KVTKFILGSLMSQTNGQA-NPVVSSKLVKEILEEKFK---
GATB_YEAST       TDDTFIRNLVTGKK---KSSLKFLIGQGMRRSQGRI-KANEFEKKFKEILNIQW----
                                        : *            .      .