CLUSTAL format seed alignment for MF_00125

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

HISZ_NOSS1      -----------------------MVYQPAAGARDLLPLDVAQKRWIEDKLQQVFHRWGYH
HISZ_SYNY3      -----------------------MIHHPPAGARDLLPLEVAQKARINDQLQQTFHRWGYQ
HISZ_THEEB      -----------------------MVYQPACGARDILPLDVARQRWLEQRLERVFQSWGYQ
HISZ_GLOVI      ------------------------MYQPPTGVRDLLPLDVSQKLWIEQRLQRVFTRWGYQ
HISZ_PROMM      -----------------------MALQPAAGARDLNPQQVELNQKLSQRLAEVYRLWGYD
HISZ_SYNPX      -----------------------MALQPAAGARDLNPRQVESNRALSERLASVFRLWGYD
HISZ_PROMA      -----------------------MPIQPAFGNKDLNPQEVRKNQLISSRLSSIYERWGYE
HISZ_BORBR      ----------------------MGNWLLPEGLADVLPAEARRIEELRRELLDLYRTYGFE
HISZ_BORPA      ----------------------MGNWLLPEGLADVLPAEARRIEELRRELLDLYRTYGFE
HISZ_BORPE      ----------------------MGNWLLPEGLADVLPAEARRIEELRRELLDLYRTYGFE
HISZ_RALSO      ----------------------MPNWLLPESIADVLPSEARKIEELRRRMLDLFRTYGYE
HISZ_NITEU      ----------------------MRNWLLPEYIEDVLPRDAYRIEKIRRLIMDMLFAHGYQ
HISZ_NEIMA      ----------------------MQTWQLPEHIADVLPTNARQLESAREQLLALFRVHGYE
HISZ_NEIMB      ----------------------MQTWQLPEHIADVLPTNARQLESAREQLLALFRVHGYE
HISZ_CHRVO      ----------------------MRNWLLPEYIADILPATARQVESAKAAMLEGFRVAGYE
HISZ_PSEPK      -------------------MATVDRWLLPDGIEEVLPPEAARIEIARRQVLDLFQSWGYE
HISZ_PSESM      -------------------MATVDRWLLPDGIEEVLPPEAARIEVARRQVLDLFQSWGYE
HISZ_PSEAE      -------------------MATVDRWLLPDGIEEVLPPEAARIEAARRQVLDLFHRWGYE
HISZ_BACAN      --------------------MTKWKRANPNGTRDYLFEECTLIEEVEQKLRRTFLERGYE
HISZ_BACCR      --------------------MTKWKRANPNGTRDYLFEECTLIEEVEQKLRLTFLERGYE
HISZ_CLOAB      --------------------MINLKKYIPEGSRDILFEECTIKNNIENILRNSYINVGYE
HISZ_CALS4      ------------------------MIYLPDGVQDFLPEEYEFKRNIEDKFREVFKSFGYK
HISZ_BACHD      -------------------MSKPFMFEKPFGMRDTLPEWYKTKKNICDQMTEEINLWGYD
HISZ_BACSU      ----------------------MFMFEKPHGMRDTLPGLYETKKKVRRSLTDLIDKWGYQ
HISZ_LISIN      ---------------------MNLNKNLPTGTRDKLFREARASYQIEQQVNHYFAKRGFK
HISZ_LISMO      ---------------------MNLNKNLPTGTRDKLFREARAAYKIEQQVNHYFEKRGFK
HISZ_STRMU      ----------------------MKKTSLPVGMHDKLFKRARVMYEIERDISNLLIKQGFN
HISZ_AGRFC      -------------------------------------MPLIDMPEFAGELLEEFAARRTS
HISZ_RHIME      -------------------------------------MPLINLPAFAGDLLADFERRNTL
HISZ_RHILO      --------------------------------------MTSRFPAIAANITKLFAARNTH
HISZ_BRUME      -----------------------------------MTMVGSRTSPIFNALRVELNAREAE
HISZ_LACPL      ----------------------MLKHLLPLGTRDEFGRRARTKQHLIAVIQAHFKQRGLA
HISZ_GEOSL      -----------------MTPITPIEAPLPKGVTDFLPEKADKIGYIEGKIRKVFELWGFR
HISZ_OCEIH      ------------------------MINYNFRNRTSFPEDFLKKANVIKQIQNRFYTYGYD
HISZ_DEIRA      MRRVSVSDPLPFSAPLAAGGEALSTSALPAGVRDVLPAEWERREHLRSHLSALLRSWGYR
HISZ_LACLA      --------------------MEKINYLLPEESAEMTLNQVKSLRQIEGRLRKLFSLKNYQ
HISZ_AQUAE      -----------------------MKTSLISGERFYSLEESNLVKEIFKKAVKIFEAFGYD
HISZ_STAAM      ---------------------------------MNNSEQLIALKESETAFLKYFNKADYE
HISZ_THEMA      --------------------------------------MDFLDFEKVFSFYSKATKKGFS
                                                                            

HISZ_NOSS1      RIITSTLERMDTLMA----GEAIQRQMVIQLQNSEDEELGLRPELTASIARAVVTRMANL
HISZ_SYNY3      RIVTSTLEWLDTLVA----GGAISANNVIQLQDSGEGRLGLRPELTASIARAVVTRMTD-
HISZ_THEEB      EIITPTIETLATLTA----GGTVHPETVIQVQGSGDEPLGLRPELTASIARAAVTRMAGM
HISZ_GLOVI      RIITPTLERMETLQA----SGSVDLQAILQLRDAEGVSLGLRPDPTPSLARAVATRLADA
HISZ_PROMM      EVSPPRVERLETLKA----GGAIASQDIVRL--VADEPLGLRPEMTASIARAACTRLKQR
HISZ_SYNPX      EVSPPRVERLDTLMA----GGAIASEDVVRL--VADEPLGLRPEMTASIARAACTRLASR
HISZ_PROMA      EVSPPKVERLETLTA----CGGISNKEIVKL--VADDPIGLRPDMTASIARAASTRLAYK
HISZ_BORBR      LVAPPLVEYIDSLLSST--GSDLNLRTCKLVDQLSGRTLGVRADMTSQVTRIDAHLLN-R
HISZ_BORPA      LVAPPLVEYIDSLLSST--GSDLNLRTCKLVDQLSGRTLGVRADMTSQVTRIDAHLLN-R
HISZ_BORPE      LVAPPLVEYIDSLLSST--GSDLNLRTCKLVDQLSGRTLGVRADMTSQVTRIDAHLLN-R
HISZ_RALSO      LVMPPMLEYIESLLSGT--GHDLDLKTFKLVDQLSGRTIGLRADITPQVARIDAHLLN-R
HISZ_NITEU      FVMPPLLEYVESLLAGS--GSGMNLRMFKVVDQLSGRMMGLRADMTPQAARIDAHLLN-I
HISZ_NEIMA      LVQPPLMEYAHSLLTHI--DAGLSLKTILVTDRLSGRQLGIRADITPQVARIDAHLLSAN
HISZ_NEIMB      LVQPPLMEYAHSLLTHI--DAGLSLKTILVTDRLSGRQLGIRADITPQVARIDAHLLSAN
HISZ_CHRVO      LVLPPLIEYIDSLVSEG--DDTLDLKTFKLDDQLSGRQLGLRADITPQVARIDAHLLGER
HISZ_PSEPK      LVVTPHIEYLESLLTGA--GQDLDQRTFKVVDPQSGRLMGFRADFTPQVARIDAHTLR-R
HISZ_PSESM      FVVTPHIEYLESLLTGA--GSDLDLRTFKVIDPQSGRQMGFRADITPQVARIDAHTLK-R
HISZ_PSEAE      FVVTPHIEYLESLLTGA--GQDLDLRTFKVTDPASGRLMGFRADITPQVARMDAHSLR-R
HISZ_BACAN      EIRTPTIEFYDVFAFQS--RPIDEEKMYKFFD-EKGRIIVLRPDMTIPLARVVGTQRCDT
HISZ_BACCR      EIRTPTIEFYDVFAFQN--RPIDEEKMYKFFD-EKGRIIVLRPDMTIPLARVIGTQRWDT
HISZ_CLOAB      EVRSPTLEFYDVYNLEN--QPISQEKMYKLFD-NTGRILVLRPDMTTPIARICATKLKNR
HISZ_CALS4      EIMPPTFEYSENFSHLF--D---ENSMYRFFD-KKGNILALRPDVTAQIARIVSTKLEGR
HISZ_BACHD      MIETPTLEYYETVGVVS--AIL-DQQLFKLLD-QQGNTLVLRPDMTAPIARLVASSLKDR
HISZ_BACSU      FMETPTLEFYDTVGVQS--AIE-EQQLFKLLD-QDGKTLVLRPDMTGPIARVAASKLLKH
HISZ_LISIN      RIETPVIEFEDVFSSEH--Q--ADAKLYRFFD-EKGRLTVLRPDMTLPIGRVVSTTGVTL
HISZ_LISMO      RIETPVIEFEDVFSSEH--Q--ADAKLYRFFD-EKGRLTVLRPDMTLPIGRVVSTTGVML
HISZ_STRMU      RIETPTLEHFEVFADD------VSSEHYHLFD-KKGNLLSLRPDITSQIGRVIASTRVET
HISZ_AGRFC      RVNTPVIQPAEPFLDMA--GEDLRRRIFMTES-ETGESLCLRPEFTIPVCLRHIETATGT
HISZ_RHIME      RVDTPVIQPAEPFLDMA--GEDLRRRIFMTES-ETGESLCLRPEFTIPVCLRHIETATGT
HISZ_RHILO      AVEVAILQPADPFLDMA--GEDLRRRIFLTES-ETGQTLCLRPEFTIPVCLDHISSQAGT
HISZ_BRUME      LVEIPLIQPADPFLDMA--GEDLRRRIFLTEN-ENGDSLCLRPEFTIPVCRNHIALNAAT
HISZ_LACPL      PIATPLLENEAVFDPYQ--MGNYQLYRLFGND---GRTLVLRPDMTLPVARFISATNVPL
HISZ_GEOSL      RIITPLLEFEDVIAAGL--GDDLKAKTFRFDDRQSGKLIAVPSDITPQIARIVATRLRGY
HISZ_OCEIH      QIETPLFEDYDMYSNVQ--GTVQQDDMVKVIH-SSGRVLVLRPDVTIPITRQYVETDMTS
HISZ_DEIRA      GVDLPALELADPAHPQ-------GNHAFKLID-SGGQVLALRSEYTTALGRLVGTHFPSG
HISZ_LACLA      EVMPPSFEYTQLYTALESNGKTFNQEKMFQFIKHEGQSITLRYDFTLPLVRLYSQIKDST
HISZ_AQUAE      YINLSHFEPYEFQELTFG---EGSKEAITFKDSYTKESFGLRLDFTTQVVRTISHLRNVK
HISZ_STAAM      LVDFSVVEKLDWKQLNH---EDLQQMGERNFWQHEHQIYALRNDFTDQLLRYYSMYPTAA
HISZ_THEMA      PFFVPALEKAEEPAGNF-------------FLDRKGNLFSIREDFTKTVLNHRKRYSPDS
                 .  . .:                                .  : *              

HISZ_NOSS1      RHPQRLYYNANVFR-RIWENRHNRQQEFYQAGVELLGVGGLLANAEVLLLAGNCLTALGL
HISZ_SYNY3      NQPQRLCYRANVFR-NPPEGYHGKQMEFFQAGIELLFAGGVRADAEILLLLTDCLTQLGL
HISZ_THEEB      QLPQRLYYKTNVFR-RTTGAELGNQQEFFQAGVELLGATGLAADAEILWLVQECLGVLAV
HISZ_GLOVI      PLPVRLSYQMNVFR-STTQ-----PQEFYQAGVELIGAGGVLADAEVLLVLAECLAELAP
HISZ_PROMM      PRPLRLWAAGTIFESRTADEGSLCIEENLQSGVELFGVEPINAEMELLSLLFSAVETLEL
HISZ_SYNPX      PRPLRLWASGTVFQSRAADEGGQCIEENLQCGVELFGVAPIEAEMELLSLLMAAVERLDF
HISZ_PROMA      DRPLRLWTSGTIFKSKEDCDGKFVIEEGLQSGVELIGISDMAAEIELLYLLLDSMNQLEI
HISZ_BORBR      AGVTRLCYCGSVLHARPAD--LLSSRELLQIGAEIYGHAGFEADLEIIQLVMDTLATAGV
HISZ_BORPA      AGVTRLCYCGSVLHARPAD--LLSSRELLQIGAEIYGHAGFEADLEIIQLVMDTLATAGV
HISZ_BORPE      AGVTRLCYCGSVLHARPAD--LLSSRELLQIGAEIYGHAGFEADLEIIQLVMDTLATAGV
HISZ_RALSO      AGVTRLCYAGSVLHTRPSG--FHVTREPLQIGAEIYGHAGLEADLEIQDLMLAALSAAGL
HISZ_NITEU      SGVTRLCYASSVVHTVPDE--ITRTREPFQVGAELYGHSGIESDLEIQCLLLECLSVSGI
HISZ_NEIMA      QGINRLCYAGPVLHAQSDG--LLNMREPLQAGAEMYGFADIRGDIELIDLMLKSMKIADM
HISZ_NEIMB      QGINRLCYAGPVLHAQPDG--LLNMREPLQAGAEMYGFADIRGDIELIDLMLKSMKIADM
HISZ_CHRVO      TGVTRLCYAGSVVHSRPSG--LTSSREPLQVGAELYGYAGIEADQEIIELMLATLEKAGV
HISZ_PSEPK      EGPSRLCYAGSVLHAQPRA--LSTSRSPIQLGAELYGDASPTSDVEVISLMLATLQLADV
HISZ_PSESM      EGPSRLCYAGSVLHAQPRA--LSSSRSPIQLGAELYGDASPSSDVEVISLMLAMLQLADV
HISZ_PSEAE      EGPSRLCYAGSVLHAQPRA--LSTSRSPIQLGAELYGDPSPASDVEVISLMLEMLEMAEV
HISZ_BACAN      --PLKVTYSGNVFRANESL--AGKYNEIVQSGIEVIGIDNVRAEIECVISVIQSLQKLRV
HISZ_BACCR      --PLKVTYSGNVFRANESH--SGKYNEIVQSGIEVIGIDNVRAEIECVISVIQALQKLKV
HISZ_CLOAB      VYPLKLSYTGNIYRMNKAL--NGKISEITQSGIEILGFSSLKADAEVIITAIKAILKTGL
HISZ_CALS4      -YPLKLCYVANVYRYEDTQ--VGKMREFTQAGVELIGTNHEESDAEVIALSIEALKSTGL
HISZ_BACHD      AYPLRLAYQSNVYRAQQNE--GGKPAEFEQLGVELIGDGTASADGEVIALMIAALKRAGL
HISZ_BACSU      GHPLRVGYAANVFRAQERE--GGRPAEFEQVGVELIGDGTTSADAEVIALVVGALKNAGL
HISZ_LISIN      --PLKLSYSGKIFRANEDF--GGEQNEQTQAGIEIIGYPSIKAEIECILSGIGVLNALEI
HISZ_LISMO      --PLKLSYSGKIFRANEDF--GGEQNEQTQAGIEIIGYPSIKAEIECILIGIGVLNALEI
HISZ_STRMU      --PIKFSYSGKVFKYNEEL--RGLANEHTQAGIEIVGYKTQDAIKDALLSAKDALKASGL
HISZ_AGRFC      --PKRYSYLGEVFRQRREG-----ASEFYQAGIEDLGDTDIAAADARVVIDATAILQRLL
HISZ_RHIME      --PQRYAYLGEVFRQRREG-----SSEFYQAGIEDLGDPDTAAADARVVGDAMFVLANRL
HISZ_RHILO      --PRRYSYLGEVFRQRREG-----GNEFFQAGIEDLGDRDTAQADARSVADAHALLSLVL
HISZ_BRUME      --PKRYAYLGEVFRQRRDG-----AAEFLQAGIEDLGAADEAASDARSLADALSCVKAIA
HISZ_LACPL      --PQKFGYVGDIFRVSRQL--SGSYNQITQAGVELVGYASLKAEFECLTIANQLSSELIA
HISZ_GEOSL      PLPHRICYSGRVLRHAELQ--SGRSREIFQSGVELIGLDSPEADAEMVTMAVEALKGLGF
HISZ_OCEIH      -HYQRFSYCLDIFRFNETQ-----QAYRTQAGVEFFGDESPEADAEVIALAIDSLKDLKI
HISZ_DEIRA      PFPLRLQYGGRLWLRTQTSE-LGRLREFNQVGAELIGVTGVQADAELLALAHAALGQAGV
HISZ_LACLA      --SARYSYFGKIFRKEKRHK--GRSTENYQIGIELFGESADKSELEILSLALQVIEQLGL
HISZ_AQUAE      -LPERVYYFGKVFSLDRRG------FEKLQTGVELIGEKSILADFEVIQVLTEFLKSLGL
HISZ_STAAM      ---TKVAYTGLIIRNNEAA---------VQVGLENYAPSLANVQQSLKLFIQFIQQQLRD
HISZ_THEMA      --QIKVWYADFVYRYSGSD-----LVAEYQLGLEKVPRNSLDDSLEVLEIIVESASEFFE
                    :      :                 * * *                          

HISZ_NOSS1      QDWH---LILGEAGITRSLLDAFPINLRAKVRSAIAHLDRITIDTLPLTD---------E
HISZ_SYNY3      SDWQ---LILGDAGLTRSLLAKLPPTLQATVRDCITRLDYVELSQLPYPDN--------E
HISZ_THEEB      GEAY---LLVGDAHLTQQLLGTFPAELQKTVRQCLANLDRVSLQALPAPW----------
HISZ_GLOVI      PDWT---LILGAVAFTRSWLAQVAEPARHRLRRAMAELDRVAILAEAGIDE--------A
HISZ_PROMM      SKRHQPRLLVGHTALMDLIMLPFQNDLREKIRTALIHYDRLALESLQLPN---------D
HISZ_SYNPX      QAQHQPRLLMGHTGLMDLLLSPVPPVLRDAVRAALIQYDRLGLETIELEE---------G
HISZ_PROMA      CSNQNPILLIGHQSILKLILSGISNDYKNKIQKYLTNYDLVETEDLDIDI---------E
HISZ_BORBR      RNAR---LDLCHSGVMRAIFDADPQASRHAGDLCTLLREKDVPGLAELASR--VDGLGED
HISZ_BORPA      RNAR---LDLCHSGVMRAIFDADPQASRHAGDLCTLLREKDVPGLAELASR--VDGLGED
HISZ_BORPE      RNAR---LDLCHSGVMRAIFDADPQASRHAGDLCTLLREKDVPGLAELASR--VDGLGED
HISZ_RALSO      ADVR---LDLCHVGVLAALLAQAPVAPDVQDELFAALASKDAPALHALTA-----GLPAA
HISZ_NITEU      HSIH---LDLGHIRVFRSLIRDSGIKPEFEMELYAALWAKDISSLKELVRTGLNKRLTRS
HISZ_NEIMA      GKVL---LSLGHIGIFRALSDAAHLDAGQSATLLALMQDKDTETVEAQVKAW---KLDGM
HISZ_NEIMB      GKVL---LSLGHIGIFRALSDAAHLDAGQSATLLALMQDKDTGAVEAQVKAW---KLDGM
HISZ_CHRVO      KKLR---LDVGHIAIYRGLAAAAGLSPEVSRELFGLLQNKDAAGIAARVAG-----VAEP
HISZ_PSEPK      PDVH---MDLGHVGIYRGLARAAGLSGAVEQQLFDAMQRKAVDEVQALTAD-----LPKD
HISZ_PSESM      PDVH---MDLGHVGIYRGLARAAGLSGEVEQQLFDALQRKAIDEVVALTAN-----LPPE
HISZ_PSEAE      PDVH---MDLGHVGIYRGLARAAGLSGEVEQQLFDALQRKAVDEVEALTAD-----LPAE
HISZ_BACAN      QSFT---IEIGQVQLYKCIVKKLSIHEEEEKFLRTYIESKNYASLSNFIRDKKL-DRCDE
HISZ_BACCR      QSFT---IEIGQVQLYKCIVKKLSIQDEEERVLRTYIESKNYAALSNFIGEKKL-DRCDE
HISZ_CLOAB      KNFK---IEIGQVEFFKSIISDTALKEQDTEKLRNFIENKNFSKVEEFILRNSD-LIGET
HISZ_CALS4      KDFK---IDIGHAEVFGSIVRNLNLGNEDVNLLRELLEQKNQSAIEDFIKQKE---IKRE
HISZ_BACHD      SEFK---VAIGHVGYVNALLMDVVGNEQRADRLRRFLYEKNYVGYREHVKSLNL-STIDK
HISZ_BACSU      ASFK---IAIGHAGIADALFVEVLGNVERADVLRRFLYEKNYVGYREHVKSLPL-SSIDK
HISZ_LISIN      PNFQ---IELGHAAIYRRVIHLLNLPETAEMDFRLLIQNKSLTGIQQFVTENP-----ST
HISZ_LISMO      PNFQ---IELGHAAIYRRVTNLLNLSETAEIDFRLLIQNKSLTGIKRFVADNP-----ST
HISZ_STRMU      KDYK---FEFSHAHILQTIFANLDIPETAKKELTTFIQDKNITGLNEFTHRYP-----SE
HISZ_AGRFC      PGRS-LAVTLGDQQVFEAVVAALGLPLGWQKRLVQAFGDMAQLDALLESLVHPKP--MTG
HISZ_RHIME      PGER-LKVTLGDQSVFEAVIAACGLPGGWQKRLIHAFGDQKQLERLLAALADPKSPGVFG
HISZ_RHILO      PGRS-LAVTLGDQGIFEAVLAALGLPRGWRMRLARAFGSAPMLQAALADLANPPR---NG
HISZ_BRUME      PDAP-LEIVLGDQSVFAGMLKALGLPQGWRKKLLRSFGDAHSMDLALAELTGTQR---RD
HISZ_LACPL      DAVE---IELGDAQFAQRVVASLTGDEGEQQAILTALFDKQVPRYTKLIAKYRA----QP
HISZ_GEOSL      RDFK---IDLGHVGFIRGIMTASGLEVAVRNRLQEAIGKKDVSAVRSILAESPL---SDA
HISZ_OCEIH      APFK---IEIGHSGIYKELLEQANLTDQEQQTLHALIQSKNISETSSFLDHLSI---DQD
HISZ_DEIRA      QAQL----EVGFPGFVDAALTDAGLPGPVRAALHDAIDRKSGADLDLLARQHGV---SPE
HISZ_LACLA      NKTV---FEIGSAKFFQRLCQ---LADGSTELLTELLLKKDLSGLNAFIEKN------NF
HISZ_AQUAE      KDLK---VILSHAGIVRKVAD-------EREELLRAFSERNLEALKEVLGN---------
HISZ_STAAM      NVHF---VVLGHYQLLDALLD----KSLQTPDILSMIEERNLSGLVTYLST---------
HISZ_THEMA      GPVI---VEIGHTGVYEDLLKEIPKDLHEKVLNLIDTKNLAEIEFLSHMKK---------
                         .                                                  

HISZ_NOSS1      LRERARIMLDLRGNSADVLQKVSSLNLDAE-QQEAVNNLKSLVELLESGGK--FPIILDL
HISZ_SYNY3      AKNLALQLFDLRGTVEEVLARLGKLDLQGE-CLGLVDRLQALLCLVAASGDGPANLVLDL
HISZ_THEEB      -RDRALALFDLRGTPEEVGERLAQWSDVAG-VVDRFAQLQQLLALVAESLA----ITLDL
HISZ_GLOVI      VRSQLLLLFDLRGEPEMVLSKASSLPMSDA-QRAELAELETLTGWLRGRSV---PVVLDL
HISZ_PROMM      QFERLLHHLECRGEPLDVLERLSGLFGTQQ-ALNNLQRLFEQMSPLAADQG--IDLQLDP
HISZ_SYNPX      LRATLLSLLDCRGTPNEVLERLSSCFGAQA-LFDDLHRLCRQLQGPAAAQG--VRLQLDP
HISZ_PROMA      IKNKLLKVLKIRGNPSDVLDKLVNIYGSNT-LFDELRRLFLIIEPISKKYG--VSIQLDP
HISZ_BORBR      TVRALQALATLYGGPEIIARARRELPAVPG-MAQALDALQALVDAMPGVT-----LSVDL
HISZ_BORPA      TVRALQALATLYGGPEIIARARRELPAVPG-MAQALDALQALVDAMPGVT-----LSVDL
HISZ_BORPE      TVRALQALATLYGGPEIIARARRELPAVPG-MAQALDALQALVDAMPGVT-----LSVDL
HISZ_RALSO      QRDAINLLPSLYGGVDVLARARAQLPQLPA-IGRALDDLATLAAHAGGAA-----VNIDL
HISZ_NITEU      VQNALLLLPELYGDGTVLLSARQHLPDFPE-IGEALDQLEHVARILQPYVDR---ITFDL
HISZ_NEIMA      WAKAFSLLPRLYGGREVLSDARGRLPDLSA-VGGALGELQAVCDAFPD-CE----IHIDL
HISZ_NEIMB      WAKAFSLLPRLYGGREVLSDARGRLPDLSA-VGGALGELQAVCDAFPD-CE----IHIDL
HISZ_CHRVO      YKSAFLALPELYGPAAVLEKARTRLPSLPE-VELGLMQLSAIARAMEGRVE----LSFDL
HISZ_PSEPK      LGSMLRALVELCGGREVLAEARVRLGRAPASVLAALDDLLAIADRLASRYPD-LPLYFDL
HISZ_PSESM      LASMLRALVDLCGGREVLDAARDRLAGAPAPVLEALDDLLAIADRLAARFPQ-LPLYFDL
HISZ_PSEAE      LRGMLRALAELCGGRDALEQGRARLAAAPADVQVALNELIEIADSLAGRFPG-LPLYFDL
HISZ_BACAN      TVKLLEKLPRLFG-NLEVIEEAEKLASSNE-MKMAITRVKEIYEAIEKLGYG-SYISIDL
HISZ_BACCR      TVRLLEKLPRLFG-NLEVIEEAEKLASSNE-MKMAIARVKEMYETIEMLGYG-SYISIDL
HISZ_CLOAB      SSKVLMNLPNLFG-GKEVIEKAEQLTSNKQ-AIEALKKVRDLYDIVKRAGFG-EYILIDL
HISZ_CALS4      EAKLLRELPLLFG-GEEILEKLKKEN-FKE-TEGVLEYLDRVYKILEDFGMK-EYISFDL
HISZ_BACHD      --SRLMNLLSLRG-GRAAIEEARGLIQTEK-GKTALAEMTKLYEVLESYGAS-EYVKFDL
HISZ_BACSU      --SRLLELLELRG-GIEVCGRAEEIVDSAQ-GKSVVDELKALWDILEDYGCT-ENVRLDL
HISZ_LISIN      LDDFILALPRLFGPATTILKQAKNLTTDKG-ILTALTEMETIVDAVSYA----ADISVDL
HISZ_LISMO      LDDFILALPRLFGPATAILKQAKNLTTDKG-ILTALREMETIVEAVSYT----ADISVDL
HISZ_STRMU      FNALIRQLPFLFGESHQVLKKARQLTNHQT-ILSALTDLEDLLQELAVSL---AEITLDL
HISZ_AGRFC      LDA-RVAGLLATGDEAVLVDYLDTVMQETGYSTNASRSPLEIARRLREKLA-LAATRLPD
HISZ_RHIME      HDVERVAALGMLEDEERLVAHIGETMKATGYSTNAGRSPRDIARRLKEKVE-LAAIRLDK
HISZ_RHILO      QLSGEVAALVLDGDLDGLSTHIAGGMEQAGLSASAGRSPTDIARRLIEKAE-LRSVRLSN
HISZ_BRUME      PLPESLAVLVAEGDEIGLARMLEAEMLEAGISPGAGRTPVEIARRLIEKED-LAATHFPA
HISZ_LACPL      LYDFLKAWPRLFGRPECIFKELAAAPLPET-VQPSLKRLQTVVAWMQQTMPE-QVISVDL
HISZ_GEOSL      AKDELAALPRLFGGREVLDEAGRVATNDTS--RRALDNISQVLDLLDIHGVS-DHLTIDL
HISZ_OCEIH      LKQKIELIPMLYGDPSTVIKRAQAIVTNET-MQQVVDTLFNVYSLLKDDQIE-EYISFNL
HISZ_DEIRA      VTRTLHSLTELYGGPEVLTEARVLARGVRA--EQAVEHLSAVHAAAQEAGVE---LLFDL
HISZ_LACLA      SKELRGLLKEIFITNELSRLENLVTNTKDDVLISSFDQLKEFSEKLSMIKP----IIIDL
HISZ_AQUAE      ---DIKFFVEVSKNPEVLNFLEKYDLEKEK------EELLELGKLLEEFGID---YAYDL
HISZ_STAAM      ------EHPIVQILKENTQQQLNVLEHYIPNDHPALVELKIWERWLHTQGYK--DIHLDI
HISZ_THEMA      ----IDLSRVEKIIEDSIYRRSPEHLKTMDLPLSVREDLLSASSFLQEKFPT-VSVEIDL
                                                                            

HISZ_NOSS1      SLIQTIDYYTGLVFEIVNNTDSQARVLGRGG-RYDQLLGLYHPQGENIPGIGFVLNIEDL
HISZ_SYNY3      SWLQPFDYYTGMVFQAVSRQADNCYVLGQGG-RYDQLLSQYHPQQQSFPGTGFSLNIEEL
HISZ_THEEB      SLVQSFDYYTGIIFEVLIPTETELRLVAQGG-RYDQLLSIYHPDGATVPGIGFVFNVEAL
HISZ_GLOVI      SLVEAFDYYTGLIFEV----SAGGRLIGRGG-RYDHLLGSY---GKPAPGAGFALNLEAL
HISZ_PROMM      TFQPHFELYTGLVFQLVCQSDAAPVVIARGG-RYDNLVARCGAKGLQAAGVGFSFAIDDI
HISZ_SYNPX      TFQPRFELYTGLVFQLVCDTHSAPVVVARGG-RYDDLVRRCGAQPGQDFGAGFSLAIDPI
HISZ_PROMA      TYQPHFKLYNGLIFQLICQTDYAPKVIARGG-RYDDLVNSFTTSIENETGAGFSFSIDKI
HISZ_BORBR      ADVGGYGYHSGVTFAVYGE--DWHDALVRGG-RYDDVSRAF---GRARPATGFSLDLRKL
HISZ_BORPA      ADVGGYGYHSGVTFAVYGE--DWHDALVRGG-RYDDVSRAF---GRARPATGFSLDLRKL
HISZ_BORPE      ADVGGYGYHSGVTFAVYGE--DWHDALVRGG-RYDDVSCAF---GRARPATGFSLDLRKL
HISZ_RALSO      ADLRGYHYHSGVMFAAYVA--GVPNAVARGG-RYDKVGEAF---GRARPATGFSLDLREV
HISZ_NITEU      ADLRGYHYHTGMVFAVYTP--GCPAPIALGG-RYDEIGKSF---GRARPATGFSLDLKQL
HISZ_NEIMA      SELRVDNYHTGLLYAAYAA--DFHDAVARGG-RYDGLGGYF---GRARPATGFSFDLRSF
HISZ_NEIMB      SELRVDNYHTGLLYAAYAA--DFHDAVARGG-RYDGLGGYF---GRARPATGFSFDLRSF
HISZ_CHRVO      AELRGDFYHTGLMFAAYAP--GWSDAIARGG-RYDNVGRRF---GRARPATGFSLDLRDL
HISZ_PSEPK      GELRGYHYHTGVVFAVFVP--GEGQSIAQGG-RYDDIGADF---GRARPATGFSTDLKTL
HISZ_PSESM      GELRGYHYHTGVVFAVFVP--GVGQSIAQGG-RYDDIGADF---GRARPATGFSTDLKTL
HISZ_PSEAE      GELRGYHYHTGVVFAAFVP--GVGQSIAQGG-RYDDIGADF---GRARPATGFSTDLKSL
HISZ_BACAN      GTIQHLDYYTGVIFKGYIY--EIGEEIVSGG-RYDELIGNFGE---MLPAVGLAVQVNQI
HISZ_BACCR      GMIQHLDYYTGVIFKGYIY--EIGEEIVSGG-RYDELIGNFGE---MLPAVGLAVQVNQI
HISZ_CLOAB      GMVQHINYYTGLIFRGYAH--GIGDDLLSGG-RYDKLLGQFGY---DIPATGLAINVDNL
HISZ_CALS4      GMVQNLNYYTGIIFRGFVK--GLGYAICTGG-RYDKLLKIYGK---DLPATGFAISVERV
HISZ_BACHD      TLVLHMSYYTGVVFEGYGN--RLGVPLCSGG-RYDELLSKFHR---PAQATGFGVRIDLL
HISZ_BACSU      NMVSHMSYYTGILFEVYAE--NVGFVIGSGG-RYNKLLGHFDS---PAPATGFGLRIDRL
HISZ_LISIN      GLVQDFHYYTGIIFRGYAD--LAADNFLSGG-RYDHLLEQFTSS--SSPAVGLALNLDSL
HISZ_LISMO      GLVQDFHYYTGIIFRGYAD--LAADNFLSGG-RYDHLLEQFTSA--SSPAVGLALNLDSL
HISZ_STRMU      AQIASMPYYTGLMFKVFGD--KIPDAFVSGG-RYDKLFERFGAK--ELTAIGWALDIDSV
HISZ_AGRFC      ESFELLKQFLALQAPLPQASQVLGDFAARAKLKLDGALSAFDKRVAALANAGVDLETVTY
HISZ_RHIME      EALGVMRAFLALDLPLADAPAALHRFAGKARLKIDDALALFDARVAALARAGADPGLMRY
HISZ_RHILO      EAFAALKNFLAIHVPLDGAARALETFAAGAGLSLGAALEKFAARAKAIEAHGLPAEKIRY
HISZ_BRUME      AALDLLRQFLAIRVSLDTAAVTLRAFAADNALDLGAVLQKFEARADAIAQAGIEMKDIIY
HISZ_LACPL      SSQAPQKYYTGLTFRGYSQ--AGAGYLFSGG-RYDKLLTNFQA--EAEPAVGMGLNVDLL
HISZ_GEOSL      GEVRGLDYHTGLTFEGFVT--GMGEAVCSGG-RYDTLTARYGF---PAPATGFTFNVLAL
HISZ_OCEIH      GLINNMNYYSGIIFQGFTE--QIGQPILMGG-RYDHLSSQFEN---EIPAVGFAFEIDKL
HISZ_DEIRA      GVSRRYGYYTGLTFRAYVD--GINQPVLGGG-RYALP--------GGLPGAGFAIGLERL
HISZ_LACLA      GMVPKMDYYTDLMFKAYSS--AANQPILSGG-RYDQLLSNFQE---EAFAIGFCCHMDTI
HISZ_AQUAE      GEVRNFPYYTGVIFEIYELK--SGKALAGGG-RYDNLSKIYGK---EYPATGGAVYLERL
HISZ_STAAM      TAQPPRSYYTGLFIQCHFAE--NESRVLTGG-YYKGSIEGF----------GLGLTL---
HISZ_THEMA      TLARTIEEYCGLIFTIYDTS---SSRLVAAGGEYTVNGEK---------GVGGSIFLEGK
                        .  :                                       *        

HISZ_NOSS1      YQVLLSTQQLPQETPASDWLVVPENPAAHSAAFAYAQKLRESPDLVRVELDLGSTDRATI
HISZ_SYNY3      HQCLLELGTLPTSTAPIDYLVCPVDDTAEGATFRHAQQLRRQHPDRRVELDLGGRSPEEL
HISZ_THEEB      LQAV-AIPPAALLAPRSQWLVVPRTANALAAALHHAQTLRLDGS-TRVELALLELTPEQI
HISZ_GLOVI      QQVLLPTGKLPGRTVGGGFLVVPDGPDAWEAALAEADKLRCAPG-ERVEIELLGRTGEEA
HISZ_PROMM      RELLTKEIKASDAVETT--LVAYGEQATLEHALKRQRHWHKQGQRAVVELEACR-DREDA
HISZ_SYNPX      RELLSDSSSNPTVAPQL--MVAFSERSTLEAALERQRWWHQQGRSAVIELHPFS-TRSLA
HISZ_PROMA      RELKLKVEYDDKKVART--LIAFSKSKRYEDALEKQLEIHRKGSMAMVELKPCD-TKKEA
HISZ_BORBR      AAGLTPAEPAR--------AVRAPWG-QDPALTDAVRRLRRSGEIVVQVLPGH-EQGLDE
HISZ_BORPA      AAGLTPAEPAR--------AVRAPWG-QDPALTDAVRRLRRSGEIVVQVLPGH-EQGLDE
HISZ_BORPE      AAGLTPAEPAR--------AVRAPWG-QDPALTDAVRRLRRSGEIVVQVLPGH-EQGLDE
HISZ_RALSO      AGISPVQARAA--------AIHAPWS-GDAKLREAIAGLRATGEIVIQSLPGH-PEDLEE
HISZ_NITEU      SQLTDMNGYPS--------GILAPWKPEDEKLAAMVRQLRAEGHIVVTELPG--EENQEV
HISZ_NEIMA      IGRLPAIERQP--------AVLVDAE-DAEAAHEAVEALREQGQCVVIDYGI---GHNVS
HISZ_NEIMB      IGRLPAIERQP--------AVLVDAE-DAEAAHEAVEALREQGQCVVIDYGI---GHNVS
HISZ_CHRVO      LRILPERDPSR--------GIRVSAR-HLPAAAAEVSRLRAEGEMVVVDYLG---ESAAA
HISZ_PSEPK      VTLGRAEVVLPT------GGIWMPDS-GDAALWQQVCQLRNEGQRVVQALPGQPLSAALE
HISZ_PSESM      VTLGQAEIVLPS------GGIWMPDS-TDAALWQQVCQLRSEGQRVVQALPGQQVSAARE
HISZ_PSEAE      VTLGQARLDQAV------SGIWAPAE-G-AGLWQAVQRLRRDGQRVVQALPGQDAASARE
HISZ_BACAN      VKALQEQQEPYERKRID--IMIHYELNRLAEAERLRNLLQKDGKKVALSLFSNLNDTFQF
HISZ_BACCR      VKALQEQQEPYERNQID--IVIHYELNRLAEAERLRNLLRKDGKNAWLSLFSNLSDTFQF
HISZ_CLOAB      VAALDDCVRENLYSRDR--YVVFASSCNIEKAYEAVSKLNSEGKRAEVSLFDNIEETKKY
HISZ_CALS4      MLALQRQSKGEWVKPRR--VLVRYKEEERRRAYEKANVLRKEGNVVEMYTFKRCENIDLK
HISZ_BACHD      VEALNGEIISNGHEQTC--ILFSNE--RRFEAIELARKKRANGEAVVLQDLAGVTDVDAM
HISZ_BACSU      IEALHMK--DEPCEIDA--VIFSKE--QRAQAIAYANEERMKGNKVVLQDLSGIENIDQM
HISZ_LISIN      TTLQNRAGIIKKQTPTT--LLIHYD----LDAIQQAEKLMQETPNSELSFFETPINAISF
HISZ_LISMO      TTLQNRAGVIKKQVSTS--LLIHYD----LDAIQQAEKLMQETPNSELSFFETPTNAISF
HISZ_STRMU      --------------------------------------------------YQAIHDHIRF
HISZ_AGRFC      GAAFGRPLDYYTG------LVFEVVEAGS--DSVLAGGGRYDRLLTLLGAQEKIPAVGFS
HISZ_RHIME      RAAFGRPLDYYTG------LVFEIGVEGT--PAVLAGGGRFDRLLTLLGAREHIPAVGFS
HISZ_RHILO      DAAFGRPLDYYTG------VVFEIAAQGG--ERPLAGGGRYDRLLTLLGAKTAIPGVGFS
HISZ_BRUME      DASFGRPLDYYTG------LVYEIRDASNRQDGVLAGGGRYDRLLTMLGACEAIPGVGFS
HISZ_LACPL      TTLATDQQTAYAE------QLIYFEP----EQWSQAEAYLAKQPHAILSLADDLAGARIE
HISZ_GEOSL      LSALEKRPDVEASKTRD--ILIFNQQDDRREALEIAQQLRRRGYTTARDIIRRNFDDSLD
HISZ_OCEIH      LTLITPGDQPLITQADF---LIEYQPNCRQDALLLARRLRQANKKVIIQPTESSSKIKAS
HISZ_DEIRA      AAVMPAGVPSEPE----TVLALDFAAATAARAAGLGAELAWTGDEAELRHYAQARGLRRW
HISZ_LACLA      LKALERQELEEDND----------------------------------------------
HISZ_AQUAE      LDILPKNVEKKD--------YFVIDKTKKRLGLKLADVLREKGKKVGMEIVKERGLEHSL
HISZ_STAAM      ------------------------------------------------------------
HISZ_THEMA      TC----------------------------------------------------------
                                                                            

HISZ_NOSS1      KQYARDRSIAQIAWIKADGSPIIEKVSQ----------------------------
HISZ_SYNY3      NTYAQAMAVGQIVWVGADGPVDL---------------------------------
HISZ_THEEB      RAYARDRQIPYIAWIESDAPPQIEALSDGATSLQIQRV------------------
HISZ_GLOVI      IAHGRALGAAVVRWVHPDGSTTDCDLAVIQ--------------------------
HISZ_PROMM      FSRLSDRGCSTLDWLDH---------------------------------------
HISZ_SYNPX      EQQATDQGGFQLDWIDP---------------------------------------
HISZ_PROMA      EFLVNKRGFDKLVWIS----------------------------------------
HISZ_BORBR      FVCDRELALQDGAWTVRTL-------------------------------------
HISZ_BORPA      FVCDRELALQDGAWTVRTL-------------------------------------
HISZ_BORPE      FVCDRELALQDGAWTVRTL-------------------------------------
HISZ_RALSO      FAYDRQLAEEGGRWVVKPRKASA---------------------------------
HISZ_NITEU      TGCDRKLVFRNGNWEIDPVTG-----------------------------------
HISZ_NEIMA      EELAGRLKKTDGVWQVVKR-------------------------------------
HISZ_NEIMB      EELAGRLKKTDGVWQVVKR-------------------------------------
HISZ_CHRVO      LNCDRELVPAADGWQLAPFH------------------------------------
HISZ_PSEPK      ADCDRQLIQQDGRWQVLPLAQ-----------------------------------
HISZ_PSESM      ADCDRQLIQHGEHWQVMPLAS-----------------------------------
HISZ_PSEAE      AGCDRQLALRDGNWQVAPLAS-----------------------------------
HISZ_BACAN      ARKNQIVTVVEAKSESLVEYVWKEKWVVQKEGETSCVTFKLR--------------
HISZ_BACCR      ARKNKIGTVVEAQNEYLVEYVWNEKWVVQKEGEASCVTFKLR--------------
HISZ_CLOAB      CIENKISKIFNADTG---KTIVEENYYGQK--------------------------
HISZ_CALS4      SFDEVVDVGE----------------------------------------------
HISZ_BACHD      SSNYQDVIYCIGTAGRGGEDA-----------------------------------
HISZ_BACSU      TKSFANVTYFIGAR-KEEQNG-----------------------------------
HISZ_LISIN      AKKWQIPTVVHVARDSIQTIFHKEAE------------------------------
HISZ_LISMO      AKKWHIPAVIHVSRQGIQTIFQREADL-----------------------------
HISZ_STRMU      --------------------------------------------------------
HISZ_AGRFC      LWLDRIKAVRGSDKP-----------------------------------------
HISZ_RHIME      LWLDRIEQAIAAGRAE----------------------------------------
HISZ_RHILO      VWLDRIEALREAAP------------------------------------------
HISZ_BRUME      IWLDRLQALAGEKQ------------------------------------------
HISZ_LACPL      AQRLNAQLIDLTGGMTND--------------------------------------
HISZ_GEOSL      YARRMNILHMMVVGGDQCGPDEVYLVRVADGQGQRIKKAEVFSERFSLDAGPDKES
HISZ_OCEIH      NIILVDSNSYQLKSSDIQTTFSSIDQTLQHVLKKR---------------------
HISZ_DEIRA      VQGAELRDVTPADLKIATEVNA----------------------------------
HISZ_LACLA      --------------------------------------------------------
HISZ_AQUAE      IYAFDKGFKEVLLVEDEIVKVYTTPKDYVVMKIREFLDLIE---------------
HISZ_STAAM      --------------------------------------------------------
HISZ_THEMA      --------------------------------------------------------