CLUSTAL format seed alignment for MF_00124

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

KITH_BACAH      ----------MYLINQNGWIEVICGSMFSGKSEELIRRVRRTQFAKQHAIVFKPCIDNRY
KITH_BACHK      ----------MYLINQNGWIEVICGSMFSGKSEELIRRVRRTQFAKQHAIVFKPCIDNRY
KITH_BACC7      ----------MYLINQNGWIEVICGSMFSGKSEELIRRVRRTQFAKQHAIVFKPCIDNRY
KITH_BACCQ      ----------MYLINQNGWIEVICGSMFSGKSEELIRRVRRTQFAKQHAIVFKPCIDNRY
KITH_BACC1      ----------MYLINQNGWIEVICGSMFSGKSEELIRRVRRTQFAKQHAIVFKPCIDNRY
KITH_BACC3      ----------MYLINQNGWIEVICGSMFSGKSEELIRRVRRTQFAKQHAIVFKPCIDNRY
KITH_BACC2      ----------MYLINQNGWIEVICGSMFSGKSEELIRRVRRTQFAKQHAIVFKPCIDNRY
KITH_BACCR      ----------MYLINQNGWIEVICGSMFSGKSEELIRRVRRTQFAKQHAIVFKPCIDNRY
KITH_BACC4      ----------MYLINQNGWIEVICGSMFSGKSEELIRRVRRTQFAKQHAIVFKPCIDNRY
KITH_BACCZ      ----------MYLINQNGWIEVICGSMFSGKSEELIRRVRRTQFAKQHAIVFKPCIDNRY
KITH_BACC0      ----------MYLINQNGWIEVICGSMFSGKSEELIRRVRRTQFAKQHAIVFKPCIDNRY
KITH_BACAN      ----------MYLINQNGWIEVICGSMFSGKSEELIRRVRRTQFAKQHAIVFKPCIDNRY
KITH_BACAA      ----------MYLINQNGWIEVICGSMFSGKSEELIRRVRRTQFAKQHAIVFKPCIDNRY
KITH_BACAC      ----------MYLINQNGWIEVICGSMFSGKSEELIRRVRRTQFAKQHAIVFKPCIDNRY
KITH_BACWK      ----------MYLMNQNGWIEVICGSMFSGKSEELIRRIRRTQFAKQHAIVFKPCIDNRY
KITH_BACCN      ----------MYLINQNGWIEVICGSMFSGKSEELIRRVRRTQFAKQNAIVFKPCIDNRY
KITH_BACVZ      ----------MYIMKQSGWLELICGSMFSGKSEELIRRVKRATYAKQEVKVFKPAIDNRY
KITH_BACSU      ----------MYIMKQSGWLELICGSMFSGKSEELIRRVKRATYAKQEVRVFKPVIDNRY
KITH_BACLD      ----------MYIMKQSGWLELICGSMFSGKSEELIRRIKRATFAKQEVKVFKPAIDNRY
KITH_BACP2      ----------MYVMKQSGWLEVICGSMFSGKSEELIRRAKRATFAKQEVKIFKPAIDNRY
KITH_GEOKA      ----------MYVMTQSGWLELICGCMFSGKSEELIRRVRRAQFAKQEVKVFKPTIDNRY
KITH_GEOTN      ----------MYVMTQSGWLEVICGSMFSGKSEELIRRIRRAQFAKQEVKVFKPTIDNRY
KITH_GEOSW      ----------MYIMKQSGWLEVICGSMFSGKSEELIRRVRRATFAKQEVKVFKPTIDNRY
KITH_ANOFW      ----------MYVMKQSGWLEVICGSMFSGKSEELIRRVRRAQFAKQEVKVFKPAIDNRY
KITH_STAAB      ----------MYETYHSGWIECITGSMFSGKSEELIRRLRRGIYAKQKVVVFKPAIDDRY
KITH_STAAW      ----------MYETYHSGWIECITGSMFSGKSEELIRRLRRGIYAKQKVVVFKPAIDDRY
KITH_STAAC      ----------MYETYHSGWIECITGSMFSGKSEELIRRLRRGIYAKQKVVVFKPAIDDRY
KITH_STAAR      ----------MYETYHSGWIECITGSMFSGKSEELIRRLRRGIYAKQKVVVFKPAIDDRY
KITH_STAAS      ----------MYETYHSGWIECITGSMFSGKSEELIRRLRRGIYAKQKVVVFKPAIDDRY
KITH_STAA3      ----------MYETYHSGWIECITGSMFSGKSEELIRRLRRGIYAKQKVVVFKPAIDDRY
KITH_STAAM      ----------MYETYHSGWIECITGSMFSGKSEELIRRLRRGIYAKQKVVVFKPAIDDRY
KITH_STAAN      ----------MYETYHSGWIECITGSMFSGKSEELIRRLRRGIYAKQKVVVFKPAIDDRY
KITH_STAES      ----------MYETYHSGWIETITGSMFSGKSEELIRRLRRGIYAKQKVVVFKPAIDDRY
KITH_STAEQ      ----------MYETYHSGWIETITGSMFSGKSEELIRRLRRGIYAKQKVVVFKPAIDDRY
KITH_STAHJ      ----------MYETYHSGWIECITGSMFSGKSEELIRRLRRGIYAKQKVVVFKPAIDDRY
KITH_STAS1      ----------MYETYHSGWIECITGSMFSGKSEELIRRLRRGLYAKQKVVVFKPAIDDRY
KITH_MACCJ      ----------MYEHYHSGWIECVTGSMFSGKSEELIRRVRRGLFAKQKVIVFKPSIDDRY
KITH_BACHD      ----------MQMIHKEGWIEVICGSMFSGKSEELIRRVRRATYGRLKVQVFKPAIDNRY
KITH_OCEIH      ----------MYVMKQNGWVELICGSMFSGKSEELIRRVRRATYAHINVRVYKPAIDDRY
KITH_CLOB6      ----------MYGPKDHGWIEVVAGPMYSGKTEELIRRIRRAEIAKQKVQVFKPEIDNRY
KITH_CLOBJ      ----------MYGPKDHGWIEVVAGPMYSGKTEELIRRIRRAEIAKQKVQVFKPEIDNRY
KITH_CLOB1      ----------MYGPKDHGWIEVVAGPMYSGKTEELIRRIRRAEIAKQKVQVFKPEIDNRY
KITH_CLOBK      ----------MYGPKDHGWIEVVAGPMYSGKTEELIRRIRRAEIAKQKVQVFKPEIDNRY
KITH_CLOBH      ----------MYGPKDHGWIEVVAGPMYSGKTEELIRRIRRAEIAKQKVQVFKPEIDNRY
KITH_CLOBL      ----------MYGPKDHGWIEVVAGPMYSGKTEELIRRIRRAEIAKQKVQVFKPEIDNRY
KITH_CLOBM      ----------MYGPKDHGWIEVVAGPMYSGKTEELIRRIRRAEIAKQKVQVFKPEIDNRY
KITH_CLOAB      ----------MYRPKDHGWVEVIVGPMYSGKSEELIRRIRRAKIAKQKIQVFKPEIDNRY
KITH_CLOTE      ----------MYGPKNHGWIEVITGPMYSGKSEELIRRVRRVKIAKQKVQVFKPEIDNRY
KITH_THEP3      ---------MIYGSLDHGFIEVIVGPMFSGKSEELIRRIKRAQIAKQKVQVFKPAIDDRY
KITH_THEPX      ---------MIYGSLDHGFIEVIVGPMFSGKSEELIRRIKRAQIAKQKVQVFKPAIDDRY
KITH_CALS4      ---------MIYGSLDHGFIEVIVGPMFSGKSEELIRRIRRAQIAKQKVQVFKPAIDDRY
KITH_DICT6      ---------MEILNGPSGWIEVICGGMYSGKSEELIRRVRRAQIAKQKVQVFKHSLDIRY
KITH_DICTD      ---------MEIVSGASGWIEVICGGMYSGKSEELIRRVRRAQIAKQKVQVFKHSLDIRY
KITH_BACFR      --MVLFSEDHIQETRRRGRIEVICGSMFSGKTEELIRRMKRAKFARQRVEIFKPAIDTRY
KITH_BACFN      --MVLFSEDHIQETRRRGRIEVICGSMFSGKTEELIRRMKRAKFARQRVEIFKPAIDTRY
KITH_BACTN      --MVLFSEDHIQETRRRGRIEVICGSMFSGKTEELIRRMKRAKFARQRVEIFKPAIDTRY
KITH_BACV8      --MVVFSEDHIQETRRRGRIEVICGSMFSGKTEELIRRLKRAKFARQRVEIFKPAIDTRY
KITH_PORGI      --MDYEIENNHADSIRRGSIEVICGSMFSGKTEELLRRLRRAKIARQTVEIFKPTIDIRY
KITH_PORG3      --MDYEIENNHADSIRRGSIEVICGSMFSGKTEELLRRLRRAKIARQTVEIFKPTIDIRY
KITH_RHOSI      ---MPMEPLILRHGGSVGWIEVICGSMFSGKTEELIRRLRRAQIARQRVEVFKPRMDRRY
KITH_SALRD      ----------MDRDRTTGWMEVICGSMFSGKTEELIRRLRRARIARQHTRVFKPALDERY
KITH_BDEBA      -------MSEFSYVHTRGWVEVVVGSMFSGKTEELIRRLRRAEFARLQIQVFKPIIDKRY
KITH_CHLSY      ----------MTRPSDGGRIEVICGCMYSGKTEELIRRMRQVRIARQSYRIFTPRMDTRY
KITH_CHLAA      ----------MTRPSDGGRIEVICGCMYSGKTEELIRRMRQVRIARQSYRIFTPRMDTRY
KITH_CHLAD      ----------MTRPSEGGRIEVICGCMYSGKTEELIRRMRQVRIARQSYRIFTPRMDTRY
KITH_ROSCS      ----------MTRLSSGGRIEVICGCMFSGKTEELIRRLNHVRLARQRLIAFTPRRDTRY
KITH_ROSS1      ----------MTRLL-GGRIEVICGCMFSGKTEELIRRLNHVRLARQRLIAFTPRRDTRY
KITH_HALSA      ----------MHAITNSGWVEVITGSMFSGKTEELLRRLRRAEIAGQDVAAVTPAVDDRY
KITH_HALS3      ----------MHAITNSGWVEVITGSMFSGKTEELLRRLRRAEIAGQDVAAVTPAVDDRY
KITH_HALWD      ----------MRAITNSGWIEVVTGSMFSGKTEELLRRLRRAEIAGQSIAVFKPAVDDRY
KITH_COPPD      ----------MEIITQDGWLEVITGCMFSGKTEELVRRLRRAVIAKKETIAIKPALDTRY
KITH_DEIDV      ---------MLKSPYSGGHLEVIVGPMFSGKSEELIRRVTRALIARQRVQVFKPAVDDRY
KITH_DEIRA      ---------MLRSPYSGGHLEVVVGPMFSGKSEELIRRLTRSLIARQRVAVFKPAIDNRY
KITH_MYCCT      MTELDINEIEAYNSNKMGWIELITGCMFAGKTEEFIRRLKVLSYAKKRVLAFKPSIDNRY
KITH_MYCMS      MTELDINEIEAYNSNKMGWIELITGCMFAGKTEEFIRRLRVLSYAKKRVLAFKPSIDNRY
KITH_MESFL      ----MIPNRDTIEQKQLGWVELITGCMFAGKTEEFIKRLRRHAFAKRNVIAFKPVIDTRY
KITH_PYRAE      ------------------MLVVIVGPMFAGKTTELIRRVERYVIAGRRAIVFKPSLDVRY
KITH_THEKO      ----------MKPMHPGGFLEVITGPMFAGKTTELIKRVERQIFAKRKAALFKPAIDNRY
KITH_AYWBP      ---------MTQKEQGQGFIEVICGPMFAGKTESLIQRRNKALKLKKKILSFKPRIDDRY
KITH_ONYPE      ---------MTQKEQGQGFIEVVCGPMFAGKTEALIQRSNQALQLNKKILSFKPQIDDRY
KITH_UREPA      -----MAKVNAFSK-KIGWIELITGPMFAGKTAELIRRLHRLEYADVKYLVFKPKIDTRS
KITH_UREP2      -----MAKVNAFSK-KIGWIELITGPMFAGKTAELIRRLHRLEYADVKYLVFKPKIDTRS
KITH_UREU1      -----MAKAHAFSK-KVGWIELITGPMFAGKTAELIRRLHRLEYADVKYLVFKPRIDTRS
KITH_MYCPE      ------MKNNAFGK-EKGWIELIYGPMFAGKSEELLRKLKRLDYADVIYQVFKPKIDTRT
KITH_MYCGA      -----MAKKNAMTT-TNGWIEAICGPMFAGKTDELIRKIKRYEYADVKSLVFSPATDTRS
KITH_MYCGE      -----MGKYQPSFQTKKGWTEVICGPMFSGKTEKLLHKIKRWKIAKISVVIFKPIIDTRQ
KITH_MYCPN      -----MSFSQVFHQSPRGWIEVICGPMFSGKTEELLRKIKRWKLAKIPVIIFKPKIDTRQ
KITH_MYCH2      ----------MYKKFFDGVIEVITGPMFSGKSDELIKRIKILTYADIKTLVIKPSVDYRF
KITH_MYCH7      ----------MYKKFFDGVIEVITGPMFSGKSDELIKRIKILTYADIKTLVIKPSVDYRF
KITH_MYCHJ      ----------MYKKFFDGVIEVITGPMFSGKSDELIKRIKILTYADIKTLVIKPSVDYRF
KITH_MYCMO      ----------MYRKYSDGIIEVITGPMYSGKSEELIKRIKILQFANIKTLIVKQKFDTRF
KITH_MYCA5      ----------MYKNFNEGMIEVITGPMFSGKSEELLKRIRTLEYAKLKPLVIKPEFDTRF
KITH_THEMA      ---------------MSGKLTVITGPMYSGKTTELLSFVEIYKLGKKKVAVFKPKIDSRY
KITH_THESQ      ---------------MSGKLTVITGPMYSGKTTELLSFVEIYKLGKKKVAVFKPKIDSRY
KITH_THEP1      ---------------MSGKLTIITGPMYSGKTTELLSFVEIYKLGKKKVAVFKPKIDSRY
KITH_PSELT      ---------------MAGKLTLIVGPMYSGKTTELLSYVEIYRLGRKKTIVFKPSLDNRY
KITH_RHIEC      ----------------MAKLYFNYSTMNAGKSTMLLQASYNYQERGMRTVQLIAAFDERA
KITH_RHIME      ----------------MSKLYFSYATMNAGKSTLLLQAAYNYQERGMRVVMLIAAFDDRA
KITH_AGRFC      ----------------MAKLYFNYSTMNAGKSTMLLQASYNYQERGMRTLIFTAAFDDRA
KITH_RHILO      ----------------MAKLYFNYATMNAGKTTMLLQASYNYRERGMTTMLFVAGHYRKG
KITH_JANSC      ----------------MAKLYFNYSTMNAGKSTLLLQASYNYIERGMQTYLLTANFDDRA
KITH_RUEPO      ----------------MAKLYFNYSTMNAGKSTVLLQASHNYRERGMQTYLMTAAIDGRA
KITH_IDILO      ----------------MASLYFTYSAMNAGKSTSLLQVAHNYEERQQHVLLMTPALDDRA
KITH_NOVAD      ----------------MAKLYFYYASMNAGKSTNLLQADFNYRERGMATMLWTAALDDRG
KITH_ZYMMO      ----------------MAKLYFYYASMNAGKSTNLLQADFNYRERGMQTLLFTAGIDTRY
KITH_XANAC      ----------------MAKLYFYYSAMNAGKTTTLLQSAHNYRERGMRTLILTPKLDHRA
KITH_XANC5      ----------------MAKLYFYYSAMNAGKTTTLLQSAHNYRERGMRTLILTPKLDHRA
KITH_XANOR      ----------------MAKLYFYYSAMNAGKTTTLLQSAHNYRERGMRTLILTPKLDHRA
KITH_XANOM      ----------------MAKLYFYYSAMNAGKTTTLLQSAHNYRERGMRTLILTPKLDHRA
KITH_XANCP      ----------------MAKLYFYYSAMNAGKTTTLLQSAHNYRERGMRTSILTPKLDHRA
KITH_XANC8      ----------------MAKLYFYYSAMNAGKTTTLLQSAHNYRERGMRTSILTPKLDHRA
KITH_BLOFL      ----------------MSKLYFYYSAMNAGKTTALLQSSYNYQERGMRTLLYTAAVVCQK
KITH_BLOPB      ----------------MAQLYFYYSAMNAGKTTALLQSSYNYQERGMRTVLYTADMNSRD
KITH_YERPE      ----------------MAQLYFYYSAMNAGKSTALLQSSYNYQERGMRTLVFTAEIDNRF
KITH_YERPS      ----------------MAQLYFYYSAMNAGKSTALLQSSYNYQERGMRTLVFTAEIDNRF
KITH_PECAS      ----------------MAQLYFYYSAMNAGKSTALLQSSYNYQERGMRTLVFTAEIDNRH
KITH_ECO57      ----------------MAQLYFYYSAMNAGKSTALLQSSYNYQERGMRTVVYTAEIDDRF
KITH_SHIFL      ----------------MAQLYFYYSAMNAGKSTALLQSSYNYQERGMRTVVYTAEIDDRF
KITH_SHISS      ----------------MAQLYFYYSAMNAGKSTALLQSSYNYQERGMRTVVYTAEIDDRF
KITH_SHIBS      ----------------MAQLYFYYSAMNAGKSTALLQSSYNYQERGMRTVVYTAEIDDRF
KITH_ECOLI      ----------------MAQLYFYYSAMNAGKSTALLQSSYNYQERGMRTVVYTAEIDDRF
KITH_ECOL6      ----------------MAQLYFYYSAMNAGKSTALLQSSYNYQERGMRTVVYTAEIDDRF
KITH_SHIDS      ----------------MAQLYFYYSAMNAGKSTALLQSSYNYQERGMRTVVYTAEIDDRF
KITH_SALPA      ----------------MAQLYFYYSAMNAGKSTALLQSSYNYQERGMRTVVYTAEIDDRF
KITH_SALTI      ----------------MAQLYFYYSAMNAGKSTALLQSSYNYQERGMRTVVYTAEIDDRF
KITH_SALTY      ----------------MAQLYFYYSAMNAGKSTALLQSSYNYQERGMRTVVYTAEIDDRF
KITH_SALCH      ----------------MAQLYFYYSAMNAGKSTALLQSSYNYQERGMRTVVYTAEIDDRF
KITH_PHOLL      ----------------MAQLYFYYSAMNAGKSTSLLQSSYNYNERGMRTLVFTAEIDTRF
KITH_SHEON      ----------------MAQLYFYYSAMNAGKSTSLLQSSYNYRERGMNTLVMTASIDDRY
KITH_VIBVU      ----------------MAQMYFYYSAMNAGKSTTLLQSSFNYQERGMTPVIFTAALDDRY
KITH_VIBVY      ----------------MAQMYFYYSAMNAGKSTTLLQSSFNYQERGMTPVIFTAALDDRY
KITH_VIBPA      ----------------MAQMYFYYSAMNAGKSTTLLQSSFNYQERGMTPVIFTAALDDRY
KITH_VIBCH      ----------------MAQMYFYYSAMNAGKSTTLLQSAFNYQERGMNPLIFTAAIDDRF
KITH_ALIF1      ----------------MAQMYFYYSAMNAGKSTTLLQSSFNYQERGMNPAIFTAAIDDRY
KITH_PHOPR      ----------------MAQMYFYYSAMNAGKSTTLLQSSFNYRERGMRPVIFTAAIDDRF
KITH_PSEHT      ----------------MAQLYFYYSAMNAGKSTTLLQSAFNYQERGMEPVILTAAIDDRA
KITH_HAEIN      ----------------MAKLYFYYSTMNAGKSTTLLQSSYNYRERDMNTLVYTAAIDDRF
KITH_HAEI8      ----------------MAKLYFYYSTMNAGKSTTLLQSSYNYRERDMSTLVYTAAIDDRF
KITH_PASMU      ----------------MAKLYFYYSTMNAGKSTTLLQSSYNYQERDMNTLVYTAAIDDRF
KITH_MANSM      ----------------MAKLYFYYSTMNAGKSTTLLQSAYNYNERNMNTLVYTAAIDDRF
KITH_HAEDU      ----------------MAKLYFYYSAMNAGKSTTLLQSSYNYQERGMNTLVYTAAIDDRY
KITH_RHOBA      ----------------MAKLYFYYSTMNAGKSTVLLQSSYNYRERGMNTLILSPEIDTRF
KITH_COLP3      ----------------MAQLYFYYSSMNAGKSTHLLQSSYNYQERGLVTAIYTAKIDDRF
KITH_LEGPA      ----------------MAKLYFYYAAMNAGKSTVLLQSSYNYRERGMQTLLFTPAIDTRF
KITH_LEGPH      ----------------MAKLYFYYAAMNAGKSTVLLQSSYNYRERGMQTLLFTPAIDTRF
KITH_LEGPL      ----------------MAKLYFYYAAMNAGKSTVLLQSSYNYRERGMQTLLFTPAIDTRY
KITH_COXBU      ----------------MAKLHFYYSAMNAGKSTTLLQSSYNYNERGMDTLVFLPVVDDRE
KITH_CHRVO      ----------------MAKLFFRYAAMNSGKSTQLLQIANNYESMDKKVALYTSAIDDRY
KITH_RHOFT      ----------------MSQLTFIFAAMNAGKSTLLLQAAHNYVERGMAVELYTAALDTRA
KITH_FRATH      ----------------MAKLYFRYSAMDAGKTLDLLKVAYNYEDRGRKPLVLTSAIDKRA
KITH_FRATT      ----------------MAKLYFRYSAMDAGKTLDLLKVAYNYEDRGRKPLVLTSAIDKRA
KITH_LISMO      ----------------MAQLFFRYGSMNSGKTIEILKVAHNYEEQNKTVAIFTSGIDDRD
KITH_LISMF      ----------------MAQLFFRYGSMNSGKTIEILKVAHNYEEQNKTVAIFTSGIDDRD
KITH_LISIN      ----------------MAQLFFRYGSMNSGKTIEILKVAHNYEEQNKTVAIFTSGIDDRD
KITH_BACSK      ----------------MAQLFFKYGAMNSGKSIEILKVANNYEEQKKPVLIFTSGMDTRD
KITH_LACPL      ----------------MAQLFFRYGAMNSGKTIEILKVAHNYEEQDKSVIILTSGLDNRD
KITH_LACSS      ----------------MAQLFFRYGAMNSGKSIEILKVAHNYEEQNKSVIILTSGIDNRD
KITH_ENTFA      ----------------MAQLFFKYGAMNSGKTIEILKVAHNYEEQDKPVVLMTSGLDTRD
KITH_STRA1      ----------------MAQLYYKYGTMNSGKTIEILKVAHNYEEQGKPVVIMTSALDTRD
KITH_STRA3      ----------------MAQLYYKYGTMNSGKTIEILKVAHNYEEQGKPVVIMTSALDTRD
KITH_STRA5      ----------------MAQLYYKYGTMNSGKTIEILKVAHNYEEQGKPVVIMTSALDTRD
KITH_STRP8      ----------------MAQLYYKYGTMNSGKTIEILKVAHNYEEQGKPVVIMTSALDTRD
KITH_STRPM      ----------------MAQLYYKYGTMNSGKTIEILKVAHNYEEQGKPVVIMTSALDTRD
KITH_STRP6      ----------------MAQLYYKYGTMNSGKTIEILKVAHNYEEQGKPVVIMTSALDTRD
KITH_STRP3      ----------------MAQLYYKYGTMNSGKTIEILKVAHNYEEQGKPVVIMTSALDTRD
KITH_STRP1      ----------------MAQLYYKYGTMNSGKTIEILKVAHNYEEQGKPVVIMTSALDTRD
KITH_STRMU      -------------MTVLAQLYYKYGTMNSGKTIEILKVAHNYEEQGKPVVIMTSSLDTRD
KITH_STRPN      ----------------MAQLYYRYGTMNSGKTIEILKVAYNYEEQGKGVVIMTSALDTRD
KITH_STRR6      ----------------MAQLYYRYGTMNSGKTIEILKVAYNYEEQGKGVVIMTSALDTRD
KITH_STRGC      ----------------MAQLYYKYGTMNSGKTIEILKVAHNYEEQGKGVVIMTSAVDTRD
KITH_LACLA      ----------------MAQLYFKYGTMNSGKSIEILKVAHNYEEQGKPVLLMTSSLDTRA
KITH_STRT2      ----------------MAQLYFRYGTMNSGKSIEILKVAYNYEEQGKPVVLLTSRLDDRD
KITH_STRT1      ----------------MAQLYFRYGTMNSGKSIEILKVAYNYEEQGKPVVLLTSRLDDRD
KITH_LACAC      ----------------MAQLFFRYGAMSSGKTIEILKVAHNYEAQGRKIALMTSGLDNRS
KITH_LACJO      ----------------MAQLFFRYGAMSSGKSIEILKVAHNYEAQGRKIALMTSNVDDRS
KITH_STRAW      ----------------MPELVFFSGTMDCGKSTLALQIGHNRSARGLQGVIFTR--DDRA
KITH_STRCO      ----------------MPELVFFSGTMDCGKSTLALQIEHNRSARGLAGMIFTR--DDRA
KITH_CUTAK      ----------------MAELVFHTGPMDSGKSTLALQMDHAQSAHDRQGVRYAM--HDRS
                                        . * .**:   :                      : 

KITH_BACAH      S-EEDVVSHNGLKVKAVPVS-------ASKDIFEHITE----------------------
KITH_BACHK      S-EEDVVSHNGLKVKAVPVS-------ASKDIFEHITE----------------------
KITH_BACC7      S-EEDVVSHNGLKVKAVPVS-------ASKDIFEHITE----------------------
KITH_BACCQ      S-EEDVVSHNGLKVKAVPVS-------ASKDIFEHITE----------------------
KITH_BACC1      S-EEDVVSHNGLKVKAVPVS-------ASKDIFEHITE----------------------
KITH_BACC3      S-EEDVVSHNGLKVKAVPVS-------ASKDIFEHITE----------------------
KITH_BACC2      S-EEDVVSHNGLKVKAVPVS-------ASKDIFEHITE----------------------
KITH_BACCR      S-EEDVVSHNGLKVKAVPVS-------ASKDIFEHITE----------------------
KITH_BACC4      S-EEDVVSHNGLKVKAVPVS-------ASKDIFEHITE----------------------
KITH_BACCZ      S-EEDVVSHNGLKVKAVPVS-------ASKDIFKHITE----------------------
KITH_BACC0      S-EEDVVSHNGLKVKAVPVS-------ASKDIFEHITE----------------------
KITH_BACAN      S-EEDVVSHNGLKVKAVPVS-------ASKDIFKHITE----------------------
KITH_BACAA      S-EEDVVSHNGLKVKAVPVS-------ASKDIFKHITE----------------------
KITH_BACAC      S-EEDVVSHNGLKVKAVPVS-------ASKDIFKHITE----------------------
KITH_BACWK      S-EEDVVSHNGLKVKAVPVS-------ASKDIFNHVTE----------------------
KITH_BACCN      S-EEDVVSHNGMKVKAVPVS-------ASKDIFKYVTE----------------------
KITH_BACVZ      S-EEAVVSHNGTSMTSHVIS-------SSAEIWDHISE----------------------
KITH_BACSU      S-EAAVVSHNGTSMTSYAIS-------SAADIWDHISE----------------------
KITH_BACLD      S-SESVVSHNGTSIVCHAIA-------SPEEIFQYISK----------------------
KITH_BACP2      S-TSSVVSHNGSSVDGIAVA-------SPKDIITHISE----------------------
KITH_GEOKA      S-EDAVVSHNGNSVIAIPVA-------TPAEMFRYISA----------------------
KITH_GEOTN      S-EDAVVSHNGNSVIAIPVA-------TPAELFRYISA----------------------
KITH_GEOSW      S-DEAVVSHNGNSLIAIPVS-------SPKEIFEHISE----------------------
KITH_ANOFW      S-EEAVVSHNGTSVIAIPVS-------CASDIRKHITT----------------------
KITH_STAAB      H-KEKVVSHNGNAIEAINIS-------KASEIMTHDLT----------------------
KITH_STAAW      H-KEKVVSHNGNAIEAINIS-------KASEIMTHDLT----------------------
KITH_STAAC      H-KEKVVSHNGNAIEAINIS-------KASEIMTHDLT----------------------
KITH_STAAR      H-KEKVVSHNGNAIEAINIS-------KASEIMTHDLT----------------------
KITH_STAAS      H-KEKVVSHNGNAIEAINIS-------KASEIMTHDLT----------------------
KITH_STAA3      H-KEKVVSHNGNAIEAINIS-------KASEIMTHDLT----------------------
KITH_STAAM      H-KEKVVSHNGNAIEAINIS-------KASEIMTHNLT----------------------
KITH_STAAN      H-KEKVVSHNGNAIEAINIS-------KASEIMTHNLT----------------------
KITH_STAES      H-KEKVVSHNGNEIEAINIS-------TAQEILNHKLE----------------------
KITH_STAEQ      H-KEKVVSHNGNEIEAINIS-------TAQEILNHKLE----------------------
KITH_STAHJ      H-KEKVVSHDGNELEAINIS-------TSRDILLQDLS----------------------
KITH_STAS1      H-KDKIVSHNGNAIEAINIS-------TAAEILKHDLS----------------------
KITH_MACCJ      S-ELEVVSHNGNKVEAVNVH-------HSSEILEHVKE----------------------
KITH_BACHD      S-EQEVVSHNGNKVCAIPVE-------RAMSILEQWSE----------------------
KITH_OCEIH      D-DKAIVSHDGTSTMARPIH-------DAVEILEDVDN----------------------
KITH_CLOB6      S-KQDVVSHAGDKIQSVPVK-------SSKEILEKLLD----------------------
KITH_CLOBJ      S-KQDVVSHAGDKIQSVPVK-------SSKEILEKLLD----------------------
KITH_CLOB1      S-KQDVVSHAGDKIQSVPVK-------SSKEILEKLLD----------------------
KITH_CLOBK      S-KQDVVSHAGDKIQSVPVK-------SSKEILEKLLD----------------------
KITH_CLOBH      S-KQDVVSHAGDKIQSVPVK-------SSKEILEKLLD----------------------
KITH_CLOBL      S-KQDVVSHAGDKIQSVPVK-------SSKEILEKLLD----------------------
KITH_CLOBM      S-KQDVVSHAGDKIQSVPVR-------SSKEILEKLLD----------------------
KITH_CLOAB      S-KEDVVSHMGEKEQAVAIK-------NSREILKYFEE----------------------
KITH_CLOTE      S-NEDVVSHCGDKEGAVPIK-------SSEDILKLIKE----------------------
KITH_THEP3      S-IDKVVSHNGTNINAISVV-------KAFEIIELLEE----------------------
KITH_THEPX      S-IDKVVSHNGTNINAISVV-------KAFEIIELLEE----------------------
KITH_CALS4      S-IDKVVSHNGSSINAISVT-------KASEILDLLEE----------------------
KITH_DICT6      D-KDYVASHTGLKIEAIPVS-------SSADIERLVED----------------------
KITH_DICTD      D-KDYVASHTGLKIEAIPVS-------SSADIERLVKD----------------------
KITH_BACFR      S-EGDVVSHDSNSISSTPID-------SSASIL-LFTS----------------------
KITH_BACFN      S-EGDVVSHDSNSISSTPID-------SSASIL-LFTS----------------------
KITH_BACTN      S-EEDVVSHDSHSIASTPID-------SSASIL-LFTS----------------------
KITH_BACV8      S-EEEVVSHDSNSIASTPID-------SSASIL-LFSS----------------------
KITH_PORGI      D-ETDVVSHDKNAIASTPVD-------NSANIL-LLSS----------------------
KITH_PORG3      D-ETDVVSHDKNAIASAPVD-------NSANIL-LLSS----------------------
KITH_RHOSI      S-ETDVVSHDENALRSTPVD-------SAEQIL-LLAD----------------------
KITH_SALRD      S-EDEVVSHNENSVTTTPVE-------APPQIQ-ELVQ----------------------
KITH_BDEBA      N-EMAVTSHDLTTIDSTPIH-------DAEEIWNLLKP----------------------
KITH_CHLSY      A-EGQVASHSGSRLEAITVA-------TMKDILAHAE-----------------------
KITH_CHLAA      A-EGQVASHSGSRLEAITVA-------TMKDILAHAE-----------------------
KITH_CHLAD      A-EGHVASHSGSRLEAITVA-------TMCEILAYAR-----------------------
KITH_ROSCS      R-LGSLVSHNGLSVEARVID-------SIRDTPAHLNT----------------------
KITH_ROSS1      R-LGSLVSHNGLSVEARVID-------SIRDIPAYLDS----------------------
KITH_HALSA      G-EATLGSHAGRSWAATVVEPTAEGVASIPTLLNGEQ-----------------------
KITH_HALS3      G-EATLGSHAGRSWAATVVEPTAEGVASIPTLLNGEQ-----------------------
KITH_HALWD      G-ETTVGSHVGRQWEAAVVPNEGEDIWNIKHELSKKKQNHRTTTQCRSGDGTNNPGGVIP
KITH_COPPD      D-LVAVVSHSGFSFNAIPVE-------DPKSILGMAK-----------------------
KITH_DEIDV      H-ESAVASHAGRTVGALAVG----DVADIRAHLSGEAP-------------------LLQ
KITH_DEIRA      H-ASEVASHAGRTLEAVAVP----DAQAIRAQLSGQGE-------------------LLS
KITH_MYCCT      S-VENIISHSGSKLDSYLVK-------SSDEIKQIVEKE---------------------
KITH_MYCMS      S-VENIISHSGSKLDSYLVH-------SSDEIKQIIEKE---------------------
KITH_MESFL      A-VNEVASHAGTLLPSIPVN-------STAELKEKLEAK---------------------
KITH_PYRAE      D-ASKVAAHNGLKFDAFVIP-------PDKDGVEIIRK----------------------
KITH_THEKO      S-EREVVAHNGLRYEAFVVP-------TTEKGVERIKEI---------------------
KITH_AYWBP      SVKEEIVSHNRNNIPAILID-------KSKDILTFITP----------------------
KITH_ONYPE      SVKEEIVSHNQNTIPAILID-------KSKDILPFITP----------------------
KITH_UREPA      I-RNIQS-RTGTSLPSVEVE-------SAPEILNYIMSNSFND-----------------
KITH_UREP2      I-RNIQS-RTGTSLPSVEVE-------SAPEILNYIMSNSFND-----------------
KITH_UREU1      T-QNIKS-RTGTSLPSIEVE-------NAPEILSYIMSDNFDN-----------------
KITH_MYCPE      K-NKIMS-RDGRNMDSFEFD-------NPYEIFDKLLSLEVN------------------
KITH_MYCGA      A-QEIINSRDGRRIGSIKIK-------KAFEIYDYVLLHKPQ------------------
KITH_MYCGE      T-NIVKS-RNGEYDQAITIN-------SPFEIYDHLVDKNYQ------------------
KITH_MYCPN      Q-HLVKS-RNGHSDEAIEIN-------SPLEIYDYLTKDRFD------------------
KITH_MYCH2      S-QCEIVSRSGLKIPTFLAR-------TTQEIRDLFTR----------------------
KITH_MYCH7      S-QCEIVSRSGLKIPTFLAR-------TTQEIRDLFTR----------------------
KITH_MYCHJ      S-QCEIVSRSGLKIPTFLAR-------TTQEIRDLFTR----------------------
KITH_MYCMO      S-HNEIVSRSGTKLNTIVAS-------NVEEIKKVWN-----------------------
KITH_MYCA5      S-ENEIVSRAGVKHKTHILK-------NINDVYFLLQE----------------------
KITH_THEMA      H-STMIVSHSGNGVEAHVIE-------RPEEMRKYIEE----------------------
KITH_THESQ      H-STMIVSHSGNGVEAHVIE-------RPEEMRKYIEE----------------------
KITH_THEP1      H-STMIVSHSGNGVEAHVIE-------RPEEIRKYIEE----------------------
KITH_PSELT      G-VDCVKTHAGVEVEAIAVE-------KSADAMKYIKQ----------------------
KITH_RHIEC      G-RGVIGSRIGLEASAIPFE-------PDEDLFRLVMTLSGEG-A---------------
KITH_RHIME      G-QGRIASRIGLESEAIPFR-------AEDDLHGLIERLNGDGSG---------------
KITH_AGRFC      G-VGRVASRIGLSSEARTFD-------ENTDLFAEVAALHAQA-----------------
KITH_RHILO      D-SGLISSRIGLETEAEMFR-------DGDDLFARVAEHHDHT-----------------
KITH_JANSC      G-MGRIGSRIGIEAEADTYT-------QSDDLFAKIDARLKAG-----------------
KITH_RUEPO      G-TGRIASRIGIGAEADIFT-------PRDDVFAMIRDRLGAG-----------------
KITH_IDILO      G-KGRIASRLGIGRDAVSFT-------HRTDLAAVVRARYMQQ-----------------
KITH_NOVAD      G-ERAIESRIGLGADAHRFD-------AGTDLWQRISAA--HAVQ---------------
KITH_ZYMMO      K-QGVIKSRIGLEAPAIAFF-------EESSLWDIIQEQ--HVKN---------------
KITH_XANAC      G-SGVVASRIGLRADGRIFE-------RDTELQQLVERDI-HNDG---------------
KITH_XANC5      G-SGVVASRIGLRADGRIFE-------RDTELQQLVERDI-HNDG---------------
KITH_XANOR      G-SGVVASRIGLRADGRIFE-------RDTGLQQLVERDI-HNDG---------------
KITH_XANOM      G-SGVVASRIGLRADGRIFE-------RDTGLQQLVERDI-HNDG---------------
KITH_XANCP      G-SGVVASRIGLRADGQTFD-------RQTELLQLIERDI-AAHG---------------
KITH_XANC8      G-SGVVASRIGLRADGQTFD-------RQTELLQLIERDI-AAHG---------------
KITH_BLOFL      NDIKYIRSRIGLTSSARIFN-------GKTNLFKQISIVNKEK-----------------
KITH_BLOPB      NRYKQIKSRIGLYASARVFN-------IKTNFFDQVVTIHQKD-----------------
KITH_YERPE      G-VGTVSSRIGLSSQAQLYN-------SGTSLLSIIAAEHQDT-----------------
KITH_YERPS      G-VGTVSSRIGLSSQAQLYN-------SGTSLLSIIAAEHQDT-----------------
KITH_PECAS      G-VGIVSSRIGLSSPALLFN-------RQTSLFELLEKEHRTQ-----------------
KITH_ECO57      G-AGKVSSRIGLSSPAKLFN-------QNSSLFDEIRAEHEQQ-----------------
KITH_SHIFL      G-AGKVSSRIGLSSPAKLFN-------QNSSLFDEIRAEHEQQ-----------------
KITH_SHISS      G-AGKVSSRIGLSSPAKLFN-------QNSSLFDEIRAEHEQQ-----------------
KITH_SHIBS      G-AGKVSSRIGLSSPAKLFN-------QNSSLFDEIRAEHEQQ-----------------
KITH_ECOLI      G-AGKVSSRIGLSSPAKLFN-------QNSSLFDEIRAEHEQQ-----------------
KITH_ECOL6      G-AGKVSSRIGLSSPAKLFN-------QNSSLFDEIRAEHEQQ-----------------
KITH_SHIDS      G-AGKVSSRIGLSSPAKLFN-------QNSSLFAEIRAEHEQQ-----------------
KITH_SALPA      G-AGKVSSRIGLSSPAKLFN-------QNTSLFEEIRAESARQ-----------------
KITH_SALTI      G-AGKVSSRIGLSSPAKLFN-------QNTSLFEEIRAESARQ-----------------
KITH_SALTY      G-AGKVSSRIGLSSPAKLFN-------QNTSLFEEIRAESARQ-----------------
KITH_SALCH      G-AGKVSSRIGLSSPAKLFN-------QNTSLFEEIRAESVRQ-----------------
KITH_PHOLL      E-NGKVNSRIGLSSDALLFS-------QQTDIGELIRNENKQA-----------------
KITH_SHEON      G-KGKVASRIGIESDAQVFS-------SHDNLIEMITAAHQEN-----------------
KITH_VIBVU      G-IGKVSSRIGLQAEAQLFK-------ADTNLYQEIAALNEVE-----------------
KITH_VIBVY      G-IGKVSSRIGLQAEAQLFK-------ADTNLYQEIAALNEVE-----------------
KITH_VIBPA      G-VGKVSSRIGLQSDAHLFR-------PDTNLYQEIAALHEVE-----------------
KITH_VIBCH      G-VGKVSSRIGLEAEAHLFH-------ADTDLLHVIATLHEAE-----------------
KITH_ALIF1      G-VGKVSSRIGLHAEAHLFN-------KETNVFDAIKELHEAE-----------------
KITH_PHOPR      G-TGKVSSRIGLEEDAELYN-------KSDDLWSKLSMMHADT-----------------
KITH_PSEHT      G-VGKVSSRIGLQADAHIFD-------ENKDVFALIQSLNQDK-----------------
KITH_HAEIN      G-VGKVTSRIGISQDAFLFR-------SETNLFDEINEHLKKE-----------------
KITH_HAEI8      G-VGKVTSRIGISQDAFLFR-------SETNLFDEINEHLKKE-----------------
KITH_PASMU      G-VGKVTSRIGISQEAQLFH-------KESDLFVEIAQHLQQQ-----------------
KITH_MANSM      G-AGRVTSRIGISQQAKLFN-------RESNLFEEIKRHLASE-----------------
KITH_HAEDU      G-IGKVCSRIGISQEAKLFY-------TDTNFLEQVEQVLKAK-----------------
KITH_RHOBA      G-SGKVASRIGIESESVSFN-------TSDNLLNLVRNETRIN-----------------
KITH_COLP3      A-KGKVASRLGIDADAFLFD-------EKINLFKDVDQKHQAE-----------------
KITH_LEGPA      Q-YGTICSRIGLSEQAYAFN-------NSDNLYVLTQEFQLQTQ----------------
KITH_LEGPH      Q-YGTICSRIGLSEQAYAFN-------NSDNLYVLTQEFQLQTQ----------------
KITH_LEGPL      Q-YGTICSRIGLSEQAYAFN-------NTDNLYVLTQELQLQAT----------------
KITH_COXBU      G-ERKIATRIGLSGKTIALT-------KDTNLFKCISDKLAENP----------------
KITH_CHRVO      G-VGMITSRLNIQRESNTFD-------AGFDFLAHDY-------G---------------
KITH_RHOFT      G-LGVIRSRLGIERGASTFN-------ADTVFDHRILE------R---------------
KITH_FRATH      G-LNKVKSRIGIDQDAYSLT-------DRDNIFEFVENYNSSN-----------------
KITH_FRATT      G-LNKVKSRIGINQDAYSLT-------DRDNIFEFVENYNSSN-----------------
KITH_LISMO      Q-VGFISSRIGLKREATPIF-------SDTNIFEIVVNIKP-------------------
KITH_LISMF      Q-VGFISSRIGLKREATPIF-------SDTNIFEIVANIKP-------------------
KITH_LISIN      Q-VGFISSRIGLKREATPIF-------SDTNIFEIVANIKP-------------------
KITH_BACSK      E-VGYVSSRVGLRRRAVPIF-------DDTNIFDYVESCRQ-------------------
KITH_LACPL      G-VGYVASRIGLKREATPVF-------DDTNIFEIVKQTNP-------------------
KITH_LACSS      G-VGIVSSRIGLKREATPIF-------SDTNIYELVEATNP-------------------
KITH_ENTFA      G-VGKVSSRIGLRRDAIPIF-------EETNVFDLINDLSY-------------------
KITH_STRA1      E-FGVVSSRIGMRREAVPIS-------DDMDIFSYIQNLPQ-------------------
KITH_STRA3      E-FGVVSSRIGMRREAVPIS-------DDMDIFSYIQNLPQ-------------------
KITH_STRA5      E-FGVVSSRIGMRREAVPIS-------DDMDIFSYIQNLPQ-------------------
KITH_STRP8      G-FGIVSSRIGMRREAIPIS-------NDMDIFTFIAQLEE-------------------
KITH_STRPM      G-FGIVSSRIGMRREAIPIS-------NDMDIFTFIAQLEE-------------------
KITH_STRP6      G-FGIVSSRIGMRREAIPIS-------NDIDIFTFIAQLEE-------------------
KITH_STRP3      G-FGIVSSRIGMRREAIPIS-------NDMDIFTFIAQLEE-------------------
KITH_STRP1      G-FGIVSSRIGMRREAIPIS-------NDMDIFTFIAQLEE-------------------
KITH_STRMU      G-FGVVASRIGMRREAVTIT-------DDMDIFAYIENMFK-------------------
KITH_STRPN      G-VGYVSSRIGMKRPALAIE-------ETTDIFGYIRDLPE-------------------
KITH_STRR6      G-VGYVSSRIGMKRPALAIE-------ETTDIFGYIRDLPE-------------------
KITH_STRGC      G-VGYVSSRIGMKRQAMAIE-------DDTDILGYIKNLPE-------------------
KITH_LACLA      G-VGTVASRIGMKAEAVAID-------EEMSVFDYVNSLPA-------------------
KITH_STRT2      E-VGYISSRIGMRRKAYPIG-------NDTDIFDYIDDISP-------------------
KITH_STRT1      E-VGYISSRIGMRRKAYPIG-------NDTDIFDYIDDISP-------------------
KITH_LACAC      G-VGTVASRIGIHRKAIPIT-------EEMDLFEYIKEMNNHDLADGDG-----------
KITH_LACJO      G-VGTVASRIGLHRKAVPIS-------EDLDLFNYVSELNKSDVESGNG-----------
KITH_STRAW      G-EGKLSSRLGLVTEAVEAA-------PGMDLHAYLVDQMSKGG----------------
KITH_STRCO      G-EGKLSSRLGLVTDAVEVG-------DGQDLYAHVVDHLSQGG----------------
KITH_CUTAK      G-GARITSRIGLSVEAVEVT-------DSLDLYQDIVSRLSRGG----------------
                        :                                                   

KITH_BACAH      ----EMDVIAIDEVQFF---DGDIVEVVQVLANRGYRVIVAGLDQDFRGLPFGQVPQLMA
KITH_BACHK      ----EMDVIAIDEVQFF---DGDIVEVVQVLANRGYRVIVAGLDQDFRGLPFGQVPQLMA
KITH_BACC7      ----EMDVIAIDEVQFF---DGDIVEVVQVLANRGYRVIVAGLDQDFRGLPFGQVPQLMA
KITH_BACCQ      ----EMDVIAIDEVQFF---DGDIVEVVQVLANRGYRVIVAGLDQDFRGLPFGQVPQLMA
KITH_BACC1      ----EMDVIAIDEVQFF---DGDIVEVVQVLANRGYRVIVAGLDQDFRGLPFGQVPQLMA
KITH_BACC3      ----EMDVIAIDEVQFF---DGDIVEVVQVLANRGYRVIVAGLDQDFRGLPFGQVPQLMA
KITH_BACC2      ----DMDVIAIDEVQFF---DGDIVEVVQVLANRGYRVIVAGLDQDFRGLPFGQVPQLMA
KITH_BACCR      ----ELDVIAIDEVQFF---DGDIVEVVQVLANRGYRVIVAGLDQDFRGLPFGQVPQLMA
KITH_BACC4      ----ELDVIAIDEVQFF---DGDIVEVVQVLANRGYRVIVAGLDQDFRGLPFGQVPQLMA
KITH_BACCZ      ----EMDVIAIDEVQFF---DGDIVEVVQVLANRGYRVIVAGLDQDFRGLPFGQVPQLMA
KITH_BACC0      ----EMDVIAIDEVQFF---DGDIVEVVQVLANRGYRVIVAGLDQDFRGLPFGQVPQLMA
KITH_BACAN      ----EMDVIAIDEVQFF---DGDIVEVVQVLANRGYRVIVAGLDQDFRGLPFGQVPQLMA
KITH_BACAA      ----EMDVIAIDEVQFF---DGDIVEVVQVLANRGYRVIVAGLDQDFRGLPFGQVPQLMA
KITH_BACAC      ----EMDVIAIDEVQFF---DGDIVEVVQVLANRGYRVIVAGLDQDFRGLPFGQVPQLMA
KITH_BACWK      ----EMDVIAIDEVQFF---DGDIVEVVQVLANRGYRVIVAGLDQDFRGLPFGQVPQLMA
KITH_BACCN      ----DMNVIAIDEVQFF---DEDIVEVVQILANRGYRVIVAGLDQDFRGLPFGQVPQLMA
KITH_BACVZ      ----STDVIAVDEVQFF---GESIIGDLSSLADKGYRVIAAGLDMDFRGEPFGVVPNLMA
KITH_BACSU      ----STDVVAVDEVQFF---DQEIVEVLSSLADKGYRVIAAGLDMDFRGEPFGVVPNIMA
KITH_BACLD      ----ETDVIGVDEVQFF---DETIVGTLTSLADQGYRVIAAGLDLDFRGEPFGVVPDLMA
KITH_BACP2      ----RTDVIGIDEVQFF---DETIIDIVTQLADKGYRVIVAGLDQDFRGEPFGVVPHLMA
KITH_GEOKA      ----ATDVVAIDEIQFF---SDDIIDVVQTLADCGYRVIAAGLDQDFRGEPFGPVPALMA
KITH_GEOTN      ----TTDVVAIDEVQFF---SDDIIDVVQTLADRGYRVIAAGLDQDFRGEPFGPVPALMA
KITH_GEOSW      ----KTDVIAIDEVQFF---SDDIIDVVQTLADRGYRVIVAGLDQDFRGEPFGPVPTLMA
KITH_ANOFW      ----HTDVVAIDEVQFF---DEHVVDVVQQLADEGYRVIVAGLDQDFRGEPFGPVPTLMS
KITH_STAAB      ----NVDVIGIDEVQFF---DDEIVSIVEKLSADGHRVIVAGLDMDFRGEPFEPMPKLMA
KITH_STAAW      ----NVDVIGIDEVQFF---DDEIVSIVEKLSADGHRVIVAGLDMDFRGEPFEPMPKLMA
KITH_STAAC      ----NVDVIGIDEVQFF---DDEIVSIVEKLSADGHRVIVAGLDMDFRGEPFEPMPKLMA
KITH_STAAR      ----NVDVIGIDEVQFF---DDEIVSIVEKLSADGHRVIVAGLDMDFRGEPFEPMPKLMA
KITH_STAAS      ----NVDVIGIDEVQFF---DDEIVSIVEKLSADGHRVIVAGLDMDFRGEPFEPMPKLMA
KITH_STAA3      ----NVDVIGIDEVQFF---DDEIVSIVEKLSADGHRVIVAGLDMDFRGEPFEPMPKLMA
KITH_STAAM      ----NVDVIGIDEVQFF---DDEIVSIVEKLSADGHRVIVAGLDMDFRGEPFEPMPKLMA
KITH_STAAN      ----NVDVIGIDEVQFF---DDEIVSIVEKLSADGHRVIVAGLDMDFRGEPFEPMPKLMA
KITH_STAES      ----EVNVIGIDEVQFF---EDDIVNIVEKLAENGHRVIVAGLDMDFRGEPFKPMPKLLA
KITH_STAEQ      ----EVNVIGIDEVQFF---EDDIVNIVEKLAENGHRVIVAGLDMDFRGEPFKPMPKLLA
KITH_STAHJ      ----HVDVIGIDEIQFF---DKEIVNIVEKLAENGHRVVVAGLDMDFRGEPFEPMPQIMA
KITH_STAS1      ----EVDVIGIDEVQFF---ENGIVHIAEQLAEKGHRVITAGLDMDFRAQPFEPMPQLMA
KITH_MACCJ      ----AHDIIAIDEVQFF---DNDIVGVATQLAEEGYRVIVAGLDMDFRGVPFEPVPELMA
KITH_BACHD      ----DTDIVAIDEVQFF---DEDVIGVVDYLADHGVRVICAGLDQDFRGEPFEPTRTLMA
KITH_OCEIH      ----NVEIVGIDEVQFF---DNNVVDVIEELADRGIRVIVAGLDLDFRGEPFEPVPKIMA
KITH_CLOB6      ----DTDVIGIDEAQFF---DDSLVEIVSKIANNNRRVICAGLDMDFKGEPFGPMPKLMA
KITH_CLOBJ      ----DTDVIGIDEAQFF---DDSLVEIVSKIANNNRRVICAGLDMDFKGEPFGPMPKLMA
KITH_CLOB1      ----DTDVIGIDEAQFF---DDFLVEIVSKIANNNRRVICAGLDMDFKGEPFGPMPKLMA
KITH_CLOBK      ----DTDVIGIDEAQFF---DDFLVEIVSKIANNNRRVICAGLDMDFKGEPFGPMPKLMA
KITH_CLOBH      ----DTDVIGIDEAQFF---DDFLVEIVSKIANNNRRVICAGLDMDFKGEPFGPMPKLMA
KITH_CLOBL      ----DTDVIGIDEAQFF---DDFLVEIVSKIANNNRRVICAGLDMDFKGEPFGPMPKLMA
KITH_CLOBM      ----DTDVIGIDEAQFF---DDSLVEIVSKIANNNRRVICAGLDMDFKGEPFGPMPKLMA
KITH_CLOAB      ----DTEVIAIDEVQFF---DDEIVEIVNKIAESGRRVICAGLDMDFRGKPFGPIPELMA
KITH_CLOTE      ----DTEVVAIDEAQFF---DKGILEVVNKIANEGKRVICAGLDQDFKGEPFGYMPDIIA
KITH_THEP3      ----DTEVIAIDEIQFF---DHSIVDVVREIADLGKRVICAGLDMDFRGEPFGPTPDVMA
KITH_THEPX      ----DTEVIAIDEIQFF---DHSIVDVVREIADLGKRVICAGLDMDFRGEPFGPTPDVMA
KITH_CALS4      ----DTQVVAIDEIQFF---DHSLVDVVREIADMGKRVICAGLDMDFRGEPFGVTPDIMA
KITH_DICT6      ----DTQVVAIEEGQFF---DMGIVKVCQRLADKGKRVIVAGLDQDFRGEPFGPMPYLMA
KITH_DICTD      ----DTQVVAIEEGQFF---DMGLVKVCQRLADRGKRVIVAGLDQDFRGEPFGPMPYLMA
KITH_BACFR      ----EIDVVGIDEAQFF---DSGLIDVCNQLANNGVRVIIAGLDMDFKGVPFGPMPALCA
KITH_BACFN      ----EIDVVGIDEAQFF---DSGLIDVCNQLANNGVRVIIAGLDMDFKGIPFGPMPALCA
KITH_BACTN      ----EIDVVGIDEAQFF---DDGLIDVCRQLANNGIRVIIAGLDMDFKGNPFGPMPQLCA
KITH_BACV8      ----DKDVVGIDEAQFF---DEGLVDVCNKLADNGIRVIVAGLDMDFRRVPFGPIPALLA
KITH_PORGI      ----QVDVVGIDEAQFF---DEGLVEVAQQLADQGVRVVIAGLDMDFRRQPFGPMPGLCA
KITH_PORG3      ----QVDVVGIDEAQFF---DEGLVEVAQQLADQGVRVVIAGLDMDFRRQPFGPMPGLCA
KITH_RHOSI      ----SADVVGIDEAQFF---DMTLVDVCQQLANDGKRVIVAGLDQEYMGRPLEPMPQFMA
KITH_SALRD      ----EADVVGIDEAQFF---DDDLVPTCQALAEDGHRVIVVGLDTDYRAEPFDPMPQLMA
KITH_BDEBA      ----NTKVVGIDEGQFF---GQNLVQIAQDLADRGLRVIIAGLDTDWQGKPFEPMPTLMA
KITH_CHLSY      ----DAQVVAIDELHLFDDDPAEMVRGCQWLANRGVRVIVAGLDLNYRAEPFPAMMHLLA
KITH_CHLAA      ----DAQVVAIDELHLFDDDPAEMVRGCQWLANRGVRVIVAGLDLNYRAEPFPAMMHLLA
KITH_CHLAD      ----DVQVVAIDELHLFDDDPAEMVRGCQVLADRGARVIVAGLDLNYRAEPFPAMMHLLA
KITH_ROSCS      ----DIHVVAVDELHLLDDPPDAAREVCQDLADRGLRVIVAGLDQDFRAQPFPAMAQLMA
KITH_ROSS1      ----DVDVVAVDELHLLDDPPDAAREVCQQLADRGLRVIVAGLDQDFRAQPFPAMAQLMA
KITH_HALSA      -------VVAIDEANFF---PAELVDVCQELAADGRRVVLSGTDQTFRGEPFEPVPQLMA
KITH_HALS3      -------VVAIDEANFF---PAELVDVCQELAADGRRVVLSGTDQTFRGEPFEPVPQLMA
KITH_HALWD      SNDDSVDVVAIDEANFF---STELVSVCESLANDGYRVVVSGTDQTYRGEPFEPLPQLMA
KITH_COPPD      ----DAEVVGIDEAQFF---TGELVPVIRELLQNKKRVIVAGLDLDFRGEPFGIMPTLLA
KITH_DEIDV      ASAEMPDVIGIDEVQFF---GPELVPLALELADAGVRVILAGLDLDFRAEPFGCMPDLLA
KITH_DEIRA      AAPEGVDVIGIDEAQFF---GPELVPLVLELADAGVRVVLAGLDLDFRAEPFGSMPELLA
KITH_MYCCT      NQIQQVDVIGIDEVQFF---DENVVDIIEQLADNGIIVIVNGLDKDFRGLPFKNVDKLLV
KITH_MYCMS      NQIQQVDVIGIDEVQFF---DEQVVELIEQLANQGIIVIVNGLDKDFRCLPFKNVDKLLV
KITH_MESFL      ILEKKVDVVGIDEIQFF---DEAIVDYIEELADRGIIVIVTGLDKDFRSQPFKNVDRILP
KITH_PYRAE      -MGAEYDVVAVDEIQFF---PVDLADALNQLANGRI-VIAAGLNLDFRGEPFETTARAMA
KITH_THEKO      TLNEGYEVIGIDEVQFF---PMSVVEALNELADQGIYVIASGLNLDFKGDPFPVTKELLV
KITH_AYWBP      ----EINVVIIDESQFL---DNDIIAIVDYLANCNIEVIISGLELDFCGKPFGPMPYLLA
KITH_ONYPE      ----EINVVIIDEAQFL---DNDIVAIVDYLANCNIEVIISGLELDFCGKPFGPMPYLLA
KITH_UREPA      ----ETKVIGIDEVQFF---DDRICEVANILAENGFVVIISGLDKNFKGEPFGPIAKLFT
KITH_UREP2      ----ETKVIGIDEVQFF---DDRICEVANILAENGFVVIISGLDKNFKGEPFGPIAKLFT
KITH_UREU1      ----EIKVIGIDEVQFF---DDRICEVANILAENGFVVIISGLDKNFKGEPFGPIAKLFA
KITH_MYCPE      -----PHVVAIDEAQFA---DESIVDVCQALADSGYIVYVSALDKNFKNEPFMVTAKIAC
KITH_MYCGA      -------LVGIDEVQFF---DDSIVEVIQTLADNQINVIVAGLDRDFRGEPFGPIPKILG
KITH_MYCGE      -------IVAIDEAQFF---SNEIIEVVTTLNEIGTNVIISGLDTDFRAEPFGCIPQLLA
KITH_MYCPN      -------VVAIDEAQFF---SSEIVEVVKSLNDLGINVIVSGLDTDFRAEPFGSIPQLLA
KITH_MYCH2      ---DNYQAIAIDEIQFF---DEEIVTFLEQIADKGIRVIVSGLDQDFRRKPFGSLPNLMA
KITH_MYCH7      ---DNYQAIAIDEIQFF---DEEIVTFLEQIADKGIRVIVSGLDQDFRRKPFGSLPNLMA
KITH_MYCHJ      ---DNYQAIAIDEIQFF---DEEIVTFLEQIADKGIRVIVSGLDQDFRRKPFGSLPNLMA
KITH_MYCMO      ---NTYKAIAIDEVQFF---DKDIINYIDELASKGIRVIISGLDTDFARKPFGIMPELLA
KITH_MYCA5      ---DKYKAVVIDEAHWF---NEELVKVADDLANKGYLVIVAGLDQNYLREPFGPIPNLLA
KITH_THEMA      ----DTRGVFIDEVQFF---NPSLFEVVKDLLDRGIDVFCAGLDLTHKQNPFETTALLLS
KITH_THESQ      ----DTRGVFIDEVQFF---SPGLFEVVKDLLDRGIDVFCAGLDLTHKQNPFETTALLLS
KITH_THEP1      ----DTRGVFIDEVQFF---SPGLFEVVKDLLDRGIDVFCAGLDLTHKQNPFETTALLLS
KITH_PSELT      ----PVDAVFVDEVQFF---DKDLVKIVRQLLDQDVDIFCAGLDMTFKQNPFETTMLLMS
KITH_RHIEC      ----PISCVFVDEAHFMT--PLHVWQLARIVDRLGIPVMVYGLRTDFQGKLFPASQELLA
KITH_RHIME      ----EIACVFVDEAQFLG--EDQVWQLARVADRLGIPVMAYGLRTDFQGKLFPGSMALLA
KITH_AGRFC      ----PVACVFVDEANFLS--EHHVWQLANIADRLNIPVMTYGLRTDFQGKLFPASKELLA
KITH_RHILO      ----TVHCVFVDEAQFLE--EEQVWQLARIADRLNIPVMCYGLRTDFQGKLFSGSRALLA
KITH_JANSC      ----PCACVLVDEAQWMT--RDQVWQLARAVDDLGVPVMCYGLRVDFRGELFPGSAALLA
KITH_RUEPO      ----PVACVFVDEAQFLS--PEQVWQLARVVDDLDVPVLAYGLRVDFQGKLFPGSATLLA
KITH_IDILO      ----AIDCVLIDEAQFLS--EEQVWQLSSLADTDNIPVMCYGIRTDAFGNAFPGSAVLLA
KITH_NOVAD      ----PLSCVLVDEAQFLR--RDQVWQLARVADAAGIPVLCYGLRTDFQGELFEGSAALLG
KITH_ZYMMO      ----PLHCILIDEAQFLN--KNQVFELARVCDDLNIPVLCYGLRTDFQAELFEGSKYLLA
KITH_XANAC      ----ALHCVLVDEAQFLS--RAQVWQLSEVVDRLRIPVLCYGLRTDFRGELFEGSQFLLA
KITH_XANC5      ----ALHCVLVDEAQFLG--RAQVWQLSEVVDRLRIPVLCYGLRTDFRGELFEGSQFLLA
KITH_XANOR      ----ALHCVLVDEAQFLS--RAQVWQLSEVVDRLRVPVLCYGLRTDFRGELFEGSQFLLA
KITH_XANOM      ----ALHCVLVDEAQFLS--RAQVWQLSEVVDRLRVPVLCYGLRTDFRGELFEGSQFLLA
KITH_XANCP      ----PLHCVLVDEAQFLS--SAQVWQLSEVVDRLRIPVLCYGLRTDFRGELFEGSQFLLA
KITH_XANC8      ----PLHCVLVDEAQFLS--SAQVWQLSEVVDRLRIPVLCYGLRTDFRGELFEGSQFLLA
KITH_BLOFL      ----KIHCILIDECHFLN--RNQVIDLTKVVDILNIPVLCYGLRTDFQSKLFSGSLWLLA
KITH_BLOPB      ----IIHCVLVDECHFLN--RNQVIDLSKIVDVLNIPVLCYGLRTDFRADLFSGSLWLLA
KITH_YERPE      ----PIHCILLDECQFLT--KEQVQELCQVVDELHLPVLCYGLRTDFLGELFPGSKYLLA
KITH_YERPS      ----PIHCILLDECQFLT--KEQVQELCQVVDELHLPVLCYGLRTDFLGELFPGSKYLLA
KITH_PECAS      ----PVDCVLIDECQFLT--REQVNELSDVVDQLDIPVLCYGLRTDFRGDLFSGSHYLLA
KITH_ECO57      ----AIHCVLVDECQFLT--RQQVYELSEVVDQLDIPVLCYGLRTDFRGELFIGSQYLLA
KITH_SHIFL      ----AIHCVLVDECQFLT--RQQVYELSEVVDQLDIPVLCYGLRTDFRGELFIGSQYLLA
KITH_SHISS      ----AIHCVLVDECQFLT--RQQVYELSEVVDQLDIPVLCYGLRTDFRGELFIGSQYLLA
KITH_SHIBS      ----AIHCVLVDECQFLT--RQQVYELSEVVDQLDIPVLCYGLRTDFRGELFIGSQYLLA
KITH_ECOLI      ----AIHCVLVDECQFLT--RQQVYELSEVVDQLDIPVLCYGLRTDFRGELFIGSQYLLA
KITH_ECOL6      ----AIHCVLVDECQFLT--RQQVYELSEVVDQLDIPVLCYGLRTDFRGELFIGSQYLLA
KITH_SHIDS      ----AIHCVLVDECQFLT--RQQVYELSEVVDQLDIPVLCYGLRTDFRGELFIGSQYLLA
KITH_SALPA      ----TIHCVLVDESQFLT--RQQVYQLSEVVDKLDIPVLCYGLRTDFRGELFVGSQYLLA
KITH_SALTI      ----TIHCVLVDESQFLT--RQQVYQLSEVVDKLDIPVLCYGLRTDFRGELFVGSQYLLA
KITH_SALTY      ----TIHCVLVDESQFLT--RQQVYQLSEVVDKLDIPVLCYGLRTDFRGELFVGSQYLLA
KITH_SALCH      ----TIHCVLVDESQFLT--RQQVYQLSEVVDKLDIPVLCYGLRTDFRGELFVGSQYLLA
KITH_PHOLL      ----KVHCVLIDECHFLT--KAQIEQICKVTDYDDIPVLCYGLRTDFRGELFSGSQYLLA
KITH_SHEON      ----HLSCVLVDECQFLS--KEQVKQLTYIVDKIDIPVLCYGLRTDFQGELFSGSHYLLA
KITH_VIBVU      ----KRHCILVDECQFLS--KEQVYQLTEVVDKLHIPVLCYGLRTDFLGELFEGSKYLLS
KITH_VIBVY      ----KRHCILVDECQFLS--KEQVYQLTEVVDKLHIPVLCYGLRTDFLGELFEGSKYLLS
KITH_VIBPA      ----KRHCILIDECQFLS--KEQVYQLTEVVDKLHIPVLCYGLRTDFLGELFEGSKYLLS
KITH_VIBCH      ----PRHCILMDECQFLS--KEQVYQLTEVVDKLDIPVLCYGLRTDFLGELFEGSKYLLS
KITH_ALIF1      ----KLHCVLIDECQFLT--KEQVYQLTEVVDKLNIPALCYGLRTDFLGELFEGSKYLLS
KITH_PHOPR      ----HIDCVLIDECQFLT--KEQVYQLTEVVDKLHIPVLCYGLRSDFRGELFDGSRYLLS
KITH_PSEHT      ----KRHCVLVDECQFLS--KEQVMQLTDVVDELGIPVLCYGLRNDFRGELFTGSQYLLA
KITH_HAEIN      ----KVHCVLVDEAQFLS--KQQVYQLSDVVDKLKIPVLCYGLRTDFQAELFEGSKYLLA
KITH_HAEI8      ----KVHCVLVDEAQFLS--KQQVYQLSDVVDKLKIPVLCYGLRTDFQAELFEGSKYLLA
KITH_PASMU      ----PLHCILVDEAQFLT--KTQVYQLSEVVDKLKIPVLCYGLRTDFQAELFEGSKYLLA
KITH_MANSM      ----KLHCILIDEAQFLT--KQQVYQLSDVVDLLNIPVLCYGLRTDFQAELFEGSQYLLA
KITH_HAEDU      ----KLHCIMIDEAQFLT--KKQVHQLTDVVDELKIPVLCYGLRTDFQKELFEGSQYLLA
KITH_RHOBA      ----PLHCVLVDEAQFLT--RTQVRQLSDVCDDLDIPVLAYGLRTDFQGNLFEGSEHLLA
KITH_COLP3      ----KIDCVLIDEAQFLS--TEQVKQLTDIVDLLHIPVLAYGIRTDFLGQTFSGSAALLA
KITH_LEGPA      ----KYSCVLIDEAQFLT--REQVYQLTEITDQMSIPVLAYGLRTDFRGELFPGSQFLLA
KITH_LEGPH      ----KYSCVLIDEAQFLT--REQVYQLTEITDQMSIPVLAYGLRTDFRGELFPGSQFLLA
KITH_LEGPL      ----KYSCVLIDEAQFLT--REQVYQLTEITDQMSIPVLAYGLRTDFRGELFPGSQFLLA
KITH_COXBU      ----NIRCVLVDEAQFLT--KSQVEALALVTDELNLPVLAYGIRTDFQGEPFEGSVYLLA
KITH_CHRVO      ----DTACVLVDEAQFMT--PEQAQQLHRLAHKRNIPVICFGLRTDFQGHPFPGSAWLLS
KITH_RHOFT      ----DTACLLIDESQFLR--PVQVRQLHRLAHTSQVPIRCYGLRSDFLGHPFAGSAALLT
KITH_FRATH      ----KIDCVLIDEIHFFT--QEQVWQLAEIVDELNIPVICYGLRTNYLGQPFETAALLLA
KITH_FRATT      ----KIDCVLIDEIHFFT--QEQVWQLAEIVDELNIPVICYGLRTNYLGQPFETAALLLA
KITH_LISMO      ----KPNCVLLDESQFLE--KEHVFQLAKIVDELNIPVIAYGLKNDFRNELFEGSKYLLL
KITH_LISMF      ----KPNCVLLDESQFLE--KEHVFQLAKIVDELNIPVIAYGLKNDFRNELFEGSKYLLL
KITH_LISIN      ----KPNCVLLDESQFLE--KEHVFQLAKIVDDLNIPVIAYGLKNDFRNELFEGSKYLLL
KITH_BACSK      ----KPYCVLIDEVQFLT--KAHVLQLANIVDTLDIPVMGFGLKNDFRNELFEGSKYMLL
KITH_LACPL      ----DAACVLIDEAQFLK--KHHVLELADIVDELKIPVMTFGLKNDFRNELFEGSKYLLL
KITH_LACSS      ----DAACVLIDESQFLE--RHHVIEAAKVVDDLNIPVMAFGLKNDFKNELFEGSKYLLL
KITH_ENTFA      ----KPFCVLVDECQFLN--KHHVIEFARIVDELDIPVMAFGLKNDFRNELFEGSKYLLL
KITH_STRA1      ----KPYCVLIDECQFLS--KKNVYDLARVVDDLDVPVMAFGLKNDFQNNLFEGSKHLLL
KITH_STRA3      ----KPYCVLIDECQFLS--KKNVYDLARVVDDLDVPVMAFGLKNDFQNNLFEGSKHLLL
KITH_STRA5      ----KPYCVLIDECQFLS--KKNVYDLARVVDDLDVPVMAFGLKNDFQNNLFEGSKHLLL
KITH_STRP8      ----KPYCVLIDESQFLS--KQNVYDLARVVDELNVPVMAFGLKNDFQNNLFEGSKHLLL
KITH_STRPM      ----KPYCVLIDESQFLS--KQNVYDLARVVDELNVPVMAFGLKNDFQNNLFEGSKHLLL
KITH_STRP6      ----KPYCVLIDESQFLS--KQNVYDLARVVDELNVPVMAFGLKNDFQNNLFEGSKHLLL
KITH_STRP3      ----KPYCVLIDESQFLS--KQNVYDLARVVDELNVPVMAFGLKNDFQNNLFEGSKHLLL
KITH_STRP1      ----KPYCVLIDESQFLS--KQNVYDLARVVDELNVPVMAFGLKNDFQNNLFEGSKHLLL
KITH_STRMU      ----KPYCILIDESQFLS--QKNVYDLARIVDELDVPVMAFGLKNDFQNHLFEGSRELLL
KITH_STRPN      ----KPYCVLVDEAQFLK--RHHVYDLARVVDELDIPVMAFGLKNDFRNELFEGSKYLLL
KITH_STRR6      ----KPYCVLVDEAQFLK--RHHVYDLARVVDELDIPVMAFGLKNDFRNELFEGSKYLLL
KITH_STRGC      ----KPYCILIDEAQFLK--RHHVYDLARVVDELDVPVMAFGLKNDFRNELFEGSKHLLL
KITH_LACLA      ----KPFCVLIDEAQFLN--KKHVYDFARVVDELNVPVMAFGLKNDFRNELFEGSKYLLL
KITH_STRT2      ----RPYCVLIDEAQFLT--RANVYDLARIVDELDIPVMAFGLKNDFQNNLFEGSKYLLL
KITH_STRT1      ----RPYCVLIDEAQFLT--RANVYDLARIVDELDIPVMAFGLKNDFQNNLFEGSKYLLL
KITH_LACAC      ----KLACVLIDEAQFLK--RHHVLECAKIVDEFNIPVMTFGLKNDFQNHLFEGSENLLI
KITH_LACJO      ----RVACVLIDEAQFLK--RHHVLECAKIVDELKIPVMAFGLKNDFQNHLFEGSENLLI
KITH_STRAW      ----KVDYLIVDEAQFLA--PEQIDQLARVVDDLDLDVFAFGITTDFRTKLFPGSQRLIE
KITH_STRCO      ----RVDYVIADEAQFLA--PDQIDQLARVVDDLDVDVYAFGITTDFRSKLFPGSQRLVE
KITH_CUTAK      ----RIDYLICDEAQFYR--TKQIDQLARVVDDLDIDVYCFGILADFRTELFPGSKRLVE
                        :  :* :                          .         :        

KITH_BACAH      IAEHVTKLQAVCS-ACGSPASRTQRLIDGEPAAFDDPIILVGA------SESYEPRCRHC
KITH_BACHK      IAEHVTKLQAVCS-ACGSPASRTQRLIDGEPAAFDDPIILVGA------SESYEPRCRHC
KITH_BACC7      IAEHVTKLQAVCS-ACGSPASRTQRLIDGEPAAFDDPIILVGA------SESYEPRCRHC
KITH_BACCQ      IAEHVTKLQAVCS-ACGSPASRTQRLIDGEPAAFDDPIILVGA------SESYEPRCRHC
KITH_BACC1      IAEHVTKLQAVCS-ACGSPASRTQRLIDGEPAAFDDPIILVGA------SESYEPRCRHX
KITH_BACC3      IAEHVTKLQAVCS-ACGSPASRTQRLIDGEPAAFDDPIILVGA------SESYEPRCRHC
KITH_BACC2      IAEHVTKLQAVCS-ACGSPASRTQRLIDGEPAAFDDPIILVGA------SESYEPRCRHC
KITH_BACCR      IAEHVTKLQAVCS-VCGSPASRTQRLIDGEPAAFDDPIILVGA------SESYEPRCRHC
KITH_BACC4      IAEHVTKLQAVCS-VCGSPASRTQRLIDGDPAAFDDPIILVGA------SESYEPRCRHC
KITH_BACCZ      IAEHVTKLQAVCS-ACGSPASRTQRLIDGEPAAFDDPIILVGA------SESYEPRCRHC
KITH_BACC0      IAEHVTKLQAVCS-ACGSPASRTQRLIDGEPAAFDDPIILVGA------SESYEPRCRHC
KITH_BACAN      IAEHVTKLQAVCS-ACGSPASRTQRLIDGEPAAFDDPIILVGA------SESYEPRCRHC
KITH_BACAA      IAEHVTKLQAVCS-ACGSPASRTQRLIDGEPAAFDDPIILVGA------SESYEPRCRHC
KITH_BACAC      IAEHVTKLQAVCS-ACGSPASRTQRLIDGEPAAFDDPIILVGA------SESYEPRCRHC
KITH_BACWK      IAEHVTKLQAVCS-ECGSPASRTQRLIDGEPAAFDDPIILVGA------SESYEPRCRHC
KITH_BACCN      IAEYVTKLQAVCS-VCGSPASRTQRLINDEPAAFDDPIILVGA------SESYEPRCRHC
KITH_BACVZ      VAESVTKLQAVCS-VCGSPASRTQRLIDGKPASYDDPVILVGA------SESYEARCRHH
KITH_BACSU      IAESVTKLQAVCS-VCGSPASRTQRLIDGKPASYDDPVILVGA------AESYEARCRHH
KITH_BACLD      LAETVTKLQAVCS-VCGSPASRTQRLINGKPASYDDPVILVGA------SEAYEARCRHH
KITH_BACP2      CAELVTKLQAVCS-VCGSPASRTQRLIDGKPASYDDPIILVGA------QESYEARCRHH
KITH_GEOKA      IAESVTKLQAVCT-VCGSPASRTQRLINGAPASYDDPVILVGA------SEAYEPRCRHH
KITH_GEOTN      LAESVTKLQAVCT-VCGSPASRTQRLINGAPASYDDPIILVGA------SEAYEPRCRHH
KITH_GEOSW      IAESVTKLQAVCT-VCGSPASRTQRLINGVPASYYDPVILVGA------SESYEPRCRHH
KITH_ANOFW      IAESVTKLQAVCT-VCGSPASRTQRLINGRPASYYDPVILIGA------SESYEPRCRHH
KITH_STAAB      VSEQVTKLQAVCA-VCGSSSSRTQRLINGKPAKIDDPIILVGA------NESYEPRCRAH
KITH_STAAW      VSEQVTKLQAVCA-VCGSSSSRTQRLINGKPAKIDDPIILVGA------NESYEPRCRAH
KITH_STAAC      VSEQVTKLQAVCA-VCGSSSSRTQRLINGKPAKIDDPIILVGA------NESYEPRCRAH
KITH_STAAR      VSEQVTKLQAVCA-VCGSSSSRTQRLINGKPAKIDDPIILVGA------NESYEPRCRAH
KITH_STAAS      VSEQVTKLQAVCA-VCGSSSSRTQRLINGKPAKIDDPIILVGA------NESYEPRCRAH
KITH_STAA3      VSEQVTKLQAVCA-VCGSSSSRTQRLINGKPAKIDDPIILVGA------NESYEPRCRAH
KITH_STAAM      VSEQVTKLQAVCA-VCGSSSSRTQRLINGKPAKIDDPIILVGA------NESYEPRCRAH
KITH_STAAN      VSEQVTKLQAVCA-VCGSSSSRTQRLINGKPAKIDDPIILVGA------NESYEPRCRAH
KITH_STAES      VSEHITKLQAVCS-VCGSPSSRTQRLINGEPAKVDDPIILVGA------NESYEPRCRAH
KITH_STAEQ      VSEHITKLQAVCS-VCGSPSSRTQRLINGEPAKVDDPIILVGA------NESYEPRCRAH
KITH_STAHJ      VSEQVTKLQAVCA-VCGSSSSRTQRLIDGQPAKVDDPIILVGA------NESYEPRCRAH
KITH_STAS1      VSEDVTKLQAVCA-VCGASSSRTQRLIDGNPAKIDDPVILVGA------NESYEPRCRAH
KITH_MACCJ      VSEHVTKLQAVCS-VCGAPSSRTQRLIDGVPAKFDDPIILVGA------KESYEPRCREH
KITH_BACHD      MAEYVTKLQAICP-VCGSPASRTQRLIDGKPASYHDPIILVGA------AEAYEPRCRHC
KITH_OCEIH      LAESVTKLNAICP-ICGSPASRTQRLIDGKPASYNDPIILVGA------SESYEPRCRHH
KITH_CLOB6      IAEFVDKIQAVCM-VCNNPATRTQRLINGKPAKKSDPVVLIGA------QESYEARCRKC
KITH_CLOBJ      IAEFVDKIQAVCM-VCNNPATRTQRLINGKPAKKSDPVVLIGA------QESYEARCRKC
KITH_CLOB1      IAEFVDKIQAVCM-VCNNPATRTQRLINGKPAKKSDPVVLIGA------QESYEARCRKC
KITH_CLOBK      IAEFVDKIQAVCM-VCNNPATRTQRLINGKPAKKSDPVVLIGA------QESYEARCRKC
KITH_CLOBH      IAEFVDKIQAVCM-VCNNPATRTQRLINGKPAKKSDPVVLIGA------QESYEARCRKC
KITH_CLOBL      IAEFVDKIQAVCM-VCNNPATRTQRLINGKPAKKSDPVVLIGA------QESYEARCRKC
KITH_CLOBM      IAEFVDKIQAVCM-VCNNPATRTQRLINGKPAKKSDPVVLIGA------QESYEARCRKC
KITH_CLOAB      IAEFVDKIQAICV-VCGNPATRTQRLINGKPAFYDDPVVLIGA------MESYEARCRKC
KITH_CLOTE      VAEFVHKVQAVCM-ICGNPATRTQRLINGKPAKYDDPVVLVGA------KESYEARCRKC
KITH_THEP3      IAESVDKLTAICV-KCGNPATRTQRLINGKPAKYDDPIILVGA------HETYEARCRKC
KITH_THEPX      IAESVDKLTAICV-KCGNPATRTQRLINGKPAKYDDPIILVGA------HETYEARCRKC
KITH_CALS4      IAESVDKLTAICV-KCGNPATRTQRLINGKPAKYDDPIILVGA------HETYEARCRKC
KITH_DICT6      VAEYVDKLHAICM-KCGNVASRTQRIIDGKPAYYDDPIILVGA------FETYEARCRNC
KITH_DICTD      VAEYVDKLHAICM-KCGNVASRTQRIIDGKPAYYDDPIILVGA------FETYEARCRHC
KITH_BACFR      IADEVSKVHAICV-KCGQLASFSHRTVKN------DKQVLLGE------TAQYEPLCREC
KITH_BACFN      IADEVSKVHAICV-KCGQLASFSHRTVKN------DKQVLLGE------TAQYEPLCREC
KITH_BACTN      IADEVSKVHAICV-KCGDLASFSHRTVKN------DKQVLLGE------TAEYEPLCREC
KITH_BACV8      IADEVTKVHAICV-KCGNLAYATHRITKS------EKRVLLGE------KADYEPLCRTC
KITH_PORGI      IADSVTKVHAVCV-ECGRLASYSFRRVQG------DQQVMLGE------LNEYSPLCRTC
KITH_PORG3      IADSVTKVHAVCV-ECGRLASYSFRRVQG------DQQVMLGE------LNEYSPLCRTC
KITH_RHOSI      VAEYVTKLHAICA-VCGAPANHSQRLTDE------EGRVVLGA------ADRYEPRCRRC
KITH_SALRD      VAEHVTKLHAVCV-VCGAPANHSQRIVPG------EDRVLVGA------TEAYEPRCRAC
KITH_BDEBA      VAESVTKQHAVCV-VCGAPASRTQRTAGG------DGQVLVGT------HDAYEARCRQH
KITH_CHLSY      LAEQVDKLYAICV-KCGAYATRSQRLIDGKPAPADAPTIVVGG------LDMYEARCRTC
KITH_CHLAA      LAEQVDKLYAICV-KCGAYATRSQRLIDGKPAPADAPTIVVGG------LDMYEARCRTC
KITH_CHLAD      LAEQVDKLYAICV-KCGAYATRSQRLIDGKPAPANAPTIVVGG------LDMYEARCRAC
KITH_ROSCS      VAEQVDKLYAICV-RCGAYATRSQRLIDGKPAPADAPTIVVGG------QELYEARCRAC
KITH_ROSS1      VAEQVDKLYAICV-RCGAYATRSQRLIDGKPAPADAPTIVVGG------QELYEARCRAC
KITH_HALSA      IAEYVDKMRAICM-QCGEPATRNQRLIEGEPAHYDDPTVMVGA------EETYEARCRNC
KITH_HALS3      IAEYVDKMRAICM-QCGEPATRNQRLIEGEPAHYDDPTVMVGA------EETYEARCRNC
KITH_HALWD      VAEYVDKLQAICT-QCGEPATRNQRLVDDSPAHIDDPTIVVGA------DETYEARCRNC
KITH_COPPD      LADEVTKLHAICS-VCGNIATKTQRLINGRPARYDDPTILVGG------LETYEARCNLH
KITH_DEIDV      RAESVEKLTAICT-QCGAPATRSQRLISGEPARFDDPVVLVGA------LESYEARCRLH
KITH_DEIRA      RAESVDKLTAICT-VCGAPATRTQRLIGGQPARFDDPVVLVGA------QESYEALPRAP
KITH_MYCCT      KAEFVTKLRARCH-LCGSFANRSQRIVNGQPALWDSPLILVDG------KESYEARCRKC
KITH_MYCMS      TAEFVTKLRARCH-LCGNFANRSQKIVNGQPALWDSPLILVDG------KESYEARCRNC
KITH_MESFL      LAEMVDKLTAICQ-KCGNFANRTQRIIDGKPADWNSPLILVDG------NDSYEARCRNC
KITH_PYRAE      FADRVISLSAVCK-LCGKPATRTQRLINGVPAPRHSPRILIGG------NESYEARCRRH
KITH_THEKO      RADNIVYLTAVCT-VCGKPATRSQRLIDGKPAPRNSPVILVGG------RESYEARCREH
KITH_AYWBP      IADTVTKLTSICA-ISGGKANRTQRLIEGKPAQSNEPVVLVGG------KEYHEPRCRKH
KITH_ONYPE      IADTVTKLTSICA-ISGKKANRTQRLIDGKPAQSNEPVVLVGG------KEYHEPRCRKH
KITH_UREPA      YADKITKLTAICN-ECGAEATHSLRKIDGKHADYNDDIVKIGC------QEFYSAVCRHH
KITH_UREP2      YADKITKLTAICN-ECGAEATHSLRKIDGKHADYNDDIVKIGC------QEFYSAVCRHH
KITH_UREU1      YADKITKLTAICN-ECGAEATHSLRKIDGKYANYDDEIVKIGC------QEFYSAVCRHH
KITH_MYCPE      IAEYVEKLSAICT-DCGAPGTATQRIINDKPSNYDEPVVQIGN------YETYTVKCRHH
KITH_MYCGA      IAESVIRLTAICS-ECGAEASRSQRLIDNQPADYNCETILIGD------TESYAPRCRHH
KITH_MYCGE      IADVVNKLDAICN-VCGSLAQRTQRLVNKNT---NDNLVLIGD------AEAYEARCKLH
KITH_MYCPN      IADKICKLDAVCN-VCGQLAQRTQRIVSK-----SNETVLIGD------IEAYEPRCKLH
KITH_MYCH2      IAENVTKLQAVCS-LCKRAATTTARKVLN------EAQTLIGD------QDEYEARCRAC
KITH_MYCH7      IAENVTKLQAVCS-LCKRAATTTARKVLN------EAQTLIGD------QDEYEARCRAC
KITH_MYCHJ      IAENVTKLQAVCS-LCKRAATTTARKVLN------EAQTLIGD------QDEYEARCRAC
KITH_MYCMO      IADDVLKLKAVCF-SCKNAGTHTFRITND------KDQKLLGD------TESYQARCRKC
KITH_MYCA5      IAERVTKLQAICV-KCQHAASTSFRKVAA------SEINLLGD------FQEYEARCRKC
KITH_THEMA      LADTVIKKKAVCH-RCGEYNATLTLKVAG-----GEEEIDVGG------QEKYIAVCRDC
KITH_THESQ      LADTVIKKKAVCH-RCGEYNATLTLKVAG-----GEEEIDVGG------QEKYIAVCRDC
KITH_THEP1      LADTVIKKKAVCH-RCGEYNATLTLKVAG-----GEEEIDVGG------QEKYIAVCRDC
KITH_PSELT      LANEIIKKKAVCH-ICGEYNATLTYKFVQ-----DDSEIDIGG------KEKYIAVCRDC
KITH_RHIEC      IADEMREVRTIC--HCGRKATMVVRLDAQGKVLHEGAQIDVGG------NEKYVSLCRRH
KITH_RHIME      IADELREVRTIC--HCGRKATMVVRLDGRGKVMREGAQVDVGG------NEKYVSYCRRH
KITH_AGRFC      IADELREIRTIC--HCGRKATMVARFDSEGKVVTEGAQIEVGG------NGKYVSFCRRH
KITH_RHILO      IADDLREVRTIC--RCGRKATMVVRLGADGKVARQGEQVAIG-------KDVYVSLCRRH
KITH_JANSC      LADEMREVRTIC--HCGRKATMVIRVGEDGNALAEGAQIEVGG------NDRYISLCRKH
KITH_RUEPO      LADEMREVRTIC--KCGRKATMVIRQDASGRAITEGAQVQIGG------NETYVSLCRKH
KITH_IDILO      IADKLVEMKTIC--HCGRKATMSLRVDEQGNAIRMGQQIAIGG------NDRYVSCCRKH
KITH_NOVAD      IADSLIELKAVC--HCGRKATMNLRVDDSGAAVRAGRQTEIGG------NDRYVALCRRH
KITH_ZYMMO      IADKLAEIKSVC--FCGAKATMNLRVDENKKPIRHGQQTEIGG------NERYIALCRRH
KITH_XANAC      WADELEEIKTIC--HSGSKATMTVRVDAHGHAVQDGPQVEIGG------NERYVSVSRAE
KITH_XANC5      WADELEEIKTIC--HSGSKATMTVRVDAHGHAVQDGPQVEIGG------NERYVSVSRAE
KITH_XANOR      WADELEEIKTIC--HSGSKATMTVRVDAQGHAVQDGPQVEIGG------NERYVSVSRAE
KITH_XANOM      WADELEEIKTIC--HSGSKATMTVRVDAQGHAVQDGPQVEIGG------NERYVSVSRAE
KITH_XANCP      WADELEEIKTIC--HSGSKATMTVRVDAQGHAVQDGPQVEIGG------NERYVSVSRAE
KITH_XANC8      WADELEEIKTIC--HSGSKATMTVRVDAQGHAVQDGPQVEIGG------NERYVSVSRAE
KITH_BLOFL      WADKLIELKTIC--YCGRQANRVLRIDNNGCVIRAGSQIMFGD------NNQYVSVCRKH
KITH_BLOPB      WADKLIELKTIC--YCGRKANRVLRIDDQGLIIRDGNQILVGG------NNRYVSVCRKH
KITH_YERPE      WADKLVELKTIC--HCGRKANMVLRLDEQGRAVHNGEQVVIGG------NESYVSVCRRH
KITH_YERPS      WADKLVELKTIC--HCGRKANMVLRLDEQGRAVHNGEQVVIGG------NESYVSVCRRH
KITH_PECAS      WADKLIELKTVC--HCGRKANCVLRLDAQGNAVHEGEQVVIGG------NESYVSVCRKH
KITH_ECO57      WSDKLVELKTIC--FCGRKASMVLRLDQAGRPYNEGEQVVIGG------NERYVSVCRKH
KITH_SHIFL      WSDKLVELKTIC--FCGRKASMVLRLDQAGRPYNEGEQVVIGG------NERYVSVCRKH
KITH_SHISS      WSDKLVELKTIC--FCGRKASMVLRLDQAGRPYNEGEQVVIGG------NERYVSVCRKH
KITH_SHIBS      WSDKLVELKTIC--FCGRKASMVLRLDQAGRPYNEGEQVVIGG------NERYVSVCRKH
KITH_ECOLI      WSDKLVELKTIC--FCGRKASMVLRLDQAGRPYNEGEQVVIGG------NERYVSVCRKH
KITH_ECOL6      WSDKLVELKTIC--FCGRKASMVLRLDQAGRPYNEGEQVVIGG------NERYVSVCRKH
KITH_SHIDS      WSDKLVELKTIC--FCGRKASMVLRLDQAGRPYNEGEQVVIGG------NERYVSVCRKH
KITH_SALPA      WSDKLVELKTIC--FCGRKASMVLRLDQDGRPYNEGEQVVIGG------NERYVSVCRKH
KITH_SALTI      WSDKLVELKTIC--FCGRKASMVLRLDQDGRPYNEGEQVVIGG------NERYVSVCRKH
KITH_SALTY      WSDKLVELKTIC--FCGRKASMVLRLDQDGRPYNEGEQVVIGG------NERYVSVCRKH
KITH_SALCH      WSDKLVELKTIC--FCGRKASMVLRLDQDGRPYNEGEQVVIGG------NERYVSVCRKH
KITH_PHOLL      WADKLVELKTIC--YCGRKANRVLRFDSEGAAIYDGEQVDIGG------NEKYVSVCRKH
KITH_SHEON      WADKLVELKTIC--HCGRKANMVVRLDGEGKVMREGEQVAIGG------NESYESVCRKH
KITH_VIBVU      WADKLVELKTIC--HCGRKANMVIRTDEHGKAIKEGDQVAIGG------NDRYVSVCRQH
KITH_VIBVY      WADKLVELKTIC--HCGRKANMVIRTDEHGNAIKEGDQVAIGG------NDRYVSVCRQH
KITH_VIBPA      WADKLVELKTIC--HCGRKANMVIRTDEHGVAIKEGDQVAIGG------NDRYVSVCRQH
KITH_VIBCH      WADKLIELKTIC--HCGRKANMVIRTDEHGNAISEGDQVAIGG------NDKYVSVCRQH
KITH_ALIF1      WADKLVELKTIC--HCGRKANMVIRTDEHGVAIADGDQVAIGG------NELYVSVCRRH
KITH_PHOPR      WADKLVELKTIC--HCGRKANMVIRQDEAGHAIADGDQVEIGG------NDRYVSVCRKH
KITH_PSEHT      WADKLVELKTVC--HCGRKANHVLRTDENGDAIADGNQVEIGG------NNRYESVCRKH
KITH_HAEIN      WADQLEELKTIC--YCGRKANFVLRLNDQGEVIKEGAQIQIGG------NDSYLSVCRLH
KITH_HAEI8      WADQLEELKTIC--YCGRKANFVLRLNDQGEVIKEGAQIQIGG------NDSYLSVCRLH
KITH_PASMU      WADQLEELKTIC--YCGRKANFVLRLNDKGEVVRDGAQIQIGG------NDSYLSVCRLH
KITH_MANSM      WADQLEELKTIC--HCGRKANFVLRLNERGDVVKDGEQIQIGG------NERYLSVCRFH
KITH_HAEDU      WADELQELKTIC--ECGKKAHFVIRLNENGETVTTGEQIQIGG------NDKYISVCRYH
KITH_RHOBA      WADTLTELKTIC--HCGRKATMVLRVSESGQVIRDGEQVQIGG------NERYQTVCRLH
KITH_COLP3      WADKLVELKTIC--HCGRKANFVIRQDANGKAVQNGEQVEVGG------NERYEPLCRAH
KITH_LEGPA      WADELIELKTIC--HCGRKAIMNMRIDENGQAVIEGEQVLIGG------NESYVATCRLH
KITH_LEGPH      WADELIELKTIC--HCGRKAIMNMRIDENGQAVVEGEQVLIGG------NESYVATCRLH
KITH_LEGPL      WADELIELKTIC--HCGRKATMNMRIDENGQAVVEGEQVLIGG------NESYVATCRLH
KITH_COXBU      WADLLIEIKTIC--HCGRKATMNLRIDDEGNPIREGEQIRLGG------NDRYTATCRKH
KITH_CHRVO      LADDVEEIKTIC--HCGRKATMHIRIDGDGRRVKEGPQVEIGG------EARYRAVCGRC
KITH_RHOFT      LADEFEEVRAVC--GCGKKATMNARLDATGARVSAGEQTLIGG------NERYIAMCPRC
KITH_FRATH      IADTLEEVKTIC--HCGKKASFNMMVQ-NGKAIKQGNPIVVDDDSLKEIDTKYVSVCRKH
KITH_FRATT      IADTLEEVKTIC--HCGKKASFNMMVQ-NGKAIKQGNPIVVDDDSLKEIDTKYVSVCRKH
KITH_LISMO      YADKLEEMKTICW-FCAKKATMVLRVDDKGKPVYTGEQIMIGG------NDHYYPVCRKC
KITH_LISMF      YADKLEEMKTICW-FCAKKATMVLRVDDKGKPVYTGEQIMIGG------NDHYYPVCRKC
KITH_LISIN      YADKLEEMKTICW-FCAKKATMVLRVDDKGKPVYTGEQIMIGG------NDHYYPVCRKC
KITH_BACSK      YADKIEEMKTICW-FCHKKAIMNLRVDEQGKPIYDGEQIQIGG------NETYYPVCRKC
KITH_LACPL      YADKIEEMKTICW-FCRKKAIMNLRFHD-GQPVYEGEQVQIGG------NEAYYPVCRHH
KITH_LACSS      FANKIEEMKTICW-FCRKKAIMNLRMNN-GLPVYTGEQIQIGG------NEAYYPVCRKH
KITH_ENTFA      YADKLEELKTICW-FCHKKATMNLHYID-GNPVYEGDQVQIGG------NEAYYPVCRKH
KITH_STRA1      LADKIDEIKTICQ-YCSKKATMVLRTEN-GKPVYEGDQIQIGG------NETYIPVCRKH
KITH_STRA3      LADKIDEIKTICQ-YCSKKATMVLRTEN-GKPVYEGDQIQIGG------NETYIPVCRKH
KITH_STRA5      LADKIDEIKTICQ-YCSKKATMVLRTEN-GKPVYEGDQIQIGG------NETYIPVCRKH
KITH_STRP8      LADKIDEIKTICQ-YCSKKATMVLRTEN-GKPVYEGDQIQIGG------NETYIPVCRKH
KITH_STRPM      LADKIDEIKTICQ-YCSKKATMVLRTEN-GKPVYEGDQIQIGG------NETYIPVCRKH
KITH_STRP6      LADKIDEIKTICQ-YCSKKATMVLRTEN-GKPVYEGDQIQIGG------NETYIPVCRKH
KITH_STRP3      LADKIDEIKTICQ-YCSKKATMVLRIEN-GKPVYEGDQIQIGG------NETYIPVCRKH
KITH_STRP1      LADKIDEIKTICQ-YCSKKATMVLRTEN-GKPVYEGDQIQIGG------NETYIPVCRKH
KITH_STRMU      LADKIEEIKTICQ-FCSKKATMVLRTEN-GRPVYKGNQIQIGG------NETYIPVCRRH
KITH_STRPN      LADKIDEIKTICQ-YCKKKATMVLRTQD-GLPVYDGEQIQIGG------NETYISVCRKH
KITH_STRR6      LADKIDEIKTICQ-YCKKKATMVLRTQD-GLPVYDGEQIQIGG------NETYISVCRKH
KITH_STRGC      LADKIEEIKTICQ-YCSRKATMVLRTDH-GKPVYDGEQIQIGG------NETYIPVCRKH
KITH_LACLA      LADKIEEIKTICW-YCSKKATMVIRTID-GKPVYEGEQLQIGG------NETYIPVCRKH
KITH_STRT2      LSDKIEEIKTICH-YCSRKATMVLRMED-GEPVYEGVQVQIGG------HESYISVCRKH
KITH_STRT1      LSDKIEEIKTICH-YCSRKATMVLRMED-GEPVYEGVQVQIGG------HESYISVCRKH
KITH_LACAC      FADKIEEMKTICH-YCGHKATMNLRINN-GKPVYEGEQVQIGG------DESYYPVCRYH
KITH_LACJO      FADKVEEMKTICH-YCGHKATMNLRINS-GKPVYEGEQVQIGG------DESYYPVCRFH
KITH_STRAW      LADRIETLQVEAMCWCGARATHNARTVG-GEMVVEGEQVVVGDVNRPAAEVGYEVLCRRH
KITH_STRCO      LADRVEVLQVEALCWCGARATHNARTVG-GVMVVEGAQVVVGDVAQSPDEIGYEVLCRRH
KITH_CUTAK      LADRVVEPPVSPLCWCGRPATHNARIVD-GKLVREGDQVGVGDIG-GGSEIHYEVLCRRH
                 :: .          .                        ..          :       

KITH_BACAH      HAVP-----------------------TNKDK-------------------------
KITH_BACHK      HAVP-----------------------TNKDK-------------------------
KITH_BACC7      HAVP-----------------------TNKDK-------------------------
KITH_BACCQ      HAVP-----------------------TNKDK-------------------------
KITH_BACC1      HAVP-----------------------TNKDK-------------------------
KITH_BACC3      HVVP-----------------------TNKDK-------------------------
KITH_BACC2      HAVP-----------------------TNKDK-------------------------
KITH_BACCR      HAVP-----------------------ANKDK-------------------------
KITH_BACC4      HAVP-----------------------ANKDK-------------------------
KITH_BACCZ      HAVP-----------------------TNKDK-------------------------
KITH_BACC0      HAVP-----------------------TKQR--------------------------
KITH_BACAN      HAVP-----------------------TKQR--------------------------
KITH_BACAA      HAVP-----------------------TKQR--------------------------
KITH_BACAC      HAVP-----------------------TKQR--------------------------
KITH_BACWK      HAVP-----------------------TKQR--------------------------
KITH_BACCN      HAVP-----------------------TKQR--------------------------
KITH_BACVZ      HEVP-----------------------KKTD--------------------------
KITH_BACSU      HEVP-----------------------GKSKK-------------------------
KITH_BACLD      HEVP-----------------------GNPK--------------------------
KITH_BACP2      HEVP-----------------------RLDVGTTLDN--------------------
KITH_GEOKA      HEVP-----------------------GKPKKRYNHPLAGHTGE-------------
KITH_GEOTN      HEVP-----------------------GKPKKQHDHPFAERASE-------------
KITH_GEOSW      HEVP-----------------------DKPTK--NGQTNNHLAR-------------
KITH_ANOFW      HEVP-----------------------DHPAKKKTSTETATRP--------------
KITH_STAAB      HIVA-----------------------PSDNNKEEL---------------------
KITH_STAAW      HIVA-----------------------PSDNNKEEL---------------------
KITH_STAAC      HIVA-----------------------PSDNNKEEL---------------------
KITH_STAAR      HIVA-----------------------PSDNNKEEL---------------------
KITH_STAAS      HIVA-----------------------PSDNNKEEL---------------------
KITH_STAA3      HIVA-----------------------PSDNNKEEL---------------------
KITH_STAAM      HIVA-----------------------PSDNNKEEL---------------------
KITH_STAAN      HIVA-----------------------PSDNNKEEL---------------------
KITH_STAES      HIVA-----------------------PSENEKEEM---------------------
KITH_STAEQ      HIVA-----------------------PSENEKEEM---------------------
KITH_STAHJ      HIVA-----------------------PSTSDEEEM---------------------
KITH_STAS1      HIVA-----------------------PSNTEKEEM---------------------
KITH_MACCJ      HVVP-----------------------K-----------------------------
KITH_BACHD      HQVT-----------------------NKPSKLPETASSGE----------------
KITH_OCEIH      HEVP-----------------------FRPENNFATKSWDALKS-------------
KITH_CLOB6      HCVP-----------------------R-----------------------------
KITH_CLOBJ      HCVP-----------------------R-----------------------------
KITH_CLOB1      HRVP-----------------------R-----------------------------
KITH_CLOBK      HRVP-----------------------R-----------------------------
KITH_CLOBH      HRVP-----------------------R-----------------------------
KITH_CLOBL      HRVP-----------------------R-----------------------------
KITH_CLOBM      HRVP-----------------------K-----------------------------
KITH_CLOAB      HVVP-----------------------QKKEV-------------------------
KITH_CLOTE      HIVP-----------------------KE----------------------------
KITH_THEP3      HEVP-----------------------RT----------------------------
KITH_THEPX      HEVP-----------------------RT----------------------------
KITH_CALS4      HEVP-----------------------RT----------------------------
KITH_DICT6      HIVL-----------------------RRDENEK-----------------------
KITH_DICTD      HVVL-----------------------RREEDEK-----------------------
KITH_BACFR      YQR------------------------ALQ----EDREKS-----------------
KITH_BACFN      YQR------------------------ALQ----EDREKS-----------------
KITH_BACTN      YLR------------------------ARG----EDGQKI-----------------
KITH_BACV8      YME------------------------ALK----EETENK-----------------
KITH_PORGI      YRK------------------------CSSPPQTEEIHSTI----------------
KITH_PORG3      YRK------------------------CSSPPQTEEIHSTI----------------
KITH_RHOSI      FQP-------PRP------------TSTSSLKAPAPAATAPRPELP-----------
KITH_SALRD      FEPEPVTVTRPRPHTEALRAVATDDADASTNEADPEAADAASADGTAA---------
KITH_BDEBA      FKPE---------------------VDAPTLDWKLKREMEIS---------------
KITH_CHLSY      YEPA-----------------------V-----------------------------
KITH_CHLAA      YEPA-----------------------V-----------------------------
KITH_CHLAD      YEPA-----------------------L-----------------------------
KITH_ROSCS      YEPA-----------------------R-----------------------------
KITH_ROSS1      YEPA-----------------------Q-----------------------------
KITH_HALSA      HVVR-----------------------RE----------------------------
KITH_HALS3      HVVR-----------------------RE----------------------------
KITH_HALWD      HILR-----------------------HE----------------------------
KITH_COPPD      HEVP-----------------------GKTLTLFKE---------------------
KITH_DEIDV      HVVT-----------------------R-----------------------------
KITH_DEIRA      HRAQ-----------------------GGVTTPSPLAS-------------------
KITH_MYCCT      FISP-----------------------KKDV--------------------------
KITH_MYCMS      FIVP-----------------------KKEV--------------------------
KITH_MESFL      YQIE-----------------------KG----------------------------
KITH_PYRAE      YVIP-----------------------P-----------------------------
KITH_THEKO      HLVP-----------------------DE----------------------------
KITH_AYWBP      HCLA---------------------DIDKTKVNWKNFANQSK---------------
KITH_ONYPE      HCLA---------------------DIDKTKINWQNFTNQSK---------------
KITH_UREPA      HKVP-----------------------NRPYLNSNSEEFIKFFKNKKRNKNI-----
KITH_UREP2      HKVP-----------------------NRPYLNSNSEEFIKFFKNKKRNKNI-----
KITH_UREU1      HKVP-----------------------NRPYLNANSEEFIRFFKNKKRNKNV-----
KITH_MYCPE      HKIP-----------------------GKPFPE-EIKKFKSDLRNLLKNKENK----
KITH_MYCGA      HKVP-----------------------NRPIND-QTKNFKRALKNNFDKIVEQSSKD
KITH_MYCGE      HSFL-----------------------TKKHVTVKTKNFKEQVQGKTQ---------
KITH_MYCPN      QPSA-----------------------G-----------------------------
KITH_MYCH2      HSL------------------------------------------------------
KITH_MYCH7      HSL------------------------------------------------------
KITH_MYCHJ      HSL------------------------------------------------------
KITH_MYCMO      HLEG-----------------------EEQKIQMDNLKLNLSL--------------
KITH_MYCA5      HNAG-----------------------QKEKLQKKV---------------------
KITH_THEMA      YNTL-----------------------KKRV--------------------------
KITH_THESQ      YNTL-----------------------KKRV--------------------------
KITH_THEP1      YNTL-----------------------KKRV--------------------------
KITH_PSELT      YNKV-----------------------ASKND-------------------------
KITH_RHIEC      WDDEMNGAWIAEPV-------------------------------------------
KITH_RHIME      WDDRMREG-------------------------------------------------
KITH_AGRFC      WVETFNCS-------------------------------------------------
KITH_RHILO      WEEEMGRAAPDDFIGFMKS--------------------------------------
KITH_JANSC      FREAVGDVPV-----------------------------------------------
KITH_RUEPO      WREATGDPGAKGH--------------------------------------------
KITH_IDILO      WKEAMGLR-------------------------------------------------
KITH_NOVAD      FSEAMGQ--------------------------------------------------
KITH_ZYMMO      FIEKLNSL-------------------------------------------------
KITH_XANAC      FKKIMRGEGRIDPLQIALPLPVA----------------------------------
KITH_XANC5      FKKIMRGEGRIDPLQIALPLPVA----------------------------------
KITH_XANOR      FKKIMRGEGRIDPLQIALPLPVA----------------------------------
KITH_XANOM      FKKIMRGEGRIDPLQIALPLPVA----------------------------------
KITH_XANCP      FKKIMRGEGRIDPLQIALPLPPA----------------------------------
KITH_XANC8      FKKIMRGEGRIDPLQIALPLPPA----------------------------------
KITH_BLOFL      FHKKYN---------------------------------------------------
KITH_BLOPB      FVEQLESPLSLTKRVYKNR--------------------------------------
KITH_YERPE      YKEAIKAACCS----------------------------------------------
KITH_YERPS      YKEAIKAACCS----------------------------------------------
KITH_PECAS      YKIALGLTRKESV--------------------------------------------
KITH_ECO57      YKEALQVGSLTAIQERHRHD-------------------------------------
KITH_SHIFL      YKEALQVGSLTAIQERHRHD-------------------------------------
KITH_SHISS      YKEALQVGSLTAIQERHRHD-------------------------------------
KITH_SHIBS      YKEALQVGSLTAIQERHRHD-------------------------------------
KITH_ECOLI      YKEALQVDSLTAIQERHRHD-------------------------------------
KITH_ECOL6      YKEALEVGSLTAIQERHRHD-------------------------------------
KITH_SHIDS      YKEALEVGSLTAIQERHRHD-------------------------------------
KITH_SALPA      YKDALEEGSLTAIQERHRHI-------------------------------------
KITH_SALTI      YKDALEEGSLTAIQERHRHI-------------------------------------
KITH_SALTY      YKDALEEGSLTAIQERHRHI-------------------------------------
KITH_SALCH      YKDALEEGSLTAIQERHRHI-------------------------------------
KITH_PHOLL      YMEAINEARKNRKDSV-----------------------------------------
KITH_SHEON      FREFIWD--------------------------------------------------
KITH_VIBVU      YKEALGK--------------------------------------------------
KITH_VIBVY      YKEALGK--------------------------------------------------
KITH_VIBPA      YKEALGK--------------------------------------------------
KITH_VIBCH      YKEALGR--------------------------------------------------
KITH_ALIF1      YKEALGK--------------------------------------------------
KITH_PHOPR      YKEALGR--------------------------------------------------
KITH_PSEHT      YKAALNMGR------------------------------------------------
KITH_HAEIN      YKEKCGQI-------------------------------------------------
KITH_HAEI8      YKEKCGQI-------------------------------------------------
KITH_PASMU      YKEKIAL--------------------------------------------------
KITH_MANSM      FKQKTGKLHN-----------------------------------------------
KITH_HAEDU      YKKKRGELRQITK--------------------------------------------
KITH_RHOBA      FKEAIYQRAEDELPLLDSNEPRQSER-------------------------------
KITH_COLP3      FKQLVWL--------------------------------------------------
KITH_LEGPA      YKRGEAGKTFPRNKLFNKDTNTF----------------------------------
KITH_LEGPH      YKRGEAEVTFPRNKLFNKDTNAF----------------------------------
KITH_LEGPL      YKRGEAGKTFPGNKLFNKDTNTF----------------------------------
KITH_COXBU      FRLGQPTQTK-----------------------------------------------
KITH_CHRVO      FHHD-----------------------------------------------------
KITH_RHOFT      FYLDSAGEQDAQSTAA-----------------------------------------
KITH_FRATH      WKEGVYE--------------------------------------------------
KITH_FRATT      WKEGVYE--------------------------------------------------
KITH_LISMO      HANPPIK--------------------------------------------------
KITH_LISMF      HANPPIK--------------------------------------------------
KITH_LISIN      HANPPIK--------------------------------------------------
KITH_BACSK      HQHPPLTV-------------------------------------------------
KITH_LACPL      YFYPPKLTK------------------------------------------------
KITH_LACSS      YFNPPIQEEIEKEG-------------------------------------------
KITH_ENTFA      YFHPKTVNEEQ----------------------------------------------
KITH_STRA1      YFNPDI---------------------------------------------------
KITH_STRA3      YFNPDI---------------------------------------------------
KITH_STRA5      YFNPDI---------------------------------------------------
KITH_STRP8      YFNPEI---------------------------------------------------
KITH_STRPM      YFNPEI---------------------------------------------------
KITH_STRP6      YFNPEI---------------------------------------------------
KITH_STRP3      YFNPEI---------------------------------------------------
KITH_STRP1      YFNPDI---------------------------------------------------
KITH_STRMU      YFHPPIKA-------------------------------------------------
KITH_STRPN      YFAPMITSNKEQNYDN-----------------------------------------
KITH_STRR6      YFAPMITSNKEQNYDN-----------------------------------------
KITH_STRGC      YFKPDINN-------------------------------------------------
KITH_LACLA      YFKPEI---------------------------------------------------
KITH_STRT2      WFNPPRERIVPLKQN------------------------------------------
KITH_STRT1      WFNPPRERIVPLK--------------------------------------------
KITH_LACAC      YFHPNVVR-------------------------------------------------
KITH_LACJO      YFHPNKQR-------------------------------------------------
KITH_STRAW      HRRRMTSASAYAAAISPDVLPVTSA--------------------------------
KITH_STRCO      HRRRMTSATARAAALSPDVLPVTAT--------------------------------
KITH_CUTAK      HRQGITGEISRAT-LSEQTLPFDGSRS------------------------------