CLUSTAL format seed alignment for MF_00123

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

SYR_AQUAE       ---------------MKELVKEKVLKALKELYNTQVENFKVEKPKEEAHGDLASNVAFLL
SYR_THEMA       --------------MLVNAIRQKVSEVISKAYGSEI-EFEVEIPPRKEFGDLSTNVAMKL
SYR1_BACHD      ------MNKMEQMKQQLREEIVVAVKAAGLATDETIPEVILETPKEKAHGDFATNMAMQL
SYR_BACSU       ------MNIAEQMKDVLKEEIKAAVLKAGLAEESQIPNVVLETPKDKTHGDYSTNMAMQL
SYR_CORGL       -------MTPADLATLIKETAVEVLTSRELDTSVLPEQVVVERPRNPEHGDYATNIALQV
SYR_MYCLE       -------MTPADLAELLKTTAIVVLAERGLDAAALPQTVTVERPRNPEHGDYSSNLAMQL
SYR_MYCTU       -------MTPADLAELLKATAAAVLAERGLDASALPQMVTVERPRIPEHGDYASNLAMQL
SYR_MYCS2       -------MTPADLAELLKATAAAVLTEHDLDVAALPATVTVERPRNPEHGDYATNLALQL
SYR_HELPY       ------------MHTLIKGILEEILEE----------EVIVEYPKDREHGHYATPIAFNL
SYR_HELPJ       ------------MHTLIKGVLEEILE----------AEVIIEYPKDREHGHYATPIAFNL
SYR_BORBU       ------MNKSVKKKIKDEINVIVTNLALSNNIKLDNININIQKPPKSDLGDISI-LMFEI
SYR_TREPA       ------MQDLCEMWRHAVARVLSQLQGPAVEPVEG-AQLVMEEPPEPGMGDIAFPL-FLF
SYR_AERPE       ------MASSIDPLTRLHGILSSYLSEV-LGVDRSVVERLLAPPPRKEYGDLGFPL-MRF
SYR_ARCFU       ---------------MFLRFIEEVIKALGEYGDK-------KFLRESEHADLASTIAFKL
SYR_METJA       --------------MDIKSNIINALKEVISKEICKEIDIKLDKTPNLELGDYSVNICFRL
SYR_METTH       -----------MFRYIEKEARDSITAALEKLGIKVPPEIKLEEPPNPQLGDLASTVSFEL
SYR_PYRAB       -----------MLSRVKEGAREKIIKVIESLAPGWKGEIEFKDTPSPELGDFGTPVAFKL
SYR_PYRHO       ------MLMEIRESVKERIEEII-----KEIAPQWEGEIELKETPDPKLGDFGTPIAFKL
SYR_MYCGE       -------------MFFIINDLKECISALKLKFDDQKE--LVKLVKNNSFNGFSSTIIFQL
SYR_MYCPN       -------------MLFINTDLQECLNALNLEFDEHKE--LVKLVKNNSFSGFASTVVFHL
SYR_RICPR       ----------MNIFNQLKQDIIAASQKLY-NNKEIANTATIETPKDSFNGDLSSNIAMII
SYR_BUCAI       --------------MNLKNTIKEDIQDALIKIAIINCDPVITLNKKTKIGHYQLNNLIKI
SYR_ECOLI       ----------MNIQALLSEKVRQAMIAAGAPADC---EPQVRQSAKVQFGDYQANGMMAV
SYR_SALTY       ----------MNIQALLSEKVSQAMIAAGAPADC---EPQVRQSAKVQFGDYQANGMMAV
SYR_HAEIN       ----------MNIQSILSDKIKQAMILAGADQSC---DALIRQSGKPQFGDYQANGIMAA
SYR_PASMU       ---------------------------MIASGADTQSDALVRQSAKVQFGDYQANGIMAA
SYR_CHLMU       ---------MTTLLSFLTSLCSSAIRQAFPELEELTLD--ITPSTKEHFGHYQCNDAMKL
SYR_CHLTR       ---------MTTLLSFLTSLCSAAIHQAFPELEELTLD--ITPSTKEHFGHYQCNDAMKL
SYR_CHLPN       ---------MSTLLSILSVICSQAIAKAFPNLEDWAPE--ITPSTKEHFGHYQCNDAMKL
SYR_SYNY3       ---------MVSILTQLNDHFAQALEGQF-PSDVTLPTPLVVPASNPKFGDFQCNIALPL
SYR_STRCO       ------MASVTSLSDSVQQHLASALTATRPEAAG--ADPLL---RRSDRADYQANGILAL
SYR_STRPN       ----------MNTKELIASELSSIIDSLDQEAILK----LLETPKNSEMGDIAFP-AFSL
                                                                         :  

SYR_AQUAE       ARELKKPPVNIAQELADFLSKDE---TFKSVE-AVKGFINFRFSEDFLKEEF-KKF-LLS
SYR_THEMA       AKTLKKNPREIAQEIVKSLDEDP---SFDRIEIMGPGFINFFLSNELLRGVV-KTV-LEK
SYR1_BACHD      ARVAKKAPRLIAEELTAKLDRKRA--AIEKIEIAGPGFINFFLDNSYLREMI-PTV-LRA
SYR_BACSU       ARVAKKAPRQIAEEIVAHFDKGKA--SIEKLDIAGPGFINFYMNNQYLTKLI-PSV-LEA
SYR_CORGL       AKKVGQNPRDLATWLAEALAADD---AIDSAEIAGPGFLNIRLAAAAQGEIV-AKI-LAQ
SYR_MYCLE       GKKVGANPLELAGWLAEVLAQAG---GIADVEVAGPGFINMRLDASAQAMIV-NTV-INA
SYR_MYCTU       AKKVGTNPRELAGWLAEALTKVD---GIASAEVAGPGFINMRLETAAQAKVV-TSV-IDA
SYR_MYCS2       GKKVGVNPRELAGWLATALTAAD---GIAVAEVAGPGFVNLRIEASAQGVII-TNV-LAA
SYR_HELPY       AKVFKKSPLAIAEELALKISTHEKTQGLFDSVVACKGYINFTLSLDFLERFT-QKA-LEL
SYR_HELPJ       AKVFKKSPLAIAEELALKIGSHEKTQGFFDRVVACKGYINFTLSLDFLERFT-QKA-LEL
SYR_BORBU       GKTLKLPIEIISEEIIKNLKTK------YEIK-AVGPYLNIKISRKEYINNTIQMV-NTQ
SYR_TREPA       AKRVRRSPAQLAQQLCTLLEEDTSMCAYGTPQ-ARGPYLNVFLNKECVAAHTLDAI-FAQ
SYR_AERPE       ARSSNASADSIVESLRGKLWERG---ITWASPTLEAGYLNIVFDVEKLGDEV-FRL-LAS
SYR_ARCFU       AKERKKSPKEIADEIVENLEVESE--YIGSVE-SVNGYINFFASYEFLEDTV-NVI-LDE
SYR_METJA       AKELKKNPKIIAEELVDKLKAMNI-EGVKEIK-AVNGYINFYIDYNKFAKNLMEEI-DKK
SYR_METTH       AGKLRRAPIEITADIMSVIETPE---IFETIE-SKGPYINFFVDYGRFSSRLLESI----
SYR_PYRAB       ARVMKKPPFQIAELIVEELKKELP-EGIREVR-AINGYVNFFVDYGYLARQLIVEV-LEK
SYR_PYRHO       AKLLKRPPIEIAEKIVEKLKLNLP-EGIKDVK-AVNGYINVFIDYPHFARILINDI-LAK
SYR_MYCGE       KSENHK---KIADSIVEWFLKNKK-DNYQNVFIANNNFINFQISYQKYLEYLIKTPCF--
SYR_MYCPN       KGVNQK---ETAQQIAAWLLKHKK-AHYRRVFVANNNFINFEISPQKYLDFL------KT
SYR_RICPR       ASKESIAPREVALKFKEVLVTLP---YIASIEIAGPGFINFTIKAESWQAAI-KDI-LQH
SYR_BUCAI       ANISNLKPFELANRIILNIKKKY---MYKEITFSQPGFINFLINPYWISEQL-EKIF--L
SYR_ECOLI       AKKLGMAPRQLAEQVLTHLDLNG---IASKVEIAGPGFINIFLDPAFLAEHV-QQAL--A
SYR_SALTY       AKKLGMAPRQLAEQVLTHLDLSG---IASKVEIAGPGFINIFLEPAFLAEQV-QQAL--A
SYR_HAEIN       AKKLGLNPREFAQKVLDNLQLSD---IAEKLEIAGPGFINIFLNPTWLTTEI-SAAL--S
SYR_PASMU       AKKLGRNPREFAQQVIEQLDLSE---IAEKIEIAGPGFINLFLDKNWLAEQI-SLAV--N
SYR_CHLMU       ARALRKSPRAIAEEIVAHIPATP----FSSIEIAGAGFINFTFSKEFLANQL-QIFS--Q
SYR_CHLTR       ARVLHKSPRAIAESIVAHIPPTP----FSSIEIAGAGFINFTFSKEFLASQL-QTFSKEL
SYR_CHLPN       ARVLKKAPRAIAEAIVAELPQEP----FSLIEIAGAGFINFTFSPVFLNQQL-EHFK--D
SYR_SYNY3       AKQLGQPPRAIAMEIVDKVNLSE---ICEPLTIAGPGFINIKLLPDYLGEQL-IKLQ--Q
SYR_STRCO       AKKTKANPRELAAEVVARITTGD--ELIEDVEVSGPGFLNITVADRAITANL-AARL-AD
SYR_STRPN       AKVERKAPQMIAAELAEKMNS----QAFEKVVATGP-YVNFFLDKSAISAQV-LQAVTTE
                              .   .                  ::*.                   

SYR_AQUAE       GEAYFKE-DLGKGLKVQLEYVSANPTGPLHLGHGRGAVVGDTLARLFKFFNYDVTREYYI
SYR_THEMA       KDEYGRE-NVGNGMKVQFEYGSANPTGPFTVGHGRQIIIGDVLSEVYKELGYDVTREMYI
SYR1_BACHD      ESAYGET-NVGKGKKVQVEFVSANPTGNLHLGHARGAAVGDALCNILAKAGYDVSREYYI
SYR_BACSU       GEAYGET-NIGNGERVQVEFVSANPTGDLHLGHARGAAVGDSLCNVLSKAGYDVSREYYI
SYR_CORGL       GETFGNS-DHLSHLDVNLEFVSANPTGPIHLGGTRWAAVGDSLGRVLEASGAKVTREYYF
SYR_MYCLE       DKNFGHS-DDLAGYQINLEFVSANPTGPIHIGGTRWAAVGDALGRLLSTQGAAVVREYYF
SYR_MYCTU       GHSYGHS-LLLAGRKVNLEFVSANPTGPIHIGGTRWAAVGDALGRLLTTQGADVVREYYF
SYR_MYCS2       EGSYGSS-DQYAGRNVNLEFVSANPTGPIHIGGTRWAAVGDALGRLLATQGAAVTREYYF
SYR_HELPY       KEKFGSQVKSERSQKIFLEFVSANPTGPLHIGHARGAVFGDSLAKIARFLGHEVLCEYYV
SYR_HELPJ       KEQFGSQVKSERSQKIFLEFVSANPTGPLHIGHARGAVFGDSLAKIARFLGHEVLCEYYV
SYR_BORBU       KDTYGTS-KYLDNKKIILEFSSPNTNKPLHVGHLRNDVIGESLSRILKAVGAKITKINLI
SYR_TREPA       GERYGHT-QYLQGKRIMVEFSSPNTNKPLHVGHLRNNAIGESLSRIIAFCGADVFKVNII
SYR_AERPE       GWRPSTA-RTSRPETIVVEHTSANPIHPLHLGHARNSSLGDALARLLEARGHRVNRRFYV
SYR_ARCFU       DENYGHL-NL-KG-EILIEHTSANPDGPLHIGHIRNSIIGDTIARIFAKAGFDVKTHYYV
SYR_METJA       GNNYGRG-D-KKSIKIILEHTSANPNGPLHIGHLRNAIIGDCLKRILEFYGYDVETHYYV
SYR_METTH       QDDYGSH-P-PRDERVILEHTSANPNGPLHIGHIRNAIIGDSLARILRMAGYDVETQYYV
SYR_PYRAB       GDRFGSS-DIGRGKKVIVEHTSVNPTKPLHMGHARNAILGDSMARILRFLGYEVEVQNYI
SYR_PYRHO       GDRFGSS-EIGKGKKVIVEHTSVNPTKPLHMGHARNAILGDVMARILRFLGYEVEVQNYI
SYR_MYCGE       ---------TKKNIKILIESVSANPTGRIHLGHVRIAFFGDVLNNLAKLLGYTTVCEYWV
SYR_MYCPN       KPTF-----APKPTKVLIEWVSANPTGELHLGHVRNAFFGHVLNNLMVFLGFQTVREYWV
SYR_RICPR       EEKFFEI-DIDKNSNINIEYVSANPTGPMHIGHARGAVYGDVLARILQKVGYSVTKEYYV
SYR_BUCAI       SPRLGIN--HVNAQNIVIDYSSPNIAKEMHIGHLRSTIIGDVMARILDFLGHNVIRANHI
SYR_ECOLI       SDRLGVA--TPEKQTIVVDYSAPNVAKEMHVGHLRSTIIGDAAVRTLEFLGHKVIRANHV
SYR_SALTY       SDRLGVS--QPTRQTIVVDYSAPNVAKEMHVGHLRSTIIGDAAVRTLEFLGHHVIRANHV
SYR_HAEIN       HKNLGIQ--ATNKQTVVIDYSSPNVAKEMHVGHLRSTIIGDAVARTLEFLGHNVIRANHV
SYR_PASMU       DDKLGIQ--ATETQTVVADYSSPNVAKEMHVGHLRSTIIGDAVVRTLEFLGNKVIRANHV
SYR_CHLMU       ELAKGFP--VSSPQKVIIDFSSPNIAKDMHVGHLRSTIIGDCLARCFSFVGHDVLRLNHI
SYR_CHLTR       AN--GF--RAASPQKVIIDFSSPNIAKDMHVGHLRSTIIGDCLARCFSFVGHDVLRLNHI
SYR_CHLPN       ALKLGFQ--VSQPKKIIIDFSSPNIAKDMHVGHLRSTIIGDSLARIFSYVGHDVLRLNHI
SYR_SYNY3       NQQLGVS-LVKGEERIVVDFSSPNIAKEMHVGHLRSTIIGDCLARVLEFRGYDVLRLNHV
SYR_STRCO       GERLGVP-LKQDAGTTVVDYAQPNVAKEMHVGHLRSAVIGDALRSMLDFTGEKTIGRHHI
SYR_STRPN       KEHYADQ-NIGKQENVVIDMSSPNIAKPFSIGHLRSTVIGDSLSHIFQKIGYQTVKVNHL
                                  :    *    : :*  *    *.         .        .

SYR_AQUAE       NDAGRQVYLLGISIYYRYLEKCPERDEETFKEIK-EIFEKDGYRGEYVKEIAERLR----
SYR_THEMA       NDAGKQIRLLAQSLWARYNQL-----LGVEKEIP-----EGGYRGEYLVDIARDLV----
SYR1_BACHD      NDAGNQINNLALSLEARYFQA---------LGMEKDM-PEDGYHGEDIIQFGKDLA----
SYR_BACSU       NDAGNQINNLALSVEVRYFEA---------LGLEKPM-PEDGYRGEDIIAIGKRLA----
SYR_CORGL       NDHGRQIDRFALSLLAAAKG---------------EPTPEDGYGGEYIKEIAEAIV----
SYR_MYCLE       NDHGAQIDRFTNSLIAAAKG---------------ELTPADGYAGTYVTDIAAQVM----
SYR_MYCTU       NDHGAQIDRFANSLIAAAKG---------------EPTPQDGYAGSYITNIAEQVL----
SYR_MYCS2       NDHGAQIDRFVNSLIASAKG---------------EPTPEDGYAGDYIVDIAQQVI----
SYR_HELPY       NDMGSQIRLLGLSVWLAYREH---------VLKESVTYPEVFYKGEYIIEIAKKAN----
SYR_HELPJ       NDMGSQIRLLGVSVWLAYKEH---------VLKESVTYPEVFYKGEYIIEIAKKAH----
SYR_BORBU       NDRGVHICKSMLAYKKFGNG----------ITPEKAFKKGDHLIGDFYVKYNKYSQ----
SYR_TREPA       NDRGVHICKSMCAYQKFAHG----------KTPAHTGIKSDRFVGDWYVQFNRYA-----
SYR_AERPE       DDVGRQAVVASLGFKLSGV--------TPRELASRMGVKVDHAVGWVYAVTHNALETVTA
SYR_ARCFU       NDMGRQTAITVLGIEKFGL----------------KDKKPDHAVAEAYIEANKLLE----
SYR_METJA       NDMGRQMALVVYGIELFGLD---------------KEKKKDHAIAETYVKINKYL-----
SYR_METTH       NDMGRQIAMIVWGLLNLDGD-----------LEDYPGDKMDHRVGKLYFEVNQRLK----
SYR_PYRAB       DDLGIQFAQVYWGYLKLREKF--EKIMKELKEKGIKEDPIDHVLGLLYVEVNRVLE----
SYR_PYRHO       DDLGIQFAQVYWGYLRLKEEF--ERIMNELRERGLKDNPIDHALGLLYVEVNRRLE----
SYR_MYCGE       NDYGQQARVFSFSVYQSLQ----------LKKNIAIQQHPDGYSGIVIDKIASEIE----
SYR_MYCPN       NDYGQQARVFGFSVYQALH----------LQQNIKVTPHPDGYEGELVDSIAKTIT----
SYR_RICPR       NDAGSQINDLVSTVLLRYKE----------ALGEPITIPVGLYPGEYLIPLGEILS----
SYR_BUCAI       GDWGTQFGMLIAYLEVKKL-----------VNSPLSLMKLE----EYYCKAKKKYD----
SYR_ECOLI       GDWGTQFGMLIAWLEKQQQE----------NAGEMELADLEG----FYRDAKKHYD----
SYR_SALTY       GDWGTQFGMLIAWLEKQQQE----------NAGDMALADLEG----FYRDAKKHYD----
SYR_HAEIN       GDWGTQFGMLIAYLEKMQNEH------------ASEMELQD--LEAFYREAKKHYD----
SYR_PASMU       GDWGTQFGMLIAYLEKVENE------------SASEMELSD--LEAFYRAAKEHYD----
SYR_CHLMU       GDWGTAFGMLITYLQETAQ---------------TDIHQLENLT-ELYKKAHVRFA----
SYR_CHLTR       GDWGTAFGMLITYLQETSQE--------------AIHQLED--LTALYKKAHARFA----
SYR_CHLPN       GDWGTAFGMLITYLQENPCDY---------------SDLED--LTSLYKKAYVCFT----
SYR_SYNY3       GDWGTQFGMLITYLKEVYPEA---------LVTADALDIGD--LVTFYKQAKQRFD----
SYR_STRCO       GDWGTQFGMLIQYLFEHPGEL--------APAGDIDGEQAMSNLNRVYKASRAVFD----
SYR_STRPN       GDWGKQFGMLIVAYKKWGDE------------EAVKAHPIDELL-KLYVRINAEAE----
                .* *                                                        

SYR_AQUAE       -------------------KLVGESLCKP---------EEANLKEVREKILKEESIELYY
SYR_THEMA       -------------------NEIGDRYKD--------------------------------
SYR1_BACHD      -------------------ETHGDKFVHE-------------------------------
SYR_BACSU       -------------------EEYGDRFVNE-------------------------------
SYR_CORGL       -------------------EKHPEALA---------------------------------
SYR_MYCLE       -------------------QQAPYALS---------------------------------
SYR_MYCTU       -------------------QKAPDALSL--------------------------------
SYR_MYCS2       -------------------AKAPDVLGL--------------------------------
SYR_HELPY       -------------------NDLEPSLLKE-------------------------------
SYR_HELPJ       -------------------NDLEPSLFKE-------------------------------
SYR_BORBU       -------------------EN-----------------ENAE-KEIQDLLLLWEQK----
SYR_TREPA       -------------------QQYPE---------------EAE-HDVRDLLQRWESA----
SYR_AERPE       RKRGDTSKVDEALSTLARLKERGDREVFDRILEAVGSLDDPE-GLVSEMMRKYERG----
SYR_ARCFU       -------------------SNP-----------------ELE-EQVEKLMLAYEEG----
SYR_METJA       -------------------EEH----------------PEEE-EKILELMRKYEDA----
SYR_METTH       -------------------ENP-----------------GIR-DEVDELIRKYEAG----
SYR_PYRAB       -------------------ENP-----------------EIE-AEIRDIMKKLESG----
SYR_PYRHO       -------------------DNP-----------------ELE-NEIRDIMKKLESG----
SYR_MYCGE       -------------------NFPVDNL----------------------------NFEE--
SYR_MYCPN       -------------------GIPLDKL----------------------------SFEE--
SYR_RICPR       -------------------KEYGNKLLTM-------------------------------
SYR_BUCAI       -------------------IDQ-----------------LFA-EKSREYVVKLQNG----
SYR_ECOLI       -------------------EDE-----------------EFA-ERARNYVVKLQSG----
SYR_SALTY       -------------------EDE-----------------AFA-ERARNYVVKLQSG----
SYR_HAEIN       -------------------EDE-----------------VFA-EKARNYVVKLQSG----
SYR_PASMU       -------------------SDP-----------------VFA-EKARNYVVKLQSG----
SYR_CHLMU       -------------------EDP-----------------EFK-KRSQYNVVALQSG----
SYR_CHLTR       -------------------EDS-----------------EFK-KRSQHNVVALQSG----
SYR_CHLPN       -------------------ND-----------------EEFK-KRSQQNVVALQAK----
SYR_SYNY3       -------------------QDE-----------------QFR-ETSRQAVVALQAG----
SYR_STRCO       -------------------TDE-----------------EFK-ERARRRVVALQSG----
SYR_STRPN       -------------------NDP-----------------SLD-EEAREWFRKLENG----
                                                                            

SYR_AQUAE       TKKYEPKDVVDLLS--NYGLDLMMKEIREDLSLMDISFDVWFSERSLYDSGEVERLINLL
SYR_THEMA       ---LWNEEVEEFFK--QTALNRILSSMKDTLEKIGSSFDVYFSEKSLIEDGTVEEVLKLL
SYR1_BACHD      ------SSEERLAFFREYGLKRELEKIKSDLEEFRVPFDNWYSETSLYTTGKVEKTLNVL
SYR_BACSU       ----EESERLAFFR--EYGLKYELEKLRKDLENFRVPFDVWYSETSLYQNGKIDKALEAL
SYR_CORGL       ---LEPAATQELFR--AEGVEMMFEHIKSSLHEFGTDFDVYYHENSLFESGAVDKAVQVL
SYR_MYCLE       ---LPESEMHETVR--EIGVDLMFTHIKKSLHEFGTDFDVYTHEDSMHASGRVDEAIARL
SYR_MYCTU       ----PDAELRETFRA--IGVDLMFDHIKQSLHEFGTDFDVYTHEDSMHTGGRVENAIARL
SYR_MYCS2       ----PEDQQRETFRA--IGVDLMFTHIKQSLHDFGTDFDVYTHEDSMHTSGRVDQAITQL
SYR_HELPY       ----NEETIIEVLS--GYARDLMLLEIKDNLDALGIHFDSYASEKEVFKHK--DAVFEQL
SYR_HELPJ       ----NEETIIEVLS--DYAKDLMLLEIKGNLDALDIHFDSYASEKEVFKHK--DAVFDRL
SYR_BORBU       -------DV-STIELWKKLNKWAIEGIKETYEITNTSFDKIYLESEIFKIGK-NVVLEGL
SYR_TREPA       -------DP-HVRALWRTMNEWALRGIKQTYERTGISFDKLYFESETYTKGR-EEVRRGL
SYR_AERPE       --------EEPEKSLIRGVVSAVLEGFRETLGRFGVDFDDWDWESDLLWSGLVNKIIEEA
SYR_ARCFU       -------DE-KTVEKFRRAVETALEGIKQTLKTINVEHDEFVWESEFVRNGYVGKVLGIL
SYR_METJA       ---LENNEDNEITKKFEFAVNYALDGIKETLKNLNIKHDTFVWESSYVRNGMVKKVIEKL
SYR_METTH       -------ENE---ELFRKVVEYCLSGMEETMKRLHVHHDRFVWEGQFVRDGTVDRVIESL
SYR_PYRAB       -------EL-NGRELAESVVRAQMV----TTYRLGIKYDLLVWESDIVSRKLFEIAVKLL
SYR_PYRHO       --------ELYGRKLAEEVVRAQMV----TTYKLGVKYDLLVWESDIVRRKLFEIALELL
SYR_MYCGE       -----FCKTSFLDHFLVNCTQKVLSLIKSDLNKIHVFIDSWKFESEIVKKTNFNDLLEQL
SYR_MYCPN       -----FLQQPFLDQLLADCTAKVLEVIKQDLATIHIHFDSWKFESQVVKETDYKKLLTQF
SYR_RICPR       ----NDVERFKIIK--SFAVEKMLDLNRKDLADLGIKHDVFFSEQSLYDKGEIEKTVKLL
SYR_BUCAI       -------DQ-YCYSIWKKLVSITMLENCKIYKRLHVTLKKKHTMGESIYNKMLPNIIEDL
SYR_ECOLI       -------DE-YFREMWRKLVDITMTQNQITYDRLNVTLTRDDVMGESLYNPMLPGIVADL
SYR_SALTY       -------DT-YFREMWRKLVDITMTQNQITYDRLNVTLTRDDVMGESLYNPMLPGIVADL
SYR_HAEIN       -------DE-YCRTMWKRLVDITMQQNQHNYARLNVTLTEKDVMGESLYNPMLPSIVKDL
SYR_PASMU       -------DE-YCRTMWKKLVDITMQQNQHNYDRLNVTLTEKDVMGESLYNPMLSDIVADL
SYR_CHLMU       -------DP-QALALWKQICAVSEKSFQKIYSILDVEL---HTRGESFYNPFLADVVSDL
SYR_CHLTR       -------DA-QALALWKQICSVSEKSFQTIYSILDVEL---HTRGESFYNPFLAEVVADL
SYR_CHLPN       -------DP-QAIAIWEKICETSEKAFQKIYDILDIVVEK---RGESFYNPFLPEIIEDL
SYR_SYNY3       -------DA-KSIKAWQLLCEQSRREFQLIYDCLDITIEE---RGESFYNPFLPGVVELL
SYR_STRCO       -------DK-ETLDLWQQFVDESKVYFYSVFEKLDMEIRDEEIVGESAYNDGMPETARLL
SYR_STRPN       -------DE-EALALWQWFRDESLVEFNRLYNELKVEFDSY--NGEAFYNDKMDAVVDIL
                                                                            

SYR_AQUAE       KEKGYVYEK-----DGALW----------LKTSL----FGDD------KD--RVVKRSDG
SYR_THEMA       KNKDVVYEK-----DGAVW----------LKVSA----FIDE------ED--KVLVRSDG
SYR1_BACHD      KEKGKTYEQ-----DGALW----------FRSTE----YGDD------KD--RVLVKNDG
SYR_BACSU       REKGHVYEE-----DGATW----------FRSTT----FGDD------KD--RVLIKKDG
SYR_CORGL       KDNGNLYEN-----EGAWW----------LRSTE----FGDD------KD--RVVIKSDG
SYR_MYCLE       RDTGNVYEK-----DGALW----------LRTSA----FGDD------KD--RVVIKSDG
SYR_MYCTU       RETGNIYEK-----DGATW----------LRTSA----FGDD------KD--RVVIKSDG
SYR_MYCS2       REAGSIYEK-----DGAVW----------LRTTD----FGDD------KD--RVVIKSDG
SYR_HELPY       EKANALYEK-----DSKIW----------LKSSL----YQDE------SD--RVLIKEDK
SYR_HELPJ       EKANALYEK-----DSKTW----------LKSSL----YQDE------SD--RVLIKEDK
SYR_BORBU       EKGFCYKRE-----DGAIC----------IDLPS----DSDEKADTKVKQ--KVLIRSNG
SYR_TREPA       ACGVFYQME-----DNSIW----------VDLSS----LGLD---------KKALLRSDG
SYR_AERPE       RRSPFLTTH----KD-AIALDIPRIVREVLARDPEAASTIKLPRSLEIPP--LILVRSDG
SYR_ARCFU       EERGLV------KKNGAWT----------IELE------GFD------KE--VVLRRENG
SYR_METJA       METGKVI------KEETYM----------LDLSD----FGIE------KK--MVLARANG
SYR_METTH       RKTGYTG------ENDVLY----------LDLEE----FGLE------KE--LVLTRSDG
SYR_PYRAB       ERNENFYTPNEGKYKGAFV----------MDLSKL---FPDM------KNPYLVLRRSDG
SYR_PYRHO       SKNENFYIPSDGKYRGAFV----------MDLRKL---FPDM------KNPILVLRRSDG
SYR_MYCGE       KPNSYFY------QDNALW----------LKTTL----YGDD------KD--RVLIRSDK
SYR_MYCPN       KDEAH-YEK-----DGAIW----------LKTTL----YGDD------KD--RVLVRQDN
SYR_RICPR       ERMGLIYEGTLPAPKGKVHEDWEYRVQKLFKSTN----YGDS------QD--RPIEKADG
SYR_BUCAI       KNKKIAIEK-----NGSTI----------VFLKEFKNRLGEP------MG--VVIQKKDK
SYR_ECOLI       KAKGLAVES-----EGATV----------VFLDEFKNKEGEP------MG--VIIQKKDG
SYR_SALTY       KAKGLAVES-----EGATV----------VFLDEFKNKEGDP------MG--VIIQKKDG
SYR_HAEIN       KKQGLAVEN-----DGALV----------VYLDEFKNKDGDP------MG--VIVQKKDG
SYR_PASMU       KQQGLAVED-----EGAFV----------VYLDEFKNKEGEP------MG--VIVQKKDG
SYR_CHLMU       ESKNLVTLS-----DGAKC----------VFHEEFS------------IP--LMIQKSDG
SYR_CHLTR       ESKNLVTLS-----DGAKC----------VFHEAFS------------IP--LMIQKSDG
SYR_CHLPN       EKKGLLTVS-----NDAKC----------VFHEAFS------------IP--FMVQKSDG
SYR_SYNY3       QEKDLLVED-----NGAQC----------VFLDGFTNKDGDR------LP--LIVQKSDG
SYR_STRCO       EEMGVAVRS-----EGALV----------VFFDEIRGKDDQP------VP--LIVQKADG
SYR_STRPN       SEKGLLLES-----EGAQV----------VNLEKY----GIE------HP--ALIKKSDG
                                             .                        : : : 

SYR_AQUAE       TYTYFASDIAYHYNKFKR-----------------------------GFEKVINVWGADH
SYR_THEMA       TYTYFMTDIAYHYKKYKR-----------------------------GFRKVYDIWGSDH
SYR1_BACHD      SYTYLTPDISYHEDKFLR-----------------------------GFEKLINIWGADH
SYR_BACSU       TYTYLLPDIAYHKDKLDR-----------------------------GFDKLINVWGADH
SYR_CORGL       DAAYIAGDIAYVADKFSR-----------------------------GHNLNIYMLGADH
SYR_MYCLE       KPAYIAGDLAYYLDKRQR-----------------------------GFDLCIYMLGADH
SYR_MYCTU       KPAYIAGDLAYYLDKRQR-----------------------------GFDLCIYMLGADH
SYR_MYCS2       NAAYIAGDLAYYLDKRKR-----------------------------GFDLCIYMLGADH
SYR_HELPY       SYTYLAGDIVYHDEKFKQ-----------------------------DYTKYINIWGADH
SYR_HELPJ       SYTYLAGDIVYHDEKFQQ-----------------------------NYTKYINIWGADH
SYR_BORBU       TSIYLTQDLGNIAVRTKEF----------------------------NFEEMIYVVGSEQ
SYR_TREPA       TTMYITQDIGTAIFRAQDW----------------------------PFDQLLYVVGNEQ
SYR_AERPE       TTLYTTRDLAYSVYKFRVT----------------------------GADRVINVIGADQ
SYR_ARCFU       TTLYITRDLAYHMWKNE------------------------------NYERFINVLGADH
SYR_METJA       TSLYSTRDIAYHLDKLSK------------------------------CDIGIDVLGADH
SYR_METTH       TSLYSTRDIAYHLQKSEE------------------------------GDVIIDVLGSDH
SYR_PYRAB       TATYTGKDIAYHLWKFGKIDVDLLYKPWDEHTWTTAPDGESVKGKFGGADIVINVIGAEQ
SYR_PYRHO       TATYTGKDIAYHLWKFGKIDVDLLYKEWDSTTWTTAPDGKSMPNKFGNANIVINVIGAEQ
SYR_MYCGE       RASYFGTDVAYHLEKLQR-----------------------------GFDILFNVWGTDH
SYR_MYCPN       RPSYFGTDVAYHLDKAAR-----------------------------GFDLLYDIWGSDH
SYR_RICPR       SWSYFASDLAYAKDKIDR-----------------------------GANHLIYVLGADH
SYR_BUCAI       GFLYSTTDIACLKYRYQVL----------------------------HADRIIYYTDSRQ
SYR_ECOLI       GYLYTTTDIACAKYRYETL----------------------------HADRVLYYIDSRQ
SYR_SALTY       GYLYTTTDIACAKYRYETL----------------------------HADRVLYYIDSRQ
SYR_HAEIN       GFLYTTTDIAAAKYRYETL----------------------------KANRALVFSDTRQ
SYR_PASMU       GFLYTTTDIAAAKYRYETL----------------------------KADRALVFSDTRQ
SYR_CHLMU       GYNYATTDVAAMRYRIQQD----------------------------HADRILIVTDSGQ
SYR_CHLTR       GYNYATTDVAAMRYRIQQD----------------------------QADRILIVTDSGQ
SYR_CHLPN       GYNYATTDLAAMRYRIEED----------------------------HADKIIIVTDLGQ
SYR_SYNY3       GYNYATTDLAALNYRLNTD----------------------------GAEKIIYVTDAGQ
SYR_STRCO       GFGYAASDLTAIRNRVQDL----------------------------HATTLLYVVDVRQ
SYR_STRPN       ATLYITRDLAAALYRKNEY----------------------------QFAKSIYVVGQEQ
                   *   *:     :                                         .  :

SYR_AQUAE       HGYIPRVKAALKMLE-IPEDWLEI--LLVQMVKLFREGKEVKMSKRAGTFV--TLRELLD
SYR_THEMA       HGHIPRMKAAMKALD-IPDDFFNV--ILHQFVTLKRGGEIVRMSTRAGEFV--TLDELLD
SYR1_BACHD      HGYIPRMKAAIQALG-YEKDQLDV--QIIQMVSLFQNGEKVKMSKRTGKAV--TLRDLME
SYR_BACSU       HGYIPRMKAAIEALG-YEKGTLEV--EIIQLVHLYKNGEKMKMSKRTGKAV--TMRDLIE
SYR_CORGL       HGYIARLKAAAAALG-YKPEGVEV--LIGQMVNLLRDGKAVRMSKRAGTVV--TLDDLVE
SYR_MYCLE       HGYIARLKAAAAAFG-DDPAIVEV--LIGQMVNLVCDGQLVRMSKRSGNVI--TLDDLVE
SYR_MYCTU       HGYIARLKAAAAAFG-DDPATVEV--LIGQMVNLVRDGQPVRMSKRAGTVL--TLDDLVE
SYR_MYCS2       HGYIARLKAAAAALG-DDPDTVEV--LIGQMVNLVRDGQPVRMSKRAGTVI--TLDDLVE
SYR_HELPY       HGYIARVKASLEFLG-YDSNKLEV--LLAQMVRLLKDNEPYKMSKRAGNFI--LIKDVVD
SYR_HELPJ       HGYIARVKASLEFLG-YDSSKLEV--LLAQMVRLLKDNEPYKMSKRAGNFI--LIKDVID
SYR_BORBU       IQHFKSLFFVAEKLG-LSKNK-KLIHLSHGMVNLVDG----KMKSREGNVI--DADNLIS
SYR_TREPA       NYHFKVLFFVLRLLG-YPWAQ-QLHHVSYGMVNLPHG----RMKSREGTVV--DADDILD
SYR_AERPE       RLPQLQIRLALLGLG-YRREALNMMHYDYEIVSLP----GRRMSSRRGEYV--TLDELLE
SYR_ARCFU       KLYGAQLSKILELLG-LKPPEI----IFFEFVSLPEG----SMSTRRGKFI--SADELIS
SYR_METJA       KLTAEMVKAALKLLG-SKVPEV----IFYEFISLPEG----SMSTRRGRFI--STDELLE
SYR_METTH       KLAAEQVGIAVELLG-GKRPEV----IFYEFITLPEG----SMSTRRGVFI--SVDELMD
SYR_PYRAB       RHPQMAIKHALKLLG-FEDAAENLHHLAYEHVERPEG----KFSGRKGTWVGFTVDEVIN
SYR_PYRHO       KHPQLAIKYALQLLG-FEDAAANLYHLAYEHVERPEG----KFSGRKGTWVGFTVDEVIQ
SYR_MYCGE       EGHIKRMYCAFDALKNTTKTSLKI--FALQLVTLYKNKELVRLSKRAGNVI--TIETMLS
SYR_MYCPN       EGHIKRMHCVYEGLKIHQKCQLKI--TALQLVMLYKNKEIVRLSKRAGNVI--TIKQMLQ
SYR_RICPR       SGYVKRIEAIVKALG-QEKVKVDV--KICQLVNFVENGVPIKMSKRLGSFA--SVQDVNK
SYR_BUCAI       HQHLLQAWTIAKKAL-YISQNLLLEHHIFGMML---SKDKRPFKTRDGDTI--KLSALLD
SYR_ECOLI       HQHLMQAWAIVRKAG-YVPESVPLEHHMFGMMLG---KDGKPFKTRAGGTV--KLADLLD
SYR_SALTY       HQHLMQAWTIVRKAG-YVPDSVPLEHHMFGMMLG---KDGKPFKTRAGGTV--KLADLLD
SYR_HAEIN       SQHMQQAWLITRKAG-YVPDSFSLEHKNFGMMLG---KDGKPFKTRTGGTV--KLADLLD
SYR_PASMU       SQHMQQAWLITRKAG-YVPDSFQLEHKNFGMMLG---KDGKPFKTRTGGTV--KLADLLD
SYR_CHLMU       SLHFQLLEATCLAAG-YLPHKGIFSHVGFGLVLD---TQGRKFKTRSGENI--KLQELLD
SYR_CHLTR       SLHFQLLEATCLAAG-YLPSKGIFSHVGFGLVLD---TQGRKFKTRSGENI--KLRELLD
SYR_CHLPN       SLHFQLLEATAIAAG-YLQPGI-FSHVGFGLVLD---PQGKKLKTRSGENV--KLRELLD
SYR_SYNY3       ANHFAQFFQVAEKAG-ILTDPTQVVHVPFGLVKG---EDGKKLKTRAGDTI--RLKDLLT
SYR_STRCO       SLHFRMVFETARRAG-WLGDEVTAHNMGYGTVLG---ADGKPFKTRAGETV--RLEDLLD
SYR_STRPN       SAHFKQLKAVLQEMG-YDWSD-DITHVPFGLVT----KEGKKLSTRKGNVI--LLEPTVA
                                               :          :. * *            

SYR_AQUAE       -------------------------------EVGKDAVRFIFLTKRSDTPLDFDVEKAKE
SYR_THEMA       -------------------------------EVGRDATRYFFAMVDPNTHMVFDIDLAKA
SYR1_BACHD      -------------------------------EVGIDATRYFFAMRSADSHLDFDMDLAVS
SYR_BACSU       -------------------------------EVGLDAVRYFFAMRSADTHMDFDLDLAVS
SYR_CORGL       -------------------------------AIGIDAARYSLIRSSVDSSLDIDLGLWES
SYR_MYCLE       -------------------------------AIGVDAARYSLIRSSVDTPIDIDLALWSS
SYR_MYCTU       -------------------------------AIGVDAARYSLIRSSVDTAIDIDLALWSS
SYR_MYCS2       -------------------------------AIGVDAARYALIRSSVDTPIDIDLELWSS
SYR_HELPY       -------------------------------DVGKDALRFIFLSKRLDTHLEFDVNTLKK
SYR_HELPJ       -------------------------------DVGKDALRFIFLSKRLDTHLEFDVNTLKK
SYR_BORBU       NLIELIIPEMTQKIE------NKESAKKNALNIALGAIHYYLLKSAIHKDIVFNKKESLS
SYR_TREPA       RLHSAAEEEIAKKGR----ENALKHAQCIAENVAIAALHYFLLQVSPQKDMVFHPEESLS
SYR_AERPE       MAKARSVREVESRNP----GADRDWIESTAEKIAVGAVRFALVRPGRLKPITLDVERILD
SYR_ARCFU       KVRDEAWKILSER------DMEEDEKRKIADAVAVGAIRFDFIKIAPEKHMTFDWSKALD
SYR_METJA       EAIKRAKEECNKRG----------VEENIAYDIGLGAVRYNIARISPEKPMVFRWEEALD
SYR_METTH       EAHSRALHEVKKRR-----DLPDDVADDIAESIGNGAIRYYIARLSPEKHIVFRWDDALS
SYR_PYRAB       EAIKRARELIEEKSP----GLSDEEKEEIAEKVGVGAIRYNMVKYSPDKKIIFRWEDVLN
SYR_PYRHO       EAVKRARELIEEKNP----ALSDEEKAEVAEKVGIGAIRYNLIKYSPDKKIIFRWEDVLN
SYR_MYCGE       -------------------------------MISEDAARWFMLSQNNGTIIKIDLDIANL
SYR_MYCPN       -------------------------------MLSEDAARWFMLSQTNNSIIKIDLDTANL
SYR_RICPR       -------------------------------EVGKDIIRFMMLTRQNDKPLDFDLVKVKE
SYR_BUCAI       EATERAMRLIKNKQP----NLSKKKLNQLSNIIGVGAVKYADLSKNRNTNYIFDWNEMLS
SYR_ECOLI       EALERARRLVAEKNP----DMPADELEKLANAVGIGAVKYADLSKNRTTDYIFDWDNMLA
SYR_SALTY       EALERARRLVAEKNP----DMPADELEKLANAVGIGAVKYADLSKNRTTDYIFDWDNMLA
SYR_HAEIN       EAIERATVLINEKNT----NLSNDEKEAVIEAVGIGAVKYADLSKNRTTDYVFDWDNMLS
SYR_PASMU       EAVERATQLIQEKST----ALSAQEKAAVIEAVAIGSVKYADLSKNRTTDYVFDWDNMLS
SYR_CHLMU       TAIEKAKESLREHRP----EISEEELAYQGPILGINAIKYADLSAHRINDYVFSFEKMLR
SYR_CHLTR       TAVEKAKESLKAHRP----DISEEELAYQGPILGINAIKYADLSSHRINDYVFSFEKMLR
SYR_CHLPN       TAIEKAEEALREHRP----ELTDEAIQERAPVIGINAIKYSDLSSHRTSDYVFSFEKMLR
SYR_SYNY3       EAVTRARQDLETRLTAEERSETEEFKTEVAQRVGIGAVKYADLSQNRTSDYVFSFDKMLA
SYR_STRCO       EAVQRAAEVVREKAR----DLTEDEIQERAAQVGIGAVKYADLSTSPNRDYKFDLDQMVS
SYR_STRPN       EAVSRAKVQIEAKNP----EL--ENKDQVAHAVGIGAIKFYDLKTDRTNGYDFDLEAMVS
                                                :.    ::            :       

SYR_AQUAE       KSSENPVYYVQYAHARISGIFREFKERYKKDV-SVEELINYVQHLEEEAEIKLIKKVLFF
SYR_THEMA       KSMDNPVYYVQYAHARIHNLFSNAEKKGVKF----EEG-KHLELLGNEEERVLMRNLGMF
SYR1_BACHD      KSNENPVYYVQYAHARVCSMLRKGKELGLSF----DES-TDLSPIASEKEYDLLKKIGEF
SYR_BACSU       TSNENPVYYAQYAHARICSMLRQGEEQGLK-----PAADLDFSHIQSEKEYDLLKTIGGF
SYR_CORGL       QSSDNPVYYVQYGHARLCSIARKAETLGVT-----EE-GADLSLLTHDREGDLIRTLGEF
SYR_MYCLE       SSNENPVYYVQYAHARLSALARNAAEFGLI-----PD-TGHLELLSHDKEGALLRTVGEF
SYR_MYCTU       ASNENPVYYVQYAHARLSALARNAAELALI-----PD-TNHLELLNHDKEGTLLRTLGEF
SYR_MYCS2       ASNENPVYYVQYAHARLCALARNAADLGVS-----VN-TDHLDLLTHEKEGALIRNLGEF
SYR_HELPY       QDSSNPIYYIHYANSRIHTMLEKSPFSKEE-----VL-QTPLTNL-NAEEKYLLFSALSL
SYR_HELPJ       QDSSNPIYYIHYANSRIHTMLEKSPFSKEE-----IL-QTPLKNL-NAEEKYLLFSALSL
SYR_BORBU       FT-GNSGPYIQYVGARINSILEKYKALSIPVM-----EKIDFELLKHEKEWEIIKIISEL
SYR_TREPA       FN-GNTGPYLQYMGARISSLLKKVQEDVEQKGP--REVRCDPALLTHEAEWELVKALARF
SYR_AERPE       LK-ENTAPYLQYTYARASSILEKHGEIDY--------LKAHPASLEEGSRRELFVEALRF
SYR_ARCFU       FER-QTASYIQYSHARACSILRKAVEDGMPEL-------EFKGELCTAGERKLVMLLSKM
SYR_METJA       FEK-VGCPFIQYAHARCCSILKEAENKGVKDE------AVFNYEL-TSEEKELIKMLDEF
SYR_METTH       FER-GCAS-IQYAHARACKLLEKASFTGEED--------IEDGWKPEGDERELVRLLARF
SYR_PYRAB       FEG-ESAPYIQYAHARCSSILRKAGNPEWEAL-----LKEANFKELTERERELIILLSKF
SYR_PYRHO       FEG-ESAPYIQYAHARCSSILRKAEEEGIKVDPE-TLFKNADFTKLSERERELVIMLSKF
SYR_MYCGE       QNSANPVYYVQYAFARMNSILRIANSDQLKEI-------TDCSLLINEKEISLLNQLVYY
SYR_MYCPN       QNSSNPVYYVQYAYARMCSVLKVVDQAALAQV-------NDCSLLTHEKEIALLDQLVYF
SYR_RICPR       QSRENPIFYVQYAHVRTKSILSKARELMPEAYNSFKEGKYNLSLLSSEEEIEIIKLLAAW
SYR_BUCAI       FEG-NTAPYIQYAYTRIVSILKKSNMPIKKL--------KEKIFLTKESEINLAIKILEF
SYR_ECOLI       FEG-NTAPYMQYAYTRVLSVFRKAEIDEEQLA-------AAPVIIREDREAQLAARLLQF
SYR_SALTY       FEG-NTAPYMQYAYTRVLSVFRKANIDEQALA-------SAPVIISEDREAQLAARLLQF
SYR_HAEIN       FEG-NTAPYMQYAYTRIRSIFNKTDINSTALL-------AAPLTIKDDKERTLAIKLLQF
SYR_PASMU       FEG-NTAPYMQYAYTRIRSIFNRSELNEQDLS-------ESPVVLSNEKERLLAIKLLQF
SYR_CHLMU       FEG-NTAMSLLYAYVRIQGIKRRMKLDTLPQ--------KGPLSIHEPAEETLALTLLRF
SYR_CHLTR       FEG-NTAMSLLYAYVRIQGIKRRMGLESPPQ--------EGPLAVHEPAEEALALTLLRF
SYR_CHLPN       FEG-NTAMFLLYAYVRIQGIKRRLGISQLSL--------EGPPEIQEPAEELLALTLLRF
SYR_SYNY3       LQG-NTAPYMLYAYARIQSISREGGIDFAQMD-------SGEIVLTEPTELVLAKNLLQF
SYR_STRCO       LNG-DTSVYLQYAYARIQSILRKAGEVRPA---------AHPELALHEAERALGLHLDAF
SYR_STRPN       FEG-ETGPYVQYAYARIQSILRKADFKPET---------AGNYSLNDTESWEIIKLIQDF
                           *   *   :                                :       

SYR_AQUAE       KDELVDITLKREPHLLTYYLIDLAGDFHHYYNHHRILGM------E-ENVMFSRLALVKG
SYR_THEMA       NTALKEVAQMFAPNRLTNYLQSLAESFHAFYTKHVIVDP------ENPELSNARLNLALA
SYR1_BACHD      PEVVAEAAQKQMPHRITNYVHELASTLHSFYNAEQVINP------ENDEQSKARLALMKA
SYR_BACSU       PEAVAEAAEKRIPHRVTNYIYDLASALHSFYNAEKVIDP------ENEEKSRARLALMKA
SYR_CORGL       PAVVKAAADLREPHRIARYAEELAGTFHRFYDSCHILPKV---DEDTAPIHTARLALAAA
SYR_MYCLE       PQVLKTAAALREPHRVCRYLEDLAGDYHRFYDSCRVLPQG---DEKPTDLHTARLALCQA
SYR_MYCTU       PRVLETAASLREPHRVCRYLEDLAGDYHRFYDSCRVLPQG---DEQPTDLHTARLALCQA
SYR_MYCS2       PRVLKTAASLREPHRVCRYLEDLAGDYHRFYDSCRVLPQG---DEEPGDLHSARLALCRA
SYR_HELPY       PKAIESSFEEYGLQKMCEYAKTLASEFHRFYNAGKILDT---------PKAKELLKICLI
SYR_HELPJ       PKAVESSFEEYGLQKMCEYAKTLASEFHRFYNAGKILDT---------PKAKELLKICLM
SYR_BORBU       EENIINAAKDLNPSILTSYSYSLAKHFSTYYQEVKVIDT------NNINLTAARIEFLKA
SYR_TREPA       PACVTRAAQGHDPSVITGYLYTLSKSFSRFYHDCPILCE------ARPDYACARLELVRA
SYR_AERPE       PLVSAKAADDLAPEDLASYLLRLADMFNSWYQKDSVIHE------EWEGARHAKAALVLL
SYR_ARCFU       PYVVKRIVSELRPNVFAEYLLSVAGTFNDFYRDHPVL-------KAESEVRMHRLAIVDA
SYR_METJA       KDIIKESAESRRVHILANYLLELAKAFNRFYANCPILMT-----KVDDDVKKSRLKLVKS
SYR_METTH       PVVVEESALARRVHPVAQYAQDLANTFNSFYRSTPVI---------GSDFEGARLRLVDS
SYR_PYRAB       PEVVEQAGRDVKPHLIAWYANELASLFNKFYMDHPVI-------KAEKGIREARLLLVMA
SYR_PYRHO       PRIVEQAGKDVKPHLIAWFANELASLFNKFYMDHPVL-------KAEEGVREARLLLVMA
SYR_MYCGE       PFMLQKAMETGELHLLTNFLYETASLFHSWYKVCKIND------DKNSLLSAQRLALLRS
SYR_MYCPN       KSLLEKVQVSHELHLLTNYLYETATLFHSWYKACKIND------PAQYNLTQQRLLLLQS
SYR_RICPR       TKTLEASVKYFEPHRIAFYLINLASKFHSMWNFGKENSDYRFIIENNKELTLARLALASV
SYR_BUCAI       EEIILLISQKGTPHILCKYLYHLATSFSHFYENCSILFP------KKIKTCKSRLKLSIL
SYR_ECOLI       EETLTVVAREGTPHVMCAYLYDLAGLFSGFYEHCPILSA------ENEEVRNSRLKLAQL
SYR_SALTY       EETLTVVAREGTPHVMCAYLYDVAGLFSGFYEHCPILSA------ENDAVRNSRLKLAQL
SYR_HAEIN       EEAVQTVGKEGTPHVLCAYLYELAGIFSSFYEHCPILNA------EDESIKLSRLKLALL
SYR_PASMU       EEAIQIVAKEGTPHVLCTYLYELAGVFSSFYEHCPILNN------EDEQIKRSRLKLALL
SYR_CHLMU       PEVLDLTLRELCPHFLTDYLYVLTNKFNAFFRDCHI---------EGSDYQQERLYLCGL
SYR_CHLTR       PEILDLTLRELCPHFLTDYLYALTNKFNAFFRDCHIEG---------SDSQQERLYLCGL
SYR_CHLPN       PEALESTIKELCPHFLTDYLYNLTHKFNGFFRDSHIQ---------DSPYAKSRLFLCAL
SYR_SYNY3       ADVIETVEISLLPNRLCDYLYELSKVFNRFYENCPVLKA------S-DPQRGSRLLLCDL
SYR_STRCO       GPTVFEAAAEYAPHKLAAYLYQLASLYTTFYDKCPVLKA------ETPEQVENRLFLCDL
SYR_STRPN       PRIINRAADNFEPSIIAKFAISLAQSFNKYYAHTRILDE------S--PERDSRLALSYA
                               .  :    :      :                         :   

SYR_AQUAE       IKEVVRLGLNLMGVSAPERM----
SYR_THEMA       TGIVLRKGLKLIGVSAPERM----
SYR1_BACHD      TQVTLKNALSLVGVEAPERM----
SYR_BACSU       TQITLNNALQLIGVSAPEKM----
SYR_CORGL       TRQTLANALHLVGVSAPEKM----
SYR_MYCLE       NRQVIANGLAILGVSAPERM----
SYR_MYCTU       TRQVIANGLAIIGVTAPERM----
SYR_MYCS2       TRQVIANGLAILGVSAPERM----
SYR_HELPY       VSLSLSNAFKLLGIEIKTKISARD
SYR_HELPJ       VSLSLTNAFKLLGIEIKTKISSKD
SYR_BORBU       ILQTIKNCMYLLNIPYMLKM----
SYR_TREPA       VRIVLRTAMRLVLIPFLEEM----
SYR_AERPE       VKSVIGEGLRLLGVEPLEKM----
SYR_ARCFU       TRVVLRNGLELLGIEPLERM----
SYR_METJA       TKTVLETGLELLGINCPGRM----
SYR_METTH       VRKTLRNALNLLGIHAPETM----
SYR_PYRAB       VRQVLRNSLWLLGIEAPDRM----
SYR_PYRHO       VEQVLKNALYLMGIEAPERM----
SYR_MYCGE       LQFIVKQILDVLKISTPQQM----
SYR_MYCPN       LHHVFGQLLQILNITAPQQM----
SYR_RICPR       IQKIIASGLEVIGVEPMVTM----
SYR_BUCAI       TAKTLKKGLNMLGIRVVKKM----
SYR_ECOLI       TAKTLKLGLDTLGIETVERM----
SYR_SALTY       TAKTLKLGLDTLGIETVERM----
SYR_HAEIN       TEKTLKQGLTLLGIKTVEKM----
SYR_PASMU       TEKTLKQGLDLLGIKTVDKM----
SYR_CHLMU       TEKTLETGMHLLGLKTLDHL----
SYR_CHLTR       TERTLSTGMHLLGLKTLNHL----
SYR_CHLPN       AEQVLATGMHLLGLKTLERL----
SYR_SYNY3       TARTLKLGLSLLGIPVLDRM----
SYR_STRCO       TARTLHRGMALLGIRTPERL----
SYR_STRPN       TAVVLKEALRLLGVEAPEKM----
                    .   :  : :     :