CLUSTAL format seed alignment for MF_00122

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

GATC_BACHD       ------------------------------------------------------------
GATC_BACSU       ------------------------------------------------------------
GATC_BACAN       ------------------------------------------------------------
GATC_BACCR       ------------------------------------------------------------
GATC_GEOSE       ------------------------------------------------------------
GATC_LISMO       ------------------------------------------------------------
GATC_LISIN       ------------------------------------------------------------
GATC_LACLA       ------------------------------------------------------------
GATC_ENTFA       ------------------------------------------------------------
GATC_STRPN       ------------------------------------------------------------
GATC_STRR6       ------------------------------------------------------------
GATC_STRP1       ------------------------------------------------------------
GATC_LACPL       ------------------------------------------------------------
GATC_STAAM       ------------------------------------------------------------
GATC_STAA8       ------------------------------------------------------------
GATC_ARCFU       ------------------------------------------------------------
GATC_DICTD       ------------------------------------------------------------
GATC_THEYD       ------------------------------------------------------------
GATC_GEOSL       ------------------------------------------------------------
GATC_SALRD       ------------------------------------------------------------
GATC_MOOTA       ------------------------------------------------------------
GATC_DEIRA       ------------------------------------------------------------
GATC_THET8       ------------------------------------------------------------
GATC_HALSA       ------------------------------------------------------------
GATC_MYCTU       ------------------------------------------------------------
GATC_MYCS2       ------------------------------------------------------------
GATC_MYCLE       ------------------------------------------------------------
GATC_STRCO       ------------------------------------------------------------
GATC_CORGL       ------------------------------------------------------------
GATC_BIFLO       ------------------------------------------------------------
GATC_CHLAA       ------------------------------------------------------------
GATC_AQUAE       ------------------------------------------------------------
GATC_DESVH       ------------------------------------------------------------
GATC_NOSS1       ------------------------------------------------------------
GATC_THEEB       ------------------------------------------------------------
GATC_GLOVI       ------------------------------------------------------------
GATC_SYNY3       ------------------------------------------------------------
GATC_PROMA       ------------------------------------------------------------
GATC_CAUVC       ------------------------------------------------------------
GATC_RHORT       ------------------------------------------------------------
GATC_RHIME       ------------------------------------------------------------
GATC_AGRFC       ------------------------------------------------------------
GATC_RHILO       ------------------------------------------------------------
GATC_BRADU       ------------------------------------------------------------
GATC_RHOS4       ------------------------------------------------------------
GATC_NEIMA       ------------------------------------------------------------
GATC_NEIMB       ------------------------------------------------------------
GATC_NEIG1       ------------------------------------------------------------
GATC_PSEAE       ------------------------------------------------------------
GATC_BORPE       ------------------------------------------------------------
GATC_MORCA       ------------------------------------------------------------
GATC1_CLOAB      ------------------------------------------------------------
GATC_CLOBH       ------------------------------------------------------------
GATC_CHLTE       ------------------------------------------------------------
GATC_FUSNN       ------------------------------------------------------------
GATC_SACS2       ------------------------------------------------------------
GATC_SULTO       ------------------------------------------------------------
GATC_THEMA       ------------------------------------------------------------
GATC_RICPR       ------------------------------------------------------------
GATC_RICCN       ------------------------------------------------------------
GATC_ORITI       ------------------------------------------------------------
GATC_HELPJ       ------------------------------------------------------------
GATC_HELPY       ------------------------------------------------------------
GATC_CAMJE       ------------------------------------------------------------
GATC_LEPIN       ------------------------------------------------------------
GATC_ORYSI       ----------------MLSAAASA--IPRLRWAAPP--RNQSARNQWLLLRRRSLSSSPP
GATC_ORYSJ       ----------------MLSAAASA--IPRLRWAAPP--RNQSARNQWLLLRRRSLSSSPP
GATC_SORBI       ----------------MLSAAAAAAVIPKLRFATRPQLRRPAARTYW----PRPLSSSS-
GATC_POPTR       ----------------MGSRAVLL-----LKGPSPP------KHSILFLLNHKKISPAPS
GATC_RICCO       ----------------MGSRALLL-----LKVALPL------KHQIKCL-NYTKITPASE
GATC_VITVI       ----------------MGSRALLL-----LKATTA---------ETLLFTSKSTFSKAL-
GATC_ARATH       ----------------MATRALLA-----VIYASPN--RCYISPSRIKIQSLTCSSSSHY
GATC_PICSI       ---------MIFLGPVLLTRGALS--FFLTAGGSSVYRAWSWWLSGIHLFMAFSMSTSSL
GATC_CHLMU       ------------------------------------------------------------
GATC_CHLTR       ------------------------------------------------------------
GATC_CHLPN       ------------------------------------------------------------
GATC_HUMAN       -------------------------------------------------MWSRLVWLGLR
GATC_BOVIN       -------------------------------------------------MWARAVHLGLR
GATC_CANLF       -------------------------------------------------MWARAVRFGLR
GATC_MOUSE       -------------------------------------------------MWSRAASVRFR
GATC_RAT         -------------------------------------------------MWAQAARVQFR
GATC_SALSA       ------MYVVVNYTRRLQTLAFNLGSSCYHQGVTGASITSQDRKSKQNFSCCRWTHLITL
GATC_TETNG       ------MSVLRFATRR--GLSWCYASRLTHQG---TSVTSGEG-SPGTRTSRVPARVLNL
GATC_DANRE       -----------MLCKCAAGALRALRPATPRIGVLNLTALSASL-SANRTSWSRWTHM---
GATC_BRAFL       --------------------------------------------MNHLHRLFRITQVDRP
GATC_IXOSC       -------------------------------------------------MFRRSVSFVRS
GATC3_CULQU      MIGIPFHLRPPPGRTLHSLVRTIASTKPADLSG-------------------TQDKSTRQ
GATC4_CULQU      MIRIPFHLRQTPGRTLHSLVRSFASTKPADLSG-------------------TQEKSTRQ
GATC1_CULQU      MIRIPFRLRPPPGRTLHSLVRTFASTKPADLTG-------------------TQEKNTRQ
GATC2_CULQU      MIQSCRKLFRSD--RCPNLHRKKPAYLEAGQRG-------------------FPEKSTRQ
GATC_AEDAE       MFRHIFTLGPRSISAITVRSRRALSSTAKPVSA-------------------PVTSDDRP
GATC_ANODA       MIR---------GWTIFTLCK------PSALVG-------------------SSHFNKQF
GATC_DROSE       --------------MLRLLSKRFYCKIATK------------------------SNEKAT
GATC_DROSI       --------------MLRLLSKRFYCKIATK------------------------SNEKAT
GATC_DROYA       --------------MLRLLSKRLYCKIATK------------------------SNEKAT
GATC_DROME       --------------MLRLFSSRFYCKIATK------------------------SNEKAT
GATC_DROAN       --------------MLRLLNKRFYCKFATK------------------------TKVRPE
GATC_DROMO       ------------------------------------------------------------
GATC_DROVI       ---------------MLRISARFYCKIATQSSF--------------KAAEYKNKIKKDK
GATC_DROGR       ---------------MLQISARFYCKIAKQ-----------------QISELPKISKPSK
GATC_DROPE       -------------MNKNCISASWRCDERTARQVCSADDSDKMADCCKRPEDFQCPINKTA
GATC_DROPS       --------------MLRVLSRRFYCKIAAKTNF------------------------KTA
GATC_DROWI       -------------MLRISNKIRFYCKIAAK-------------------------SDLKS
GATC_BRUMA       --------MNLSTIGFQVIFKQRLRCVRFGVRC------------------ISRETLGCN
GATC_LOALO       ------------MISFQIILQQRLRSLRFGKRC------------------KSKRTLKSN
GATC_CAEEL       ------------MNLIF------TRIIRRFGEG------------------KRKTPFPGD
GATC_CAERE       ------------MNRFFKIVLTSTRRASTNGSG------------------KRKTPFEGD
GATC2_CLOAB      ------------------------------------------------------------
GATC_DICDI       ------------------------------------------------------------
GATC_TRIAD       ----------------------------------------------------MAVKPSAN
                                                                             

GATC_BACHD       -------------------------------MSRIS--MEQVKHVAHLARLAITEEEAKL
GATC_BACSU       -------------------------------MSRIS--IEEVKHVAHLARLAITEEEAKM
GATC_BACAN       -------------------------------MSRIS--VENVKHVAHLARLAITDQEAEK
GATC_BACCR       -------------------------------MSRIS--VENVKHVAHLARLAITDQEAEK
GATC_GEOSE       -------------------------------MSRIS--IEQVKHVADLARLAITDEEAEM
GATC_LISMO       -------------------------------MSNIS--KETVEKVANLAKLEVSETEATA
GATC_LISIN       -------------------------------MSNIS--KETVEKVANLAKLEVSETEATA
GATC_LACLA       -------------------------------MSQIT--EEQVKHVALLSKLEFSENEVKS
GATC_ENTFA       --------------------------------MAIT--EEQVKHVAKLSKLSFSEEELAD
GATC_STRPN       --------------------------------MKIT--QEEVTHVANLSKLRFSEEETAA
GATC_STRR6       --------------------------------MKIT--QEEVTHVANLSKLRFSEEETAA
GATC_STRP1       --------------------------------MKIS--EEEVRHVAKLSKLSFSESETTT
GATC_LACPL       -----------------------------MAEERIN--AEQVQHVASLAKLEFTPDQLAM
GATC_STAAM       -------------------------------MTKVT--REEVEHIANLARLQISPEETEE
GATC_STAA8       -------------------------------MTKVT--REEVEHIANLARLQISPEETEE
GATC_ARCFU       ---------------------------------MVS--IEDVYHTAELAKIEITEEQAEK
GATC_DICTD       --------------------------------MEKRDFKEQLKKTAHLARLYLTPEEEEL
GATC_THEYD       --------------------------------MKIS--KEEVKHIAMLSRLELNEEEIGV
GATC_GEOSL       --------------------------------MKIT--RTDVEHVATLARLELTEDEKDR
GATC_SALRD       --------------------------------MSVT--RDDVRHVAQLARLDFSEEEEAR
GATC_MOOTA       --------------------------------MPIS--TAEVEHVALLARLKLSPEEKTA
GATC_DEIRA       ---------------------------------MID--AAQIDHLTALARLELSPAERRT
GATC_THET8       --------------------------------MELS--PELLRKLETLAKIRLSPEEEAL
GATC_HALSA       ------------------------------MTDAVD--AEEIRHVADLARLRLDDEDVDT
GATC_MYCTU       -------------------------------MSQIS--RDEVAHLARLARLALTETELDS
GATC_MYCS2       -------------------------------MSQIS--RDEVAHLARLARLALTEDELDG
GATC_MYCLE       -------------------------------MSPIS--RDEVLHLARLTRLVLTDTELAS
GATC_STRCO       -------------------------------MPGIT--REEVAHLARLARLELKPEELEH
GATC_CORGL       -------------------------------MPEIS--RDQVAHLAKLSRLALTEEELEQ
GATC_BIFLO       -------------------------------MPTFS--REEIVHLGDLARIALTDEEITR
GATC_CHLAA       --------------------------------MALS--EAEVRHVARLARIALSDEEIAL
GATC_AQUAE       ---------------------------------MVD--REWVLKIAKLARLELKEEEIEV
GATC_DESVH       --------------------------------MKIS--KEQVATIARLARLDLDEARLER
GATC_NOSS1       ---------------------------------MID--REQVRKVALLARLELTPEEEEQ
GATC_THEEB       -----------------------------MTTKVIT--AEDVRKVAHLARLAIDESEIEA
GATC_GLOVI       ---------------------------------MID--REQVKKVAFLARLEISEQEQEM
GATC_SYNY3       ---------------------------------MLD--QSQVQKIAHLARLEITPEEESQ
GATC_PROMA       -------------------------------MTRIS--SDDVRKVSKLARLEISEEHVET
GATC_CAUVC       --------------------------------MAID--AATVRKVARLARIATPEERLEP
GATC_RHORT       --------------------------------MALD--KTTVAKIATLARLDIEEDRMEA
GATC_RHIME       --------------------------------MSVD--LATVKRVARLARIAVSDEEAER
GATC_AGRFC       --------------------------------MSVD--LATVKRVARLARIAVSEEEAQN
GATC_RHILO       --------------------------------MSVD--LQTVKRVARLARIAVSEEDAER
GATC_BRADU       --------------------------------MSVD--AATVRRIAHLARIAVSEGEVPH
GATC_RHOS4       --------------------------------MSID--IETARRVAHLARIRVDEADLPA
GATC_NEIMA       --------------------------------MALT--LADVDKIARLSRLHLTAAEKEK
GATC_NEIMB       --------------------------------MALT--LADVDKIARLSRLHLTAEEKEK
GATC_NEIG1       --------------------------------MALT--LADVDKIARLSRLQLTAEEKEK
GATC_PSEAE       --------------------------------MALE--RSDVEKIAHLARLGLSEADLPR
GATC_BORPE       --------------------------------MALN--EQDVARIARLARIELTPDQRGR
GATC_MORCA       --------------------------------MTIT--TEDILDCANLSRLALDEKTAQN
GATC1_CLOAB      --------------------------------MSVS--KKDVEYVAELARLSFSEEQKEG
GATC_CLOBH       --------------------------------MSVS--KKDVEYVAELARLEFKEEEKDS
GATC_CHLTE       --------------------------------MSVT--TKDVAYIAELARLKFTDAEQEK
GATC_FUSNN       --------------------------------MALT--REEVLKIAKLSKLSFEDKEIEK
GATC_SACS2       --------------------------------MKIEVNENLIKHLENLSLIQLSGEEEKI
GATC_SULTO       --------------------------------MKIEVNNELISRLQNLALVELNDREKER
GATC_THEMA       ---------------------------------MIKVTKDLVLHLENLARLELSEDQRES
GATC_RICPR       ---------------------------------MIT--KEEAQKIAKLARLKFEKDIVEK
GATC_RICCN       ---------------------------------MIT--KEEAQKIAKLARLKFEEDTVEK
GATC_ORITI       ---------------------------------MIS--INEVQSIANYCKLRFNEQELNH
GATC_HELPJ       --------------------------------MQID--DALLQRLEKLSMLEIKDEHKES
GATC_HELPY       --------------------------------MQID--DALLQRLEKLSMLEIKDEHKES
GATC_CAMJE       --------------------------------MQID--EKLLSKLEKLSALQITKNRNET
GATC_LEPIN       --------------------------------MNIN--EDSLQKIAELSRLKIRSEEKEA
GATC_ORYSI       YVTPGIP-----------------AAAAAAGSGALE--PPDLPRLANAARISLSPEEAEE
GATC_ORYSJ       YVTPGIP-----------------AAAAAAGSGALE--PPDLPRLANAARISLSPEEAEE
GATC_SORBI       HVTP-----------------------AAAGAGELE--PPDLTRLANAARISLSPQEAED
GATC_POPTR       I---RRF-----------------TTKATANGSSLE--PPDVARLAETARISLTPQQVEE
GATC_RICCO       LLTKRRF-----------------SIKATN-GSSLQ--PPDVSRLAETARISLNQNEVEE
GATC_VITVI       ----IRN-----------------STRSFSTRSALL--PPDLPRLAETARISLTPHEVEE
GATC_ARATH       YQRQSRKNHRIA-----------RSYSSDSDSSVLQ--PPDVARLAQTARISLTPAEIEE
GATC_PICSI       YKVGFGFVCTKSPCLRVSLISRSQPWRFYSVHNNFE--APDVVQLAAKARISLTPKEVED
GATC_CHLMU       -----------------------------MTQSYVN--KEEIISLAKNAALELEEAHVEE
GATC_CHLTR       -----------------------------MTESYVN--KEEIISLAKNAALELEDAHVEE
GATC_CHLPN       -----------------------------MEQFHLD--REEILLLAKASALQLSEELIQE
GATC_HUMAN       APLGGRQGFTSKADPQ-------------------GSGRITAAVIEHLERLALVDFGSRE
GATC_BOVIN       AAARGRRGFTSKADPQ-------------------GSGRVTGELIQHLERLSLVDFGSQE
GATC_CANLF       SWVAWRRGFTSKADPQVAKQ-VRTRYPHSPPHSPQGNGRVSAQVIEHLERLALVDFGSQE
GATC_MOUSE       APLDAGRSFASKANPQGKVQ-AAGLGTQAPRLVPQGSGRVSPAVIEHLERLALVNFGSRE
GATC_RAT         APLDRGRSFASKVGPRGKVQ-AADPKTQAPRLVPEGTDRVSAAVVEHLERLALVNFSSRE
GATC_SALSA       VHQYSTRISNSKVPRVATWE-PVLENQ------LPPPCQIPVDLVDKLERLALVDFRNQE
GATC_TETNG       TRPLSCRAYNSKVPQSPTWE-PVSEDL------LPPCAQFPADLVDKLERLALVDFRTKQ
GATC_DANRE       -RDSSNAAWTPKVPQTPTWE-PVAESQ------LPPATRISPDLVDKLERLALVDFGSEE
GATC_BRAFL       VLLAITRRLSSKVPTEPTWK-EVDESK------LPNPTKIDQDTIAHLERLALVDFANKE
GATC_IXOSC       HVLRSFSS-QPVVPVTPIVK-NPASQG-------AGTIKLEQSTVELLERLSLVDFSNAE
GATC3_CULQU      KINFHELKHPSKVPQRPN------KSTID-GQSTPTRIPVDTQTVQLLERLSLVDLDSAE
GATC4_CULQU      KINFHELKHPSKVPQRPH------KSTID-GQSTPTRIPVDAQKGQLLERLSLVDLDSAE
GATC1_CULQU      KINFHELKHPSKVPQRPH------KSTTTVGQSTPTRIPVDAQTVQLLERLSLVDLDSAE
GATC2_CULQU      KINYHELKHLSKVPQRPH------KPTID-GQSTPTRIPVDAQTV----RLSLVDLDSAE
GATC_AEDAE       NLDVKHLKHPTKVPQQPH------KSDIDRRQEPVPRISVDDQTVQLLERLSLVDLDSKE
GATC_ANODA       NWAKSQLQFATKVPQQPYAK-T--ESILPTLQEPDTKPAIDRHTVQLLERLSLVDLETND
GATC_DROSE       KLYFKQLTHPTKVPQTPV------DAEFPDTSASE--IQIDTKTIQLLERLSLVDLDSER
GATC_DROSI       KLDFKQLTHPTKVPQTPV------DAEFPDTSASE--IQIDTKTIQLLERLSLVDLDSER
GATC_DROYA       KLDFKQLTHPTKVPQTPV------DAEFPDTSSSE--IQIDTKTIQLLERLSLVDLDSER
GATC_DROME       KLDFKQLTHPTKVPQTPV------DSKFPDTSASE--IQIDTKTIQLLERLSLVDLDSER
GATC_DROAN       KLNFKQLTHPTKVPQTPV------KAAFPNTSANE--IELDPKSIQLLERLALVDLDSER
GATC_DROMO       -MVAALLSHPTKVPQTPV------PAAFPDTSKNP--IEIDTNTIKLLERLSLVDLDSDQ
GATC_DROVI       KLNFTQLLHPTKVPQTPV------PAAFSDPSENV--VEIDTKTIQLLERLSLVDLDSDQ
GATC_DROGR       LLDFKQLHHPTKVPQTPV------PTAFPDATNNSE-IEIDAKTIQLLERLSLVDLDSEQ
GATC_DROPE       KLDFKELRYATKVPQTPV------DTVFPETTANR--VEIDAKTIQLLERLSLVNLDSEQ
GATC_DROPS       KLDFKELRYATKVPQTPV------DTVFPETNANR--VEIDAKTIQLLERLSLVNLDSEQ
GATC_DROWI       KLDFTQLRHPTKVPQQPE------PNAFPDLDNNTDDDPIDSKTIQLLERLSLVDLDSEE
GATC_BRUMA       SVAASSADEDDKIYVP-----KKPILSPIDQSKVEEPPVFDKALITHLERLSLVWFTDEQ
GATC_LOALO       STAVGSSDEDDEIYVP-----KKPIPSPIDQSKVEEPPVFTKALITHLERLSLVRFSDEQ
GATC_CAEEL       PILVPDEPYDSKIQ----------------ESQLSPMPQIDAKLINHLERLSLVRFDSEQ
GATC_CAERE       KVHIPDEPYNSKVRFFICFKKKLKHGIQIDESLLSEMPPIDAKLISHLERLSLVRFDSEQ
GATC2_CLOAB      -------------------------------MSDKHVDIDTVKYISKLSKLKFTDNEAKK
GATC_DICDI       -------------------------------------------------MLSIPEDKVEQ
GATC_TRIAD       LGKAFQLPHPFNSCVYIQIPPQPTWSINEYWERNPNKQYLDESDTTYLEELTLTPIEKHQ
                                                                   :         

GATC_BACHD       FTEQLGDIIQFAEQLNELDTEGV--EPTSHVLDM----KNVLREDKPEKGLP------VE
GATC_BACSU       FTEQLDSIISFAEELNEVNTDNV--EPTTHVLKM----KNVMREDEAGKGLP------VE
GATC_BACAN       FQKQLDAIVTFAEQLNELDTTDV--KPTTHVLTM----KNVMREDVPEKGLP------VE
GATC_BACCR       FQKQLDAIVTFAEQLNELDTTDV--KPTTHVLTM----KNVMREDVPEKGLP------VE
GATC_GEOSE       FTKQLDAIITFAEQLNELDTENV--PPTSHVLDM----RNVMREDIPEPGLP------RE
GATC_LISMO       FAGQLGKIIELVEQLNTLDTTNV--EPTSHAIDV----SNVLREDVATKGLD------RK
GATC_LISIN       FAGQLGKIIELVEQLNTLDTNNV--EPTSHAIDV----SNVLREDVATKGLD------RK
GATC_LACLA       FTDTFGKIIDMVEMLDEVDGEGV--PFTMNVADN----LNFMREDVAEKGLD------RE
GATC_ENTFA       FTNQLDKIIDMVELLEEVDTTGV--PFTSNVNES----INVMREDVATPGMD------RK
GATC_STRPN       FATTLSKIVDMVELLGEVDTTGV--APTTTMADR----KTVLRPDVAEEGID------RD
GATC_STRR6       FATTLSKIVDMVELLGEVDTTGV--APTTTMADR----KTVLRPDVAEEGTD------RD
GATC_STRP1       FATTLSKIVDMVELLNEVDTEGV--AITTTMADK----KNVMRQDVAEEGTD------RA
GATC_LACPL       FTPQLEKIIGMFEELSTVDTTGV--PVTSRMSDH----TNTLREDVAVKSDEA----LRE
GATC_STAAM       MANTLESILDFAKQNDSADTEGV--EPTYHVLDL----QNVLREDKAIKGIP------QE
GATC_STAA8       MANTLESILDFAKQNDSADTEGV--EPTYHVLDL----QNVLREDKAIKGIP------QE
GATC_ARCFU       FRKEFETILDYFNILDEVE-EDV--EPTFHVLPL----TNVFREDEPGECLK------QE
GATC_DICTD       YAKQLQDILDYFKKLQEVDTSNI--EPMAHVLSL----SNIWREDEPKGSIS------QE
GATC_THEYD       YQEQLSRILDYIEKLNEIDTTLV--EPTSHVIEL----KNVFRDDNVKGSIS------RD
GATC_GEOSL       FTGQLDAILAYVEKLNELDTDGI--IPTSHAVPV----ENAFREDEVRPSIG------VE
GATC_SALRD       MAEELSEILGYVEKLDELDTAGV--PPMSHVLDV----TNVFRSDEIEERID------RG
GATC_MOOTA       YTEQLNAILEYMDKLNALDTRDV--EPTAHVLPL----RNVFRDDCARPGLP------RE
GATC_DEIRA       MQQDLTRMLGYFEQLGRVPTEGV--QEMQRPVSL----VNVLRDDAPGETFP------SG
GATC_THET8       LLQDLKRILDFVDALPRVEEGGA--EEA----------LGRLREDEPRPSLP------QA
GATC_HALSA       VVDHCGDILEHFERLEEVPEVDA--EPE-----L----VNVMRADEIADSLD------QD
GATC_MYCTU       FAGQLDAILTHVSQIQAVDVTGV--QATDNPLKD----VNVTRPDETVPCLT------QR
GATC_MYCS2       FAGQLDAILGHVSQIQSVDVTGV--EPTDNPLKD----VNVTRPDTVQPCLT------QD
GATC_MYCLE       FSSQLDVILAHVSQIQAVDVTGV--EPTDNPLKY----VNITRPDETVPCLT------QQ
GATC_STRCO       FAGQLDDIIGAVARVSEVADQDV--PPTSHPLPL----TNVMRPDEVRPSLT------PE
GATC_CORGL       FAGQIDDIVGYVSAVQNVDAAGV--EPMSHPHSI----ATTMREDVVHKTLD------AA
GATC_BIFLO       LQGELNVIADSINKVQEVASDDV--PPTANPVPL----EAYLRPDVAETPLT------QE
GATC_CHLAA       MQAQLSAILDYIAMLQEVDVSNV--PPTAQVTGL----TTVWRPDVVGEMLT------QE
GATC_AQUAE       FQKQLSDILDFIDQLKELDTENV--EPYIQEFEE-----TPMREDEPHPSL------DRE
GATC_DESVH       FAGQFGDILDYMDMLGAVDTTDV--EPLYSPSEH----GTVLRADEVHTHC------TRE
GATC_NOSS1       FTTQLGSILDYVEQLNELDVSNV--PPTARAIDV----SNITREDNLQPYA------DRE
GATC_THEEB       LTQQLDSILDYVNQLSELDVTEV--PPTTRAIEV----SNVTRPDVLAPWP------NRE
GATC_GLOVI       FTRQLGAILDYIAELQQVDTEGV--PPTTRAIEV----HNVVRPDALVVFE------DRE
GATC_SYNY3       FASQLSSILDYFDQLNELPTEGV--EPTTRAIEL----SNIVRGDRQISWDGDNAATTRQ
GATC_PROMA       YANQLEEILEYIAQLEKIDTKNI--PPTTRAVEV----VNVLREDIVDKSN------VRD
GATC_CAUVC       LAQELNGIMTWIEQLAEVDTDGC--EPLTSVVAA----GLPLREDVVTMGG------DPA
GATC_RHORT       LAGELSGILDWIEQLAEVDTSGV--AAMTSVADL----ALAWREDAVTDGG------YAD
GATC_RHIME       MTGELNGILGFVEQLSEVDVDGV--EPMTSVMPM----KMKKRDDIVADGD------KAD
GATC_AGRFC       MLGQLNGILGFVEQLSEVNVDGV--EPMTSVTPV----EMKKRADVVTDGN------KAD
GATC_RHILO       MTGELNAILGFVEQLNEVDVSGV--EPMTSVTPM----EMKKRQDVVTDGN------KAA
GATC_BRADU       LQGELNAMLAFVEQLSEVNVEGV--EAMTSVTPM----QMKKRQDVVNDGE------IAD
GATC_RHOS4       LAGELSGILTFMEQLNEVDVEGI--EPMTSVTPM----RLKRRQDVVTDGD------MQD
GATC_NEIMA       SLQELNDIFAMVEQMQNINTDGI--EPMAHPHEA----ALRLREDEVTETD------RAA
GATC_NEIMB       SLQELNDIFTMVEQMQTINTDGI--EPMAHPHEA----ALRLREDEVTETD------RAA
GATC_NEIG1       SLQELNDIFTMVEQMQNINTDGI--EPMAHPHEV----ALRLREDEVTETD------RAA
GATC_PSEAE       TTETLNNILGLIDQMQAVDTSGV--EPLAHPLEA----TQRLRPDAVTETD------HRD
GATC_BORPE       AQAELNGILHLIERLQAVDTQGV--EPLAHPLSAHEDITLRLREDAVSEQATEA---RRA
GATC_MORCA       YAGNLDKILAMMDILDGVNTDNI--KPLANIHEA----CNELRADIANSDI------GRD
GATC1_CLOAB      FMEDLNSILGYVDKLSELDTDNV--DIIVNPYYI----ENKFREDEVEESM------DLK
GATC_CLOBH       FVNDLNKILNYMEKLDELNTDDV--DIVVNPYYI----ENKYREDNVEKSM------ELK
GATC_CHLTE       MASELNMILHYIEKLNGIDTEGV--EPLSTIHDQ----INVLRADVEHTPL------SND
GATC_FUSNN       FQVELNDILKYIDMLNEVDTSKV--EPLVYINES----VNNFREKEEKPSL------EIE
GATC_SACS2       LEKDLANIIKFFEKINELDLSNV--EPLFHPLP-----QGRLRKDVPRDPLD------RE
GATC_SULTO       IKRDIKNILDFFDQINKLDLSNV--EPLFHPIS-----TGKLRKDEIIKPLS------RD
GATC_THEMA       LMKDFQEILDYVELLNEVDVEGV--EPMYTPVED----SAKLRKGDPRFFEM------RD
GATC_RICPR       FSTQLSTIMNMINILNEIDCKDI--EPLTSVSNM----NARMREDTVTSSDL------SN
GATC_RICCN       FFTQLSTIMDMIDILNEIDCKDI--EPLTSVCNM----NARMREDAVTSSDL------SS
GATC_ORITI       MVKQLSSIVEMMNKLEKIDCTSV--PPMRHFEE-----NNRMRKDQVEQNIT------VD
GATC_HELPJ       VKGHLAEVLGFVENIFALETNN-----LKTDTHL----STPLREDEPKSQPHI-----AK
GATC_HELPY       VKGHLAEVLGFVENIFALETSA-----LKTDIEL----CTPLREDEPKSQPNT-----AK
GATC_CAMJE       I-AQLSEIVNFVEKLNELDLDSQ--EITVSTIKG----GAPLRIDEIRN-SNV-----ID
GATC_LEPIN       TLQDFNKILEYVDQIKGLDVSSI--KDDEIYLHH----ENAIRPD-LAGKHLS-----RE
GATC_ORYSI       FAPKIRQVVDWFGQLQAVDLESV--EPSLRAGTA---AGNSLREDRPETFTN------RD
GATC_ORYSJ       FAPKIRQVVDWFGQLQAVDLESV--EPSLRAGTA---AGNSLREDRPETFTN------RD
GATC_SORBI       FEPKIRQVVDWFGQLQAVDLESI--EPSLRAGTT---ADSSLREDKPETFDN------RD
GATC_POPTR       FGPKIRQVIDWHALL-SVDLDSV--EPSIRADTE---GDN-LRHDNPETFEN------RE
GATC_RICCO       FAPKIRQVIDWFGQLQAVDLNSV--EPAIRADSE---GEN-LRDDVPETFSE------RE
GATC_VITVI       FAPKIRQVIDWFGQLQAVDLQSI--EPSIRADTE---GDN-LRDDSPETFEN------RE
GATC_ARATH       CETKIRRVIDWFGQLQQVDVNSV--EPAIRAEMD---GGN-LREDAPETFDN------RD
GATC_PICSI       YGPKIGQVIDWFGQLQGVNLENV--EPAIRADTD---KLSNLRPDEPIIYED------RE
GATC_CHLMU       FVTSMNNVIALMQEVVAIDISDI-ILEATVHHFV---GPEDLREDMVTSDFT------RE
GATC_CHLTR       FVTSMNDVIALMQEVIAIDISDI-ILEATVHHFV---GPEDLREDMVTSDFT------QE
GATC_CHLPN       YQTSLSAVITSMKEALAIEIDDADSCESLFMHVV---NVEDLREDSVTSDFN------RE
GATC_HUMAN       AVARLEKAIAFADRLRAVDTDGV--EPMESVLED---RCLYLRSDNVVEGNC------AD
GATC_BOVIN       AVARLEKAIAFADRLRAVNTDGV--EPMESVLED---RCLYLRSDNVVEGSC------AE
GATC_CANLF       AVARLEKAIAFADRLRAVDTGGV--EPMESVLED---RCLYLRSDNVVEGNC------AE
GATC_MOUSE       AVDRLEKAIAFADQLHAVDTDGV--EPLESVLED---RCLYLRSDNVAEGSC------AE
GATC_RAT         AVDRLEKAVAFADQLHAVDTDGV--EPLESVLED---RCLYLRSDKVAEGGC------AE
GATC_SALSA       GLACLEKAIRFADQLHVVDTDGV--DPMDSVLEE---RALYLREDAVAEGDC------AE
GATC_TETNG       GLECLEKAIRFADQLHVVDTSGV--EPMDSVLED---RVLYLREDEEKEGDC------AE
GATC_DANRE       GVDCLEKAIRFADQLHVINTDGV--EPMDSVLED---RELYLRDDTVTEGEC------AE
GATC_BRAFL       GIRRLEAAIRFADQMFLVDTTGV--EPMDSVLED---RELYLRDDVVTEGNC------KD
GATC_IXOSC       AVSRLEEAVKFASVIMNVDTTGV--RPMVTPLED---TVLRLRDD-VAEKCS------SE
GATC3_CULQU      AHRTLEDAIEFASQILSVDTDGV--EPLNTVLER---ERLTLREDRVSDGKI------QQ
GATC4_CULQU      AHRTLEDAIEFASQILSVDTDDV--EPLYTVLER---ERLTLREDRVSDGNI------QQ
GATC1_CULQU      AHRTLEDAIEFASQILSVDTEGV--EPLYTVLER---ERLTLREDRVTDGNI------QQ
GATC2_CULQU      AHRTLEDAIEFASQILSVDTDGV--EPLYTVLER---DRLTLREDRVSDGNI------QQ
GATC_AEDAE       AHRTLEDSIEFASRILAIDTDGV--EPLYTVLEK---QKLALREDVVSDGNL------QE
GATC_ANODA       ALETLEDSIGFASRILTIGTEGV--EPLYTVLER---ERLSLREDVVNDGDL------QT
GATC_DROSE       ALATLKSSIQFADKIAHINTDHV--RPLYTVLEH---QQLQLRNDQVTEGDC------RA
GATC_DROSI       ALATLKSSIQFADKIAHINTDHV--RPLYTVLEH---QQLQLRNDQVTEGDC------RA
GATC_DROYA       ALATLKSSIQFANKIAHINTEHV--RPLYTVLEQ---QQLQLRNDQVTEGDC------RA
GATC_DROME       ALATLKSSIQFADKIAHINTEHV--RPLYTVLEH---QQLQLRNDQVTEGDC------RA
GATC_DROAN       ALETLKSSIQFADKITHIQTDNV--RPLYTVLEQ---QQLQLRNDLVTEGDC------RG
GATC_DROMO       ALDTLKSSIQFADKIANINTDNV--QPLYTVLEH---QQLQLRNDQVTAGNC------RE
GATC_DROVI       ALATLKSSIQFADKIAHIDTQNV--RPLYTVLEK---QQLQLRNDQVTAGDS------RA
GATC_DROGR       ALATLKSSIQFADKIEHIDTHNV--RPLYTVLEH---QQLQLRNDRVAEGDC------RE
GATC_DROPE       ALATLNSSIQFADKIAHINTENV--RPLYTVLEN---QQLQLRNDEVKEGDC------RV
GATC_DROPS       ALATLNSSIQFADKIAHINTENV--RPLYTVLEN---QQLQLRNDEVKEGDC------RV
GATC_DROWI       ALKTLKSSIQFANRIVDIPTENV--PALYTVLEK---QQLQLRNDSVTEGNC------RQ
GATC_BRUMA       AVFNLKEAVRFANQLKLVDTTGI--EPLETLLED---MPCPLREDVADNPMT------KA
GATC_LOALO       AVLNLKQAVRFANQLKLIDTTGI--KPLETLLED---IPCPLREDVPGDPMT------KA
GATC_CAEEL       AVANLRSSIRVAKRLELVDVEGV--EPMHTVWED---QECPTFEDVEEDPLP------IE
GATC_CAERE       AVANLRNSIRMAKRLELVDVEDV--EPMHTVWES---QECPTFDDVEEEPLP------ID
GATC2_CLOAB      LAGEFEAILGHFETIDKVDLSDI---NVNEFDEV----NTEFRKDVPKVFED------KK
GATC_DICDI       YCDDLGGFLNSVESIQSVNTENV--RPLHSILED---TQLTLHFEQTTVNQD------HE
GATC_TRIAD       ALEKLNTIISAADRLQEVDTKNV--DPMYTCVDE---REMYMNSGQDGETVN------KE
                                                                             

GATC_BACHD       DVLKNAP------DHEDGQIRVPSVLE---------------------------------
GATC_BACSU       DVMKNAP------DHKDGYIRVPSILD---------------------------------
GATC_BACAN       EVLKNAP------DHKDNQIRVPAVLE---------------------------------
GATC_BACCR       EVLKNAP------DHKDNQIRVPAVLE---------------------------------
GATC_GEOSE       EVLKNAP------DQQDGQFRVPAILE---------------------------------
GATC_LISMO       EVLKNAP------DEQDGMFKVPTIMEQ--------------------------------
GATC_LISIN       EVLKNAP------DQQDGMFKVPTIMEQ--------------------------------
GATC_LACLA       KLMAAVP------EKEDGFIKVPAMLSDGGDA----------------------------
GATC_ENTFA       ELMRNVP------ESENGYIKVPAIMDNGEAGA---------------------------
GATC_STRPN       RLFKNVP------EKDNYYIKVPAILDNGGDA----------------------------
GATC_STRR6       RLFKNVP------EQDNYYIKVPAILDDGGDA----------------------------
GATC_STRP1       LLFKNVP------EKENHFIKVPAILDDGGDA----------------------------
GATC_LACPL       ALLKNAP------ETANGLIKVPAIIDESGDGE---------------------------
GATC_STAAM       LALKNAK------ETEDGQFKVPTIMNEEDA-----------------------------
GATC_STAA8       LALKNAK------ETEDGQFKVPTIMNEEDA-----------------------------
GATC_ARCFU       EALSNAK------HKEEGYFKGPRVVE---------------------------------
GATC_DICTD       EAFKNAP------EIENLGFKIPRIIKREE------------------------------
GATC_THEYD       EALKNAP------DQTDKFFRVPKIIE---------------------------------
GATC_GEOSL       NALANAP------DRVEGFFRVPRVIE---------------------------------
GATC_SALRD       QALEPAP------DADNEHFLVPQVVE---------------------------------
GATC_MOOTA       KALQGAP------EVSEGQFKVPRVV----------------------------------
GATC_DEIRA       VVSALAP------ETQDGFIRVPRTVDTE-------------------------------
GATC_THET8       EALALAP------EAEDGFFRVPPVLE---------------------------------
GATC_HALSA       DALANAP------ETEDGRFKGPNVS----------------------------------
GATC_MYCTU       QVLDQAP------DAVDGRFAVPQILGDEQ------------------------------
GATC_MYCS2       EALAAAP------KAADGRFAVPRILGEPE------------------------------
GATC_MYCLE       QALAEAP------EAIYGRFVVPQILGDNK------------------------------
GATC_STRCO       QALSGAP------AQEQQRFKVPQILGEE-------------------------------
GATC_CORGL       AALDQAP------AVEDGRFMVPQILGEGD------------------------------
GATC_BIFLO       EALAGGP------KTEAGMFVAPRILGSEE------------------------------
GATC_CHLAA       QALANAP------DQQDGMFRVRAVFDE--------------------------------
GATC_AQUAE       KALMNAP------ERKDGFFVVPRVVEV--------------------------------
GATC_DESVH       ELLANAP------ESDGQFFVVPRIV----------------------------------
GATC_NOSS1       AILSSAP------EQEGEFFKVPKILNAE-------------------------------
GATC_THEEB       DLLAIAP------EREDDFFRVPKIM----------------------------------
GATC_GLOVI       GILENAP------ERAEDFFKVPRIMED--------------------------------
GATC_SYNY3       ALLDNAP------EPEGDFFRVPRIMGGDEA-----------------------------
GATC_PROMA       KILDLAP------NREGQFYRVPKILAE--------------------------------
GATC_CAUVC       RVTSNAP------KSINNFFVVPKVVE---------------------------------
GATC_RHORT       RVLANAP------ESQDGCFLVPKVVE---------------------------------
GATC_RHIME       DIVANAP------NSDRNFFLVPKVVE---------------------------------
GATC_AGRFC       DIVANAP------ATDRDFFMVPKVVE---------------------------------
GATC_RHILO       DIVANAP------ATEENFFLVPKVVE---------------------------------
GATC_BRADU       DIVANAP------ATEGHFFLVPKVVE---------------------------------
GATC_RHOS4       KVLSNAP------DAREGFFAVPKVVE---------------------------------
GATC_NEIMA       EYQAVAP------EVRNRLYIVPQVIEE--------------------------------
GATC_NEIMB       EYQAGAP------EVRNRLYIVPQVIEE--------------------------------
GATC_NEIG1       EYQAVAP------EVRNRLYIVPQVIEE--------------------------------
GATC_PSEAE       AYQTIAP------AVEEGLYLVPKVIES--------------------------------
GATC_BORPE       ELLANAP------ESADGLFLVPKVIE---------------------------------
GATC_MORCA       GFQAVAP------MVQDGLYLVPQVIE---------------------------------
GATC1_CLOAB      DVIKNAP------KNLEEYIVVPKIID---------------------------------
GATC_CLOBH       EVIDNAP------ESLEEYVIVPKVID---------------------------------
GATC_CHLTE       EALKNAP------DSQDRFFKVPKVIG---------------------------------
GATC_FUSNN       KVLFNAP------ESAENAIVVPKVIGE--------------------------------
GATC_SACS2       NALKNVK------RKEDGYIVGPRTYGE--------------------------------
GATC_SULTO       EALSNVK------RKEDGFIVGPATYGE--------------------------------
GATC_THEMA       LIKKNFP------EEKDGHIKVPGIHR---------------------------------
GATC_RICPR       KLFDNVSGNSAKLAKEVKYFITPKVVE---------------------------------
GATC_RICCN       ELLDNVSGNSAQLAKEVKYFITPKVVE---------------------------------
GATC_ORITI       QLLSNVPQSSATIAKNTKYFVVPKIIE---------------------------------
GATC_HELPJ       EILSQNK------HSQDHYFVVPKIIE---------------------------------
GATC_HELPY       EILSQNK------HSQDHYFVVPKIIE---------------------------------
GATC_CAMJE       EVLDCAP------KKQEHFFVVPKIIE---------------------------------
GATC_LEPIN       EIESFAP------SFQNGYFVVPKVIET--------------------------------
GATC_ORYSI       AIIESVP------SYDDPYIKVPRVLNKE-------------------------------
GATC_ORYSJ       AIIESVP------SYDDPYIKVPRVLNKE-------------------------------
GATC_SORBI       AIVEAIP------SYDDPYIKVPRVLNKE-------------------------------
GATC_POPTR       AIIAAVP------NYEDPYVKVPKVLNKE-------------------------------
GATC_RICCO       AIIAAVP------SYEKPYVKVPKVLNKE-------------------------------
GATC_VITVI       AIIAAIP------SYEEPYLKVPKVLNKD-------------------------------
GATC_ARATH       SIRASIP------SFEDAYLKVPKILNKE-------------------------------
GATC_PICSI       EMIAGVP------TLEEPFIKVPKILKSSME-----------------------------
GATC_CHLMU       EFLANVP------VSLGGLVKVPTVIK---------------------------------
GATC_CHLTR       EFLSNVP------VSLGGLVKVPTVIK---------------------------------
GATC_CHLPN       EFLRNVP------ESLGGLVKVPAVIK---------------------------------
GATC_HUMAN       ELLQNSH-----RVVEEYFVAPPGNISLPKLDEQEPFPHS--------------------
GATC_BOVIN       ELLQNSH-----RVVEEYFVAPPGNISWSKLDEKQPFSHR--------------------
GATC_CANLF       ELLQNAH-----RVVEEYFVAPPGNISLPKQDEQEPFSYNH-------------------
GATC_MOUSE       ELLQNSN-----HVVEEYFVAPPGNISLPDMVNKIPSSTAE-------------------
GATC_RAT         ELLQNSN-----HVVEEYFVAPPGNIPLPDMVGKVPSSTAE-------------------
GATC_SALSA       ELLQLSK-----NTVEEYFVAPPGNIPLPKREERAAMLKHSEF-----------------
GATC_TETNG       ELLQLSR-----NTCEEYYVAPPGNIPLPTREKRAAMLKHSEF-----------------
GATC_DANRE       ELLQLAK-----HTVEEYFLAPPGNIPLPKREERSAMLKDSEF-----------------
GATC_BRAFL       DILRNAG-----KVVEDYFVAPPGNIPLPKKEEYDS------------------------
GATC_IXOSC       DVLKNAA-----VIEEDYFVAPPGNIPLEPKANYGLGNS---------------------
GATC3_CULQU      DVLRNAC-----VTEEENFVAPPGNIPLEQEPRK--------------------------
GATC4_CULQU      DVLRNAR-----VTEEENFVAPPENIPLEQEPRK--------------------------
GATC1_CULQU      DVLRNAR-----VTEEEYFVAPPGNIPLEQEPRK--------------------------
GATC2_CULQU      DVLRNAR-----VTEEEYFVAPPGNIPLEQEPKK--------------------------
GATC_AEDAE       DVLSNAR-----ITEEEYFVAPPGNIPLEQDSSGNKHKQ---------------------
GATC_ANODA       DVLRNAA-----VTEEEYFVAPPGNIPLELQENSRPIAH---------------------
GATC_DROSE       EVLQNAK-----VTDEDYYVSPPGNIPLEQ------------------------------
GATC_DROSI       EVLRNAK-----VTDEDYYVSPPGNIPLEQ------------------------------
GATC_DROYA       EVLRNAK-----VTDEDYYVSPPGNIPLEQ------------------------------
GATC_DROME       EVLRNAK-----VTDEDYFVSPPGNIPLEQ------------------------------
GATC_DROAN       KVLSNAK-----VTDEDYFVSPPGNIPLEQ------------------------------
GATC_DROMO       ELLRCAK-----RTDEDYYVSPPGNIPLEQ------------------------------
GATC_DROVI       ELLRCAK-----VTDEDYYVSPPGNIPLEQ------------------------------
GATC_DROGR       QLLRIAK-----VTDEDYYVSPPGNIPLEQLDK---------------------------
GATC_DROPE       ELLRNAK-----VTDEDYYVSPPGNIPLEQ------------------------------
GATC_DROPS       ELLRNAK-----VTDEDYYVSPPGNIPLEQ------------------------------
GATC_DROWI       EILRNAK-----ITDEDYFVSPPGNIPLEQQNE---------------------------
GATC_BRUMA       EVLMNAA-----KVVEDYFVAPLENIPLEESDKLNLTKVEEFDRRVMAKKNLLNDSVKEK
GATC_LOALO       EVLMNAT-----KVVEDYFVTPPGNIPLEESDKLDLMKIEDDAQKEMSKKTLLKDSVKKT
GATC_CAEEL       EVFRNAS-----LRFDDFFVTPPGNLPLESKERFDLNVINEWDTIGKPVAPEVKLTRMTE
GATC_CAERE       KVFRNAA-----VRFDDFFVTPPGNVPLESNERFDLNVINKWDTIGKPVAPEAKTIRLAE
GATC2_CLOAB      KLMQNVK------SLRDGAIEVPKIIE---------------------------------
GATC_DICDI       HILDHSN------NVQGGFFTVPKQISSHTNSQKSNKNNSIDDEF---------------
GATC_TRIAD       EILGNAH------KIFQDYFTAPTSEKMRSSSDLNAKE----------------------
                                                                             

GATC_BACHD       ----
GATC_BACSU       ----
GATC_BACAN       ----
GATC_BACCR       ----
GATC_GEOSE       ----
GATC_LISMO       ----
GATC_LISIN       ----
GATC_LACLA       ----
GATC_ENTFA       ----
GATC_STRPN       ----
GATC_STRR6       ----
GATC_STRP1       ----
GATC_LACPL       ----
GATC_STAAM       ----
GATC_STAA8       ----
GATC_ARCFU       ----
GATC_DICTD       ----
GATC_THEYD       ----
GATC_GEOSL       ----
GATC_SALRD       ----
GATC_MOOTA       ----
GATC_DEIRA       ----
GATC_THET8       ----
GATC_HALSA       ----
GATC_MYCTU       ----
GATC_MYCS2       ----
GATC_MYCLE       ----
GATC_STRCO       ----
GATC_CORGL       ----
GATC_BIFLO       ----
GATC_CHLAA       ----
GATC_AQUAE       ----
GATC_DESVH       ----
GATC_NOSS1       ----
GATC_THEEB       ----
GATC_GLOVI       ----
GATC_SYNY3       ----
GATC_PROMA       ----
GATC_CAUVC       ----
GATC_RHORT       ----
GATC_RHIME       ----
GATC_AGRFC       ----
GATC_RHILO       ----
GATC_BRADU       ----
GATC_RHOS4       ----
GATC_NEIMA       ----
GATC_NEIMB       ----
GATC_NEIG1       ----
GATC_PSEAE       ----
GATC_BORPE       ----
GATC_MORCA       ----
GATC1_CLOAB      ----
GATC_CLOBH       ----
GATC_CHLTE       ----
GATC_FUSNN       ----
GATC_SACS2       ----
GATC_SULTO       ----
GATC_THEMA       ----
GATC_RICPR       ----
GATC_RICCN       ----
GATC_ORITI       ----
GATC_HELPJ       ----
GATC_HELPY       ----
GATC_CAMJE       ----
GATC_LEPIN       ----
GATC_ORYSI       ----
GATC_ORYSJ       ----
GATC_SORBI       ----
GATC_POPTR       ----
GATC_RICCO       ----
GATC_VITVI       ----
GATC_ARATH       ----
GATC_PICSI       ----
GATC_CHLMU       ----
GATC_CHLTR       ----
GATC_CHLPN       ----
GATC_HUMAN       ----
GATC_BOVIN       ----
GATC_CANLF       ----
GATC_MOUSE       ----
GATC_RAT         ----
GATC_SALSA       ----
GATC_TETNG       ----
GATC_DANRE       ----
GATC_BRAFL       ----
GATC_IXOSC       ----
GATC3_CULQU      ----
GATC4_CULQU      ----
GATC1_CULQU      ----
GATC2_CULQU      ----
GATC_AEDAE       ----
GATC_ANODA       ----
GATC_DROSE       ----
GATC_DROSI       ----
GATC_DROYA       ----
GATC_DROME       ----
GATC_DROAN       ----
GATC_DROMO       ----
GATC_DROVI       ----
GATC_DROGR       ----
GATC_DROPE       ----
GATC_DROPS       ----
GATC_DROWI       ----
GATC_BRUMA       TE--
GATC_LOALO       E---
GATC_CAEEL       -RKK
GATC_CAERE       GRRK
GATC2_CLOAB      ----
GATC_DICDI       ----
GATC_TRIAD       ----