CLUSTAL format seed alignment for MF_00127

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

SYH_CHLMU       -------------MSNVLPKGVFDIFPYVTNSKNLWRNSFLWKTVEHAAHRICNLYGFDE
SYH_CHLTR       -------------MSNALPKGVFDIFPYVTSPKNLWRNSSLWKRVEHAAHRICNLYGFDE
SYH_CHLPN       -------------MTVTLPKGVFDIFPYLADAKQLWRHTSLWHSVEKAIHTVCMLYGFCE
SYH_CHLTE       ------------MTQFQGVKGTRDIFPDEIS------R---WHYVEGVVHSVAALYGFSE
SYH_COREF       --MTDKNTRTEKIQPFSAPKGVPDYAPPRS-----AAFVAVRDAFITQAHL----AGFEH
SYH_CORGL       --MSQNKSKSEKLQSFAAPKGVPDYAPPKS-----AAFLAVRDAFVNQAHK----AGFEH
SYH_MYCLE       --MTESCT----VFSFSGPKGIPDYFPPDS-----AQFVAVRDGLLTAARR----AGYGD
SYH_MYCTU       --MTEFS-------SFSAPKGVPDYVPPDS-----AQFVAVRDGLLAAARQ----AGYSH
SYH_STRCO       --MTRPS-----VSTFKAPKGTYDLLPPDS-----AKFLAVREAIAAPLRN----SGYGY
SYH_DEIRA       --MAIQR-----------PKGTNDLLPSGSPKTEAFQRAAAHEWLIAQAREVLERAGAQR
SYH_THET8       --MTARA-----------VRGTKDLF--G-------KELRMHQRIVATARKVLEAAGALE
SYH_CLOPE       -------------MAIQAQKGTKDMLPND---------AYKWHYIEEKLRKISAEYGIRE
SYH_CALS4       -------------MLTKAPRGTKDVLPSE---------SYKWQYVENLMREICEFYGYKE
SYH_THEMA       -------------MKYRRIKGTNDIFGEE---------IWYWRYVEETFRNVCESAGIEE
SYH_FUSNN       ------------MKLIKAVRGTKDIIGEE---------AKKYIYISNVAQKMFENYGYNF
SYH_AQUAE       -------------MNIQSVRGFHDILGKD---------AKKFRKISDTARKILKLYNFEE
SYH_BACHD       -------------MAIQIPRGTQDILPGD---------VETWQWIEQKAYDLCRRYNYQE
SYH_BACSU       -------------MGYNIPRGTQDILPGE---------SDRWQFVEQIMRDTCRTYQYKE
SYH_OCEIH       -------------MSMKAPRGTVDLLPEQ---------SIKWQFAESKIKEICHNYHYQE
SYH_LISIN       -------------MDLQLPRGTRDILPEE---------VSKWHFLESAFNKVCENYQYEE
SYH_LISMO       -------------MDLQLPRGTRDILPEE---------VSKWHFLETEFKNVCENYQYEE
SYH_STAAM       --------------MIKIPRGTQDILPED---------SKKWRYIENQLDELMTFYNYKE
SYH_STAES       --------------MIKMPRGTQDILPQD---------SAKWRYIENRLHTLMELYNYKE
SYH_STRA3       -------------MKLQKPKGTQDILPGE---------SAKWQYVENVIRNLFKQYHYDE
SYH_STRP3       -------------MKLQKPKGTQDILPGD---------AAKWQYVESVARDTFSQYNYGE
SYH_STRP8       -------------MKLQKPKGTQDILPGD---------AAKWQYVESVARDTFSQYNYGE
SYH_STRP1       -------------MKLQKPKGTQDILPGD---------AAKWQYVESVARDTFSQYNYGE
SYH_STREQ       -------------MKLQKPKGTQDILSVA---------AAKWQYVEGVARETFKQYHYGE
SYH_STRMU       -------------MTLQKPKGTQDILPQE---------TVKWQYVENVARKTFKKYHYGE
SYH_STRPN       -------------MKLQKPKGTQDILPAE---------SAKWQYVEGFAREIFKRYNYAE
SYH_STRR6       -------------MKLQKPKGTQDILPAE---------SAKWQYVEGFAREIFKRYNYAE
SYH_LACLA       -------------MKLQKPKGTADLLPAE---------TAKWQYIEEIARGVFNDYNFKE
SYH_LACPL       -------------MRYQRPKGTADILPGD---------SEKWQYVEATARAVFKTYQFKE
SYH_SALTI       -----------MAKNIQAIRGMNDYLPGE---------TAIWQRIEGTLKNVLGSYGYSE
SYH_SALTY       -----------MAKNIQAIRGMNDYLPGE---------TAIWQRIEGTLKNVLGSYGYSE
SYH_ECOLI       -----------MAKNIQAIRGMNDYLPGE---------TAIWQRIEGTLKNVLGSYGYSE
SYH_YERPE       -----------MAKNIQAIRGMNDYLPAD---------TAIWQRIESILKQVLSGYGYSE
SYH_VIBPA       -----------MAKTIQAIRGMNDCLPTQ---------SPLWQKLENTVKNVISAYGYNE
SYH_VIBVU       -----------MAKTIQAIRGMNDCLPTQ---------SPLWQKLEGAVKNVISAYGYNE
SYH_VIBCH       -----------MAKTIQAIRGMNDCLPTQ---------SPLWQKVEGVVKNVISAYGYSE
SYH_HAEIN       -----------MAKTIQAIRGMNDCAPTE---------SPLWQWIEAQVRNVLNSYGYSE
SYH_PASMU       -----------MAKTIQAIRGMNDCSPTE---------SPLWQWVEGKVRSVLQNYGYSE
SYH_SHEON       -----------MAKQIQAIRGMNDILPTQ---------SPLWQKVEAVLRSSVAAYGYSE
SYH_PSEPK       -----------MSKSLQAIRGMNDILPEQ---------SPLWRYFEGTVAGLLDTYGYSQ
SYH_PSESM       -----------MSKSLQAIRGMNDILPEQ---------TPLWRHFEGTVSRLLDNYGYRQ
SYH_PSEAE       -----------MSKSLQAIRGMNDILPEQ---------TPAWRYLERTFAGLLDGYGYSE
SYH_NEIMA       -----------MAQKIQSVKGMNDLLPVEQKDFK--LTAAFWQAFEDTVGRWTRTYGYQQ
SYH_NEIMB       -----------MAQKIQSVKGMNDLLPVKQKDFK--LTAAFWQAFEDTVGRWTRAYGYQQ
SYH_RALSO       ------------MQKIAGVKGMNDLLPGD---------APLWEHFDNAVRSMLRAYGYQQ
SYH_THEEB       -------------MGLQAPRGTRDILPAE---------RVYWQYLETIARQILDRAAYRE
SYH_SYNY3       ------------MGAIQAIRGTRDILPPE---------TNYWQWVEAIAKSILDRALYQE
SYH_PORPU       ------------MAKIQAIRGTKDILPDE---------QLYWQFIHEKVASLLKYANYKE
SYH_BUCAI       -----------MNKEIKSIRGMYDYFPKD---------LKIWNYIEIIFKEVLNSYCYLE
SYH_BUCAP       -----------MNKKINSVRGMHDYLPEE---------LKIWKKIENIIQKILTSYCYEE
SYH_BUCBP       -----------MKEIIRSIKGMHDYIPDD---------VITWQYIEYIVKRILKNYCYNE
SYH_WIGBR       ---------MKKNLIISNVRGSKDITPEC---------MHIWNYVETKIIKIVDSYNYKE
SYH_RICCN       -----------MTEKLQPLRGMKDLLPDD---------YKVHDYIINKARDVGVLYGYKQ
SYH_RICPR       -----------MIENLQPLRGMKDLLPND---------YQIHNYIINKARDVGALYGYKQ
SYH_CAMJE       --------------MINALKGMKDLLDKD---------AYYYEKVIKICEEVAKNYGFTF
SYH_MYCGE       ------------MNFLQKPRGVKDWFGDE---------LVYFNWIVKKIRSLAFNWGFSE
SYH_MYCPN       ------------MSVLQKPRGVKDWYGEE---------LIYFNWTVHQITNLAWKWGFSE
SYH_MYCPE       -------------MVIKKPRGTYDLFGEE---------IEVFNKINDVLKTISNTYNCHE
SYH_UREPA       ------------MINYSKPRGTIDLYNKE---------MNDFKLLENFLLSTTKRYGFQQ
SYH_MYCPU       -------------MKFQKLKGTRDYYFQD---------SNKLEIIRNAFFTSAKKFNFSF
SYH_METAC       -------------MTVNRPRGTRDFLPADTA---------RRRYVESVMRNVVRNWGYSE
SYH_METMA       -------------MSVNRPRGTRDFLPADTA---------RRRYVESVMRNVVLNWGYSE
SYH_ARCFU       -------------MKIERPRGTRDFLPDEME---------RRREIEKRMRKIAESFGYRE
SYH_METJA       -----------MIVMFQKPRGTRDFLPEEMK---------KRRFVENKLREVFERYGYKE
SYH_METTH       -------------MDISRPRGTRDFLFAEMR---------NRKEVEGVLRRTFETYGYHE
SYH_METKA       --------MGVTLMKVERPKGTRDFTPEEMR---------ARRWLERYLLDVFRSYGYEE
SYH_PYRAB       --------------MIERVKGTRDFLPEEMV---------KRRWVFEKIREVFETYGFKE
SYH_PYRHO       --------------MIERVKGTRDFLPEDMA---------KRRWVFEKIREVFEAYGFKE
SYH_PYRFU       --------------MIERVKGTRDFLPEEMV---------KRRWVFERIRERFETYGFKE
SYH_SACS2       ------------MVKFETVRGMKDYIGIDAE---------KIRYLESTFRDLAKKYGYSE
SYH_SULTO       ------------MISYEPVRGMKDYYGEELH---------KIKVVENAFLKIVKLAGYQE
SYH_PYRAE       -------MSGLPDHLRRPVRGMRDWLPPQYY---------ALRHMEEVLCKVAESFGYRR
SYH_THEAC       ----------MYRLQIEKIRGFRDFYPEDMD---------VEKFIFKTAEEAAEAFGFRR
SYH_THEVO       -------------MQIERIKGFRDFYPEDME---------IEKFIFETASSVAESYGFKR
SYH_HALSA       --------------MYDRLKGFRDFYPAEMG---------PRRAAIDAIEDAAASYGFRE
SYH_AGRFC       ---MSEKAKKPQKLKARLPRGFVDRSAAD---------IHATNEMVDKIRRVYELYGFDP
SYH_RHIME       ---MNEKQKKTQKLRARLPRGFVDRSAAD---------IRAVDEMIAKIREVYERYGFDP
SYH_BRUME       ---MADKA---DKMKARLPRGFVDRVPDD---------LRAAEKMMATIREVYDLYGFEP
SYH_BRUSU       ---MADKA---DKMKARLPRGFVDRVPDD---------LRAAEKMMATIREVYDLYGFEP
SYH_RHILO       ---MADKS---EKTKARLPRGFADRSAED---------IRAVEKMMATIRSVYELYGFEP
SYH_BRADU       ---MAEKPKKPQKLKARLPRGLEDRDPAA---------IRATREMVEKIRAVYELYGFEP
SYH_CAUVC       MTTDSEQPNTDFRPEARAPRGFADKRARD---------LRAERAILEAVSAVYERYGFEA
SYH_CLOAB       ---------MNNKIKPSILPGFMELLPKE---------QLVFNDIVSKITGVYEQNGFLP
SYH_CLOTE       --------MKKDIVKPSILPGFMELLPAD---------QIVFNKMKDTIRHNYEKFGFIP
SYH_XANAC       ------------MIKPRTPPGIMELLPRE---------QIAFQRMLDVIRRNYERFGFLP
SYH_XANCP       ------------MIKPRTPPGIMELLPRE---------QIAFQRMLDVIRRNYERFGFLP
SYH_XYLFA       ------------MIKPRTPPGVLELLPRE---------QIAFQRMLDVIRRNYERFGFLP
SYH_XYLFT       ------------MIKPRTPPGVLELLPRE---------QIAFQRMLDVIRRNYERFGFLP
SYH_NOSS1       -------MAKNDKINFSTPSGFPEFLPSE---------KRLELYLLDTIRRVYESYGFTP
SYH_BIFLO       ------------MAKGASISGFPEWLPSE---------RVVEQRVIDTLRKVFELNGFIG
SYH_HELPY       ------------MITPKVLSGFKDRLPKD---------AIQKAQLLAKVSVVFQSFGFVP
SYH_HELPJ       ------------MITPKVLSGFKDRLPKD---------AIQKAQLLAKVSVVFQSFGFVP
SYH_BACTN       -----------MAAKPSIPKGTRDFSPVE---------MAKRNYIFNTIRDVYHLYGFQQ
SYH_AERPE       ----------MAGGRPRPPRGFRDFPPEV---------MILRKRLLSRLERVFESYGFDP
SYH_BORBU       -------------MDIKTLKGFKDYLPKD---------SLIRIHIVRQIFSVLNSYNFDL
SYH_TREPA       -------MRVGSAVSPKVLKGFRDLLPDE---------EIERALLVEKLTVALRQMGFVP
SYH_LEPIN       ------MENQKNFLTTAPYKGTRDFYPED---------MRLRNWMFSVMRETVLSFGYEE
                                    *  :                                    

SYH_CHLMU       IRTPVFEKTETFLR-VGEHSDIVKKEVYTFLDK-KGRS----------------------
SYH_CHLTR       IRTPVFEKTETFLR-VGEYSDIVKKEVYTFLDK-KRRS----------------------
SYH_CHLPN       IRTPIFEKSEVFLH-VGEESDVVKKEVYSFLDR-KGRS----------------------
SYH_CHLTE       IRTPVFEYTELFQRGIGATTDIVGKEMFTFLPDPNGRS----------------------
SYH_COREF       IELPIFEETGLFARGVGESTDVVSKEMYTFADRGERS-----------------------
SYH_CORGL       IELPIFEDTGLFARGVGESTDVVSKEMYTFADRGERS-----------------------
SYH_MYCLE       IELPVFEDTALFARGVGESTDVVAKEMYTFADRGDRS-----------------------
SYH_MYCTU       IELPIFEDTALFARGVGESTDVVSKEMYTFADRGDRS-----------------------
SYH_STRCO       IETPGFENVELFARGVGESTDIVTKEMYVFETKGGDR-----------------------
SYH_DEIRA       IDTPMFEEAELVKRGVGGSTDIVRKEMFTVYYFGDHGG----------------------
SYH_THET8       LVTPIFEETQVFEKGVGAATDIVRKEMFTFQDRGGRS-----------------------
SYH_CLOPE       IRTPMFEATELFKRGVGETTDVVQKEMYTFEDK-GGRS----------------------
SYH_CALS4       IRTPGFEHTELFLRGVGESTDIVRKEMYTFNDR-SGRS----------------------
SYH_THEMA       IRTPIFEQTELFVRSVGEESDIVQKEMYTFQDK-AGRS----------------------
SYH_FUSNN       VKTPIFEETELFKRGIGEATDVVEKEMYTFKDR-GDRS----------------------
SYH_AQUAE       IILPVVEYAELFQRSVGETTDIVQKEMFVFEDR-KGRK----------------------
SYH_BACHD       IRVPMFEHTELFLRGVGDTTDIVQKEMYTFEDR-GGRS----------------------
SYH_BACSU       IRTPIFEHTELFARGVGESTDIVQKEMYTFEDR-KGRS----------------------
SYH_OCEIH       IRTPLFEHTEVFQRGVGDTTDIVQKEMYTFEDR-GGRS----------------------
SYH_LISIN       IRTPIFEHTELFERGVGDSTDIVSKEMYTFLDK-GGRS----------------------
SYH_LISMO       IRTPVFEHTELFERGVGDSTDIVSKEMYTFQDK-GGRS----------------------
SYH_STAAM       IRTPIFESTDLFARGVGDSTDVVQKEMYTFKDK-GDRS----------------------
SYH_STAES       IRTPIFESTELFARGVGDSTDVVQKEMYTFKDK-GDRS----------------------
SYH_STRA3       IRTPMFEHYEVISRSVGDTTDIVTKEMYDFHDK-GDRH----------------------
SYH_STRP3       IRTPMFEHYEVISRSVGDTTDIVTKEMYDFYDK-GDRH----------------------
SYH_STRP8       IRTPMFEHYEVISRSVGDTTDIVTKEMYDFYDK-GDRH----------------------
SYH_STRP1       IRTPMFEHYEVISRSVGDTTDIVTKEMYDFYDK-GDRH----------------------
SYH_STREQ       IRTPMFEHYEVISRSVGDTTDIVTKEMYDFYDK-GDRH----------------------
SYH_STRMU       IRTPMFERYEVISRSVGDTTDIVTKEMYDFHDK-GDRH----------------------
SYH_STRPN       VRTPIFEHYEVISRSVGDTTDIVTKEMYDFYDK-GDRH----------------------
SYH_STRR6       VRTPIFEHYEVISRSVGDTTDIVTKEMYDFYDK-GDRH----------------------
SYH_LACLA       IRTPMFESYELFSRATGETSDIVTKEMYDFEDK-GGRH----------------------
SYH_LACPL       IRTPMFENFEVFSRSAGDTSDIVTKEMYDFHDK-GDRH----------------------
SYH_SALTI       IRLPIVEQTPLFKRAIGEVTDVVEKEMYTFEDR-NGDS----------------------
SYH_SALTY       IRLPIVEQTPLFKRAIGEVTDVVEKEMYTFEDR-NGDS----------------------
SYH_ECOLI       IRLPIVEQTPLFKRAIGEVTDVVEKEMYTFEDR-NGDS----------------------
SYH_YERPE       IRMPIVEQTPLFKRAIGEVTDVVEKEMYTFDDR-NGES----------------------
SYH_VIBPA       VRMPIVEETNLFSRAVGEETDVVSKEMYTFDDR-NGDS----------------------
SYH_VIBVU       MRMPIVEMTHLFSRAIGEVTDVVEKEMYTFEDR-NGDS----------------------
SYH_VIBCH       VRMPIVEMTHLFSRAIGEVTDVVEKEMYTFEDR-NGDS----------------------
SYH_HAEIN       VRMPIVESTPLFARAIGEVTDVVSKEMYTFWD--NDEQ----------------------
SYH_PASMU       VRMPIVESTPLFARAIGEVTDVVSKEMYTFWD--NDEQ----------------------
SYH_SHEON       IRTPIVENTDLFKRSIGEVTDIVEKEMYTFEDR-NGDS----------------------
SYH_PSEPK       IRTPIVEFTELFKRSIGEVTDIVEKEMYTFEDR-NGDS----------------------
SYH_PSESM       IRMPVVEFTDLFKRSIGEVTDIVEKEMYTFADR-NGDS----------------------
SYH_PSEAE       IRLPILEFTELFARGIGEGTDVVDKEMYTFLDR-NGES----------------------
SYH_NEIMA       IRTPIVEQTGLFVRSIGEETDVVGKEMYTFSDSNDSLS----------------------
SYH_NEIMB       IRTPIVEQTGLFVRSIGEETDVVGKEMYTFSDSNDSLS----------------------
SYH_RALSO       IRTPIVEQTQLFVRGIGEVTDIVEKEMYSFTDALNGEQ----------------------
SYH_THEEB       ICTPIFEQTPLFERGIGEATDIVSKEMYTFRDR-AQRS----------------------
SYH_SYNY3       IRTPIFEQTSLFERGIGEATDVVGKEMYSFTDR-GDRP----------------------
SYH_PORPU       IKTPIFENSDLYDRGIGENTDIVNKEMYRFNDR-SNRD----------------------
SYH_BUCAI       IRLPILEKTEIFKRAIGNVTDVVEKEMYSFNDR-KGNN----------------------
SYH_BUCAP       IRLPILEKTKIFQRAIGNITDVVEKEMYSFKDK-KGNS----------------------
SYH_BUCBP       IRFPLIEKTSLFAHSIGNITDIIEKEMYSFKDK-KNKK----------------------
SYH_WIGBR       IRFPIMEFAKLFSKAIGDDNIVVNKEMYIFLDK-NKHE----------------------
SYH_RICCN       MSTPIVEYTKVFNRSMGESSDVISKEIYSFLDK-SNDF----------------------
SYH_RICPR       MSTPILEYTKVFNRSMGESSDVMSKEIYSFVDK-SNNA----------------------
SYH_CAMJE       INTPHLELCTLFKRSVGESSDIVGKEMYEFIDK-GENH----------------------
SYH_MYCGE       VKTPLFENAQLFQRSN-ANADIVQKELYQFFDK-SQRE----------------------
SYH_MYCPN       VKTPLLEYAEAFKRTN-ANADIVKKELYEFHDK-SNRL----------------------
SYH_MYCPE       IKTPIFEHKELYIRNIGESSDIVTKEFYDFKDK-SDRE----------------------
SYH_UREPA       IKTPVFEFAELFMKSAGESSDLVSKEMYLFKDK-SDRW----------------------
SYH_MYCPU       LETPIIENVELFKRTSGDFSDLVKKELYSFEDK-SKRQ----------------------
SYH_METAC       IITPTFEHLDLFTLKSGEG---IVGELYNFTDK-GGRD----------------------
SYH_METMA       IITPTFEHLDLFTLKSGEG---IIGELYNFTDK-GGRE----------------------
SYH_ARCFU       VATPTFEYLELFTRKSGEG---IIEEMYVFKDK-SGRD----------------------
SYH_METJA       ILTPTFESFELIAKKTGEE---IRKQLYVFKDH-GGRE----------------------
SYH_METTH       IKTPIFEELKLFTVKSGEE---VVNQIYHFTDK-GGRE----------------------
SYH_METKA       VLTPTFEHAKLFEEKSGEE---ILEEMYVFKDK-KGRK----------------------
SYH_PYRAB       VLTPVMEYTKLFQLRSGEE---VVKQLYAFKDK-GGRD----------------------
SYH_PYRHO       ILTPVMEYTKLFQLRSGEE---VVKQLYAFKDK-GGRD----------------------
SYH_PYRFU       VLTPTMEYTKLFELRSGEE---VVKQLYAFKDK-GGRD----------------------
SYH_SACS2       IITPVVEEFKLFELKGGEE---LRQTMYVFKDK-ADRE----------------------
SYH_SULTO       VETPIVEDFQLFALKGGEE---LRNTMYVFKDK-AGRE----------------------
SYH_PYRAE       VETPVVEHFEVLAKKAGQD---VINEIYYFKDK-AGRD----------------------
SYH_THEAC       IDFPSLEYLDLYRIKSGEE---LLQQTYSFVDK-GGRE----------------------
SYH_THEVO       IDFPSLEYIDLYRIKSGEE---LLNQTYSFTDR-GGRE----------------------
SYH_HALSA       VGTPAMERTEMYVDKSGAE---IVDELYSFTDQ-GGRD----------------------
SYH_AGRFC       IETPLFEYTDALGKFL-PDSDRPNEGVFSLQDDDDQ------------------------
SYH_RHIME       VETPLFEYTDALGKFL-PDSDRPNEGVFSLTDDDDQ------------------------
SYH_BRUME       VETPLVEYTDALGKFL-PDQDRPNEGVFSFQDDDEQ------------------------
SYH_BRUSU       VETPLVEYTDALGKFL-PDQDRPNEGVFSFQDDDEQ------------------------
SYH_RHILO       ADQPLIEYTDALGKFL-PDQDRPNEGVFSFQDDDEQ------------------------
SYH_BRADU       VETPAMEYTDALGKFL-PDQDRPNEGVFSFQDDDEQ------------------------
SYH_CAUVC       LDTGAFEYADALGKFL-PDSDRPNEGVFALQDDDDQ------------------------
SYH_CLOAB       MDTPIIEKEEVLLAKS--AGETE-KQVYRIDNEDR-------------------------
SYH_CLOTE       LDTPTIEKSEILLAKG--GGETE-KQIYRFNKGNT-------------------------
SYH_XANAC       VETPVFELSDVLLTKS--GGETE-RQVYFVQSTGAL----------ANAAAAADEGAENG
SYH_XANCP       VETPVFELSDVLLTKS--GGETE-RQVYFVQSTGAL----------ANAAAAADEGAESG
SYH_XYLFA       VETPVFELSDVLLTKS--GGETE-RQVYFVQSTGTL----------ANAAESGATR----
SYH_XYLFT       VETPVFELSDVLLTKS--GGETE-RQVYFVQSTGTL----------ANAAESGATR----
SYH_NOSS1       IETPAVERLEVLQAK---GNQGD-NIIYGLEPILPP----------NRQAEKDKSG--DT
SYH_BIFLO       IETRAVETGASLLKK----GETS-KEIYLLSRLQEV----------GHESDTPIEE----
SYH_HELPY       IETPHLEYAQTLLPDA--SSDIQ-KEIYRFKDHGDR------------------------
SYH_HELPJ       IETPHLEYAQTLLPDA--SSDIQ-KEIYRFKDHGDR------------------------
SYH_BACTN       IETPSMEMLSTLMGKY--GDEGD-KLLFKIQNSGDYFSGITDEELLSRNAVKLASK----
SYH_AERPE       LDTPAVEYWETLSGKY--GEEAESRLIWRFQDP---------------WSGRWYA-----
SYH_BORBU       IDTPVLEYSDLLLKKSGDE---TEKQIYRFKDN-GGRD----------------------
SYH_TREPA       IDTPALEYTEVLLRKSEGD---TEKQMFRFVDK-GGRD----------------------
SYH_LEPIN       YDGPILESFDLYKAKSGEE--IVERQLYDFIDKGERR-----------------------
                     .*                    : .                              

SYH_CHLMU       ----LTLRPEGTAAVVRALLDHSADM--RKD-NKIYYILPMFRYERQQSGRYRQHHQFGL
SYH_CHLTR       ----LTLRPEGTAAVVRALLDHSADM--RKD-NKFYYILPMFRYERQQSGRYRQHHQFGL
SYH_CHLPN       ----MTLRPEGTAAVVRSFLEHGASH--RSD-NKFYYILPMFRYERQQAGRYRQHHQFGV
SYH_CHLTE       ----LTLRPEMTAGVMRACLQKNLLS--QAPVHKLWYISDLFRKERPQAGRQRQFTQFGA
SYH_COREF       ----VTLRPEGTAGVMRAVIEHSLDR--GQLPVKLNYAGPFFRYERPQAGRYRQLQQVGV
SYH_CORGL       ----VTLRPEGTAGVMRAVIEHSLDR--GQLPVKLNYAGPFFRYERPQAGRYRQLQQVGV
SYH_MYCLE       ----VTLRPEGTAGVVRAVIEHGLDR--GALPVKLCYAGPFFRYERPQAGRCRQLQQVGV
SYH_MYCTU       ----VTLRPEGTAGVVRAVIEHGLDR--GALPVKLCYAGPFFRYERPQAGRYRQLQQVGV
SYH_STRCO       ----LALRPETTAPVLRAVLEANLHKA-GNLPVKVWYSGSQYRYERPQKGRYRHFSQVGA
SYH_DEIRA       ----YVLRPEGTASIVRAYLENGLKQ--LPAPLKLWTSGPMFRAERHQKGRYRQFTQVDY
SYH_THET8       ----LTLRPEGTAAMVRAYLEHGMKV--WPQPVRLWMAGPMFRAERPQKGRYRQFHQVNY
SYH_CLOPE       ----ITLKPEGTAPAVRAFIENSLYADAQP--TKMFYFTPCFRYEKMQKGRLREFHQYGI
SYH_CALS4       ----ITLKAEGTSPAVRAFIEHGLYAETQP--TKLYYITPVYRYEKPQAGRLREHHQFGV
SYH_THEMA       ----ITLRPEGTAPVVRAFLENSLIDRGFQ--QRYYYIGPMFRYEKPQSGRLRQFHQVGF
SYH_FUSNN       ----ITLRPENTASLVRCYLENAIYAKEEI--SRFYYNGSMFRYERPQAGRQREFNQIGL
SYH_AQUAE       ----LALRPEGTAGTVRAFIQHKLYALRPY--VKLFYEGPMFRYERPQAGRYRQFHQIGA
SYH_BACHD       ----LTLRPEGTASVTRAYVSNKLYGQANQ-PTKLFYIGPMFRYERPQSGRMRQFVQFGV
SYH_BACSU       ----LTLRPEGTAAAVRAFNENKLFANPVQ-PTKLYYVGPMFRYERPQTGRYRQFYQFGI
SYH_OCEIH       ----LTLRPEGTASVARAYVENKLFGSPNQ-PTKLFYFGSMFRYERPQKGRMRQLNQFGT
SYH_LISIN       ----LTLRPEGTASVVRAFVEHKLYGEVSQ-PIKMYYNEPMFRYERPQGGRQRQFTQMGI
SYH_LISMO       ----LTLRPEGTASVVRAFVEHKLYGEVSQ-PIKMYYNEPMFRYERPQGGRQRQFTQMGI
SYH_STAAM       ----ITLRPEGTAAVVRSYIEHKMQGNPNQ-PIKLYYNGPMFRYERKQKGRYRQFNQFGV
SYH_STAES       ----LTLRPEGTAAVVRSYIEHKMQGEPNQ-PIKLYYNGPMFRYERKQKGRYRQFNQFGV
SYH_STRA3       ----ITLRPEGTAPVVRSYVENKLFAPEVQKPTKMYYIGSMFRYERPQAGRLREFHQVGV
SYH_STRP3       ----ITLRPEGTAPVVRSYVENKLFAPEVQKPVKLYYIGSMFRYERPQAGRLREFHQIGV
SYH_STRP8       ----ITLRPEGTAPVVRSYVENKLFAPEVQKPVKLYYIGSMFRYERPQAGRLREFHQIGV
SYH_STRP1       ----ITLRPEGTAPVVRSYVENKLFAPEVQKPVKLYYIGSMFRYERPQAGRLREFHQIGV
SYH_STREQ       ----ITLRPEGTAPVVRSYVENKLFAPEVQKPVKLYYIGSMFRYERPQAGRLREFHQIGV
SYH_STRMU       ----ITLRPEGTAPVVRSYVENKLFAPEVQKPVKVFYIGSMFRYERPQAGRLREFHQLGV
SYH_STRPN       ----ITLRPEGTAPVVRSYVENKLFAPEVQKPSKFYYMGPMFRYERPQAGRLRQFHQIGV
SYH_STRR6       ----ITLRPEGTAPVVRSYVENKLFAPEVQKPSKFYYMGPMFRYERPQAGRLRQFHQIGV
SYH_LACLA       ----IALRPEGTASAVRAYIENKLYAPEVVKPVKLWYDAPMFRYERPQSGRLRQFHQFGV
SYH_LACPL       ----ITLRPEGTAGVVRAFVENKLYGPQVLKPYKVYYMGPMFRYERPQSGRLREFHQLGV
SYH_SALTI       ----LTLRPEGTAGCVRAGIEHGLLYN-QE--QRLWYIGPMFRHERPQKGRYRQFHQLGA
SYH_SALTY       ----LTLRPEGTAGCVRAGIEHGLLYN-QE--QRLWYIGPMFRHERPQKGRYRQFHQLGA
SYH_ECOLI       ----LTLRPEGTAGCVRAGIEHGLLYN-QE--QRLWYIGPMFRHERPQKGRYRQFHQLGC
SYH_YERPE       ----LTLRPEGTAGCVRAGIEHGLLYN-QE--QRLWYIGPMFRYERPQKGRYRQFHQLGA
SYH_VIBPA       ----LTLRPEGTAGCVRSCIQNSLINR-DE--QRLWYMGPMFRHERPQKGRYRQFHQCGV
SYH_VIBVU       ----LTLRPEGTAGCVRAGIENGLLYN-QE--QRVWYMGPMFRHERPQKGRYRQFHQCGV
SYH_VIBCH       ----LTLRPEGTAGCVRSGIENGLLYN-QE--QRLWYMGPMFRHERPQKGRYRQFHQCGV
SYH_HAEIN       ----LTLRPEGTAGCVRAAIEHGWIYN-NE--QRLWYIGPMFRHERPQKGRYRQFHQVGV
SYH_PASMU       ----LTLRPEGTAGCVRAAIEHGWIYN-QE--QRLWYMGPMFRHERPQKGRYRQFHQAGV
SYH_SHEON       ----LTLRPEGTASTVRAGNEHGLLYN-QE--QRLWYMGPMFRHERPQKGRYRQFHQFGV
SYH_PSEPK       ----LTLRPEGTAACVRAVLEHGITGNGQV--QKLWYIGQMFRHERPQKGRYRQFHQIGV
SYH_PSESM       ----LTLRPEGTAACVRAVLEHGITGGGQV--QKLWYIGPMFRHERPQKGRYRQFHQIGV
SYH_PSEAE       ----LTMRPEGTAGCVRAVLEHGLSGGGQV--QKLWYTGPMFRYEKPQKGRYRQFHQIGV
SYH_NEIMA       ----LSLRPEGTASCLRAVVEHNFLYN-SP--QKLWYMGPMFRRERPQKGRYRQFHQVGI
SYH_NEIMB       ----LSLRPEGTASCLRAVVEHNLLYN-SP--QKLWYMGPMFRRERPQKGRYRQFHQVGI
SYH_RALSO       ----LTMRPEGTAAAVRAVIEHNLLYD-GP--KRLWYTGPMFRHEKPQRGRYRQFHQVGV
SYH_THEEB       ----LTLRPEGTAGVVRAYIEHGLHSQGGV--QRLWYLGPMFRYERPQSGRYRQFHQLGV
SYH_SYNY3       ----ITLRPEGTAGVVRAYIEQNLQAAGGV--QRLWYTGPMFRYERPQAGRQRQFHQLGV
SYH_PORPU       ----ITLRPEGTAGVVRAFIENRMDVQNRL--QKLWYSGPMFRYERPQSGRQRQFHQLGI
SYH_BUCAI       ----LTLRPEGTVGCVRAIIQNNLLQ--KS--NKFWYLGPMFRYERPQKGRYRQFYQLGA
SYH_BUCAP       ----LTLRPEGTVGCVRAIIENNLLFQ-KK--QRFWYLGPMFRYERPQKGRYRQFYQLGV
SYH_BUCBP       ----ITLRPEGTIGCMRACINKGLLRT-SK--QKLWYLGPMFRYERPQHGRYRQFHQFGI
SYH_WIGBR       ----LALRPEGTAGCVRSCIFNKLLKN-NI--TRLWYMGPMFRYERPQKGRQRQFSQLGI
SYH_RICCN       ----VALRPEFTACIIRSLISNRLQHK-LP--LKFFSTGPVFRYDRPQAGRQRQFHQLNY
SYH_RICPR       ----VALRPEFTSGIIRSFISNGLQHK-LP--LKFFSTGPVFRYDRPQAGRQRQFHQLNY
SYH_CAMJE       ----VCMRPEGTAGVVRAYIEKKLDKNTSV--KRWFYYGSMFRYERPQKGRLREFHQFGV
SYH_MYCGE       ----LALRPEATTPIVRLACENKLMQEANF-PLKLFCIGSMYRYERPQNNRFREHWQFSC
SYH_MYCPN       ----LALRPEATAGIVRLVCENKLLQPQNY-PLRLFTIGTMYRYERPQSNRYREHYQFSC
SYH_MYCPE       ----LALRPENTVGVIRSVVENKLLYTNPF-PLKFYYLGPMFRYERPQSGRNRQFYQFGI
SYH_UREPA       ----LALRPEGTAGVIRAVVENKLLLNHPL-PLKLMYFEPCFRYERPQAGRQRQFHQFGV
SYH_MYCPU       ----IALRPEGTAPALRAIVENNLLQKHN----KFFYFGPMFRYENPQKGRQRQFFSGGI
SYH_METAC       ----MTLRPELTAPVMRLYVNELQPFP-KP--LKLFYFENCFRYERPQKGRFREFWQFGV
SYH_METMA       ----MTLRPELTAPVMRFYVNELQPFP-KP--LKLFYFENCFRYERPQKGRFREFWQFGV
SYH_ARCFU       ----LALRPELTAPVMRMFVNECSVMP-KP--LRFYYFANCFRYERPQKGRYREFWQFGV
SYH_METJA       ----MALRPEMTSPVVRFYLNELKNLQ-KP--LRLYYFANCFRYERPQAGRFREFWQMGC
SYH_METTH       ----LALRPELTAPVARLYMNEMQKKP-KP--IKMYYFGSCFRYERPQAGRFRQFWQFGC
SYH_METKA       ----LALRPEMTAPVVRFYNAELKTRP-HP--LKLAYIVNCFRYEQPQRGRWREFWQAGV
SYH_PYRAB       ----VALRPDMTSSVARLYVNSFQTAP-KP--IKWYYIANMFRYEEPQSGRYREFWQAGV
SYH_PYRHO       ----VSLRPDMTSSVARLYVNSFQMAP-KP--IKWYYIANMFRYEEPQSGRYREFWQAGV
SYH_PYRFU       ----VSLRPDMTSSVARLYVNMFQTAP-KP--IKWYYIANMFRYEEPQSGRYREFWQAGV
SYH_SACS2       ----ISLRPEITPSVARAYIQNLQSSP-KP--IRLFYFGTVYRYDEPQYGRYREFRQAGI
SYH_SULTO       ----VALRPEFTPSIVRFYLNSLQHLP-KP--IRLYYLGTVYRYDEPQFGRYREFRQAGI
SYH_PYRAE       ----LGLRFDMTVPVARVLSYNLE-LP-RP--VRWYYFTKVFRYDEPQHGRYREFYQFGV
SYH_THEAC       ----VTLIPEATPSTVRMVTSRKD----LQRPLRWYSFPKVWRYEEPQAGRYREHYQFNA
SYH_THEVO       ----VTLIPEATPSTVRMLTSRKD----IAKPVRWYSFPKVWRYEEPQAGRFREHYQFNA
SYH_HALSA       ----VALTPELTPTVARMVVAKQQA---LSKPIKWYSSRPFWRYEEPQQGRFREFYQTNL
SYH_AGRFC       ---WMSLRYDLTAPLARHVAENFNE---IQLPYRTYRAGYVFRNEKPGPGRFRQFMQFDA
SYH_RHIME       ---WLSLRYDLTAPLARHVAENFNE---IQLPYRTYRAGYVFRNEKPGPGRFRQFMQFDA
SYH_BRUME       ---WLSLRYDLTAPLARYVAENFET---LPKPYRSYRNGWVFRNEKPGPGRFRQFMQFDA
SYH_BRUSU       ---WLSLRYDLTAPLARYVAENFET---LPKPYRSYRNGWVFRNEKPGPGRFRQFMQFDA
SYH_RHILO       ---WLSLRYDLTAPTARFVAENYER---LPKPYRSYRSGWVFRNEKPGPGRFRQFMQFDA
SYH_BRADU       ---WISLRYDLTAPLARYVGERYGTDG-LVLPYRSYRVGYVFRNEKPGPGRFRQFMQFDA
SYH_CAUVC       ---WMALRYDLTAPLARFAAQNWET---LPKPFRRYAFGPVWRNEKPGPGRFRQFIQCDA
SYH_CLOAB       ---KQVLRFDLTVPFSRFAAQYMSD---LTFPFKRYQLGKVYRGERNQKGRYREFYQCDV
SYH_CLOTE       ---DLSLRFDLTVPLARYVSQHFSD---LNFPFRRYHISKVFRGERNQKGRFREFYQCDI
SYH_XANAC       GLPELALRFDLTVPLARYVAEHEHD---LSFPFRRYQMQRVYRGERAQRGRFREFYQCDI
SYH_XANCP       GLPELALRFDLTVPLARYVAEHEHE---LSFPFRRYQMQRVYRGERAQRGRFREFYQCDI
SYH_XYLFA       -LPELALRFDLTVPLARYVAEYEHV---LAFPFRRYQMQRVYRGERAQRGRFREFYQCDI
SYH_XYLFT       -LPELALRFDLTVPLARYVAEYEHV---LAFPFRRYQIQRVYRGERAQRGRFREFYQCDI
SYH_NOSS1       GSEARALKFDQTVPLAAYIARHLND---LTFPFARYQMDVVFRGERAKDGRFRQFRQCDI
SYH_BIFLO       ---RLGLHFDLTVPLSRYVVEHSGA---LAFPFKRWQIQKVWRGERPQEGRFREFVQADI
SYH_HELPY       ---DVALRFDLTVPLARFVSLHHQT---LGMPFKRYAIGNVFRGERAQKGRYREFTQCDF
SYH_HELPJ       ---DVALRFDLTVPLARFVSLHHQI---LGMPFKRYAIGNVFRGERAQKGRYREFTQCDF
SYH_BACTN       -FCEKGLRYDLTVPFARYVVMHRDE---ITFPFKRYQIQPVWRADRPQKGRYREFYQCDA
SYH_AERPE       ------LRYDLTVPLARFVASNPG----LPMPFKRYHIGKVWRHEEPQKGRYREFVQCDA
SYH_BORBU       ----VSMRFDLTVPFARFVATNISA---LKLPFRRSQFGKVFRGENSQKGRYREFMQFDF
SYH_TREPA       ----VALRFDLTVPLARFVATHYAR---LYFPFKRYHFAKVWRGEKPQMGRYREFTQCDF
SYH_LEPIN       ----VAIRPEMTPTLARMVAGNLRN---LPKPVRWFSIPNLWRYEQPGKGRLREHWQLNV
                      :  : *                             :* :.   .* *.  . . 

SYH_CHLMU       EAIGVR--HPLRDAEVLSLLW-DFYAAV-----GLKH--MQIQVNFLGGRKTRARYDEAL
SYH_CHLTR       EAIGVR--HPLRDAEVLSLLW-DFYAAV-----GLQH--MQIHVNFLGGQKTRARYDEAL
SYH_CHLPN       EAIGVR--HPLRDAEVLALLW-DFYSRV-----GLQH--MQIQLNFLGGSETRFRYDKVL
SYH_CHLTE       ELLGVS--NPAAVAEVLTLMM-QVFETL-----GLHG--LRLRINSLGDLDDRARYREAL
SYH_COREF       EAIGVD--DPALDAEIIALAD-RSYRSL-----GLTG--FRLELTSLGDSNCRPAYRQKL
SYH_CORGL       EAIGVD--DPALDAEIIALAD-RSYRSL-----GLQD--FRLELTSLGDRHCRPEYRQKL
SYH_MYCLE       EAIGVD--DPALDAEVITIAD-AGFRSL-----GLDG--FQLEITSLGDGTCRPQYRKLL
SYH_MYCTU       EAIGVD--DPALDAEVIAIAD-AGFRSL-----GLDG--FRLEITSLGDESCRPQYRELL
SYH_STRCO       EAIGAE--DPALDAELIILAD-QSYRAL-----GLQD--FRILLNSLGDQECRPVYRAAL
SYH_DEIRA       EVLGSA--DALVDAEAIALMV-AVVQKL-----GLRG--VRVKLGSIGDPEDRERYNAYL
SYH_THET8       EALGSE--NPILDAEAVVLLY-ECLKEL-----GLRR--LKVKLSSVGDPEDRARYNAYL
SYH_CLOPE       EVFGSQ--EASIDAEILSLVMRALTEDF-----GIKG--LSLNINSLGCPKCRAKFNEAL
SYH_CALS4       EIFGAK--SASADAEVISIAM-TLLKKL-----GLNN--LELRINSVGCPVCRKNYNKVL
SYH_THEMA       EIIGPE--SPKADFEVIMLVD-TFLRRL-----GLTK--YKIHLNSIGCPVCRKNYREAL
SYH_FUSNN       EVFGEK--SPKVDAEVIAIGY-KFLEKL-----GITD--LEVKINSVGSKASRTVYREKL
SYH_AQUAE       EVFGVA--EPHADAEIIKIVY-DILQAL-----GIKG--VVVEINSLGCKKDREAYREAL
SYH_BACHD       EALGSA--DPAIDAEVLALVM-RFYEEL-----GLKN--LKLVINSLGDTDSRLAHREAL
SYH_BACSU       EAIGSK--DPAIDAEVMALAM-SIYEKA-----GLEN--VKLVINSLGDQDSRKSYREAL
SYH_OCEIH       EVIGSE--DPAVDAEVMDFAM-NIYKSL-----GLKS--VKLVINSLGDQESRESHRNAL
SYH_LISIN       EALGSD--DPSIDVEVISLAM-EFFRKI-----GLTN--IKLVINSLGDKESRLKHREAL
SYH_LISMO       EALGSD--DPSIDVEVISLAM-EFFRKI-----GLTN--IKLVINSLGDKESRLKHREAL
SYH_STAAM       EAIGAE--NPSVDAEVLAMVM-HIYQSF-----GLKH--LKLVINSVGDMASRKEYNEAL
SYH_STAES       EAIGAE--NPSIDAEILAMVM-HIYESF-----GLKH--LKLVINSIGDSESRKEYNEAL
SYH_STRA3       ECFGSN--NPATDVETIAMGH-HLFEDL-----GIKN--VKLHLNSLGNPESRQAYRQAL
SYH_STRP3       ECFGAA--NPATDVETIAMAY-HLFEKL-----GIKD--VTLHLNSLGSPESRSAYRQAL
SYH_STRP8       ECFGAA--NPATDVETIAMAY-HLFEKL-----GIKD--VTLHLNSLGSPESRAAYRQAL
SYH_STRP1       ECFGAA--NPATDVETIAMAY-HLFEKL-----GIKD--VTLHLNSLGSPESRAAYRQAL
SYH_STREQ       ECFGSA--NPATDVETIAMAY-HLFERL-----GIKG--VTLHLNSLGNAASRAAYRQAL
SYH_STRMU       ECFGSN--NPAIDAETIAMAY-QLFNEL-----GIKD--VTLHLNSLGNKESRKAYRQAL
SYH_STRPN       ECFGSS--NPATDVETIAMAA-HFLKEI-----GIQG--VKLHLNTLGNPESRAAYRQAL
SYH_STRR6       ECFGSS--NPATDVETIAMAA-HFLKEI-----GIQG--VKLHLNTLGNPESRAAYRQAL
SYH_LACLA       ECLGVK--NPAVDVEIIAMAD-TLFRQL-----GITG--LKLALNTLGDMESRMAYRQAL
SYH_LACPL       EAFGSE--SAALDVEVIAMGY-NLLKTF-----GLTD--LKLVINTLGDQQTRDDYRQAL
SYH_SALTI       EVFGLQ--GPDIDAELIMLTA-RWWRAL-----GISEH-VSLELNSIGSLEARANYRDAL
SYH_SALTY       EVFGLQ--GPDIDAELIMLTA-RWWRAL-----GIAEH-VSLELNSIGSLEARANYRDAL
SYH_ECOLI       EVFGLQ--GPDIDAELIMLTA-RWWRAL-----GISEH-VTLELNSIGSLEARANYRDAL
SYH_YERPE       EVFGLP--GPDIDAELILLTA-RWWRAL-----GIFEH-VKLELNSIGSLAARADYREAL
SYH_VIBPA       EVFGLN--GPDVDAELIMMTA-RLWREL-----GIDKH-VRLELNSIGSQEDRADYRTAL
SYH_VIBVU       EVFGLN--GPDVDAELIMMTA-RLWREL-----GIDKH-VRLELNSIGSLEARANYRTAL
SYH_VIBCH       EVFGLD--GPDVDAELIMMTA-RLWREL-----GIAQH-VRLELNSIGSLEARANYRTAL
SYH_HAEIN       EVFGIA--NPEIDAELIMLTY-RLWKAL-----GIDQH-VTLQLNSIGSLEARANYRSAL
SYH_PASMU       EVFGIP--NPEIDAELIMLTA-RLWKEL-----GIAEH-VTLQLNSIGSLEARKNYRSAL
SYH_SHEON       EIYGIG--SADIDAEVLMLSA-RLWEKL-----GITEH-VTLELNTLGDPAERAAYREAL
SYH_PSEPK       EVFNLD--GPDIDAELIMLTW-RLWGLL-----GIQDA-VKLELNSLGTSEARARYRDAL
SYH_PSESM       EVFNLD--GPDIDAELIVMTW-RLWGML-----GIRNA-VKLELNSLGTSEARARYRDAL
SYH_PSEAE       EVFNLP--GPDIDAELIILTW-RLWQKL-----GMADA-VTLQLNTLGSSEARARYREAL
SYH_NEIMA       EALGFE--GPDIDAEIIAMSA-DLWEKL-----GIREY-LTLEINSLGNREERAAHRAAL
SYH_NEIMB       EALGFE--GPDIDAEIIAMSA-DLWEKL-----GIREY-LTLEINSLGNREERAAHRAAL
SYH_RALSO       EALGFA--GPDIDAEVILMCQ-RLWDDL-----GLVG--LKLELNSLGQAEERAAHRADL
SYH_THEEB       EVLGSA--DPRADAEVIAVAL-DILQAL-----GLKQ--LTLMLNSVGDREDRSAYRQAL
SYH_SYNY3       EVLGSA--DPRADVEVIALGT-DILKAL-----GLSN--LSLALNSVGNGGDRQRYREAL
SYH_PORPU       EFIGSS--DARADAEIIHLAM-NIFNDL-----SVND--LQLDINSIGKAEDRNHYQAKL
SYH_BUCAI       EVFGLD--TEDIDLEIIILTN-RLWKRI-----GIDSF-ITLEVNSIGSKIDRVQYKKEL
SYH_BUCAP       EVFGLN--TPDIDLEIILLIS-RLWKCL-----GINLH-IKLEINSIGSKLDRIKYQKEL
SYH_BUCBP       EVLGMS--GPDIDLEIILLVE-RILRTL-----NISNY-VQLELNSIGSYESRLHYKKIL
SYH_WIGBR       EIFGSD--SYSAEFELISISN-RIWKSL-----NINKH-VYLELNSIGNLQERQTYQIEL
SYH_RICCN       EYIGAK--GAITDADTLKLAV-DILKAL-----EIEQD-TTLELNSLGCNESRSVYQQKL
SYH_RICPR       EYLGAK--GAITDAETVKLAV-DILKAL-----EIEED-TTLELNSLGCHESRIVYQQKL
SYH_CAMJE       ESLGIP--NVYEDASIILMLV-EIFSRL-----GID---FKLQLNSLGCSQCLPKYRDRL
SYH_MYCGE       EVFGFS--NLFIFLDTLLFAN-SLLEAL-----GITG--YVLKINNLANFETLSKWNKAL
SYH_MYCPN       EVIGDT--NPTVLLDTLLLGH-AIIQQL-----GIEG--VILKLNNLGNSATIQQWNQAL
SYH_MYCPE       EFIGVK--NILNEIEGILFAL-DILKKL-----NITN--WKLKVNYIGSIETREKWINSL
SYH_UREPA       EVLGTK--NIYYDFELIALAD-TILKKL-----MISN--YILEINYISSPHNRSLWVKSL
SYH_MYCPU       EWLEKQ--SPFTNIEIIFFAK-NFLDTL-----KIDD--YEIVINWIGHPEQRKNYLDHL
SYH_METAC       ELIGSG--KSDSDAEVIALAD-ALLKAV-----GIQ---GDMKLGNLAVIRTLLK--GLE
SYH_METMA       ELIGSG--KSDSDAEVIALAS-ALLKAV-----GIK---GDMKLGNLAVIRTLLK--GLE
SYH_ARCFU       ELIGSE--SYLADAEVIILAD-KILKDV-----GVN---FSLEIGHVGIMRHLLK--PIG
SYH_METJA       ELIGCK--EPLADAEVLNLAM-DGLINI-----GLD---FDVHIGHLGVLKGVLEKFNVS
SYH_METTH       ELIGGR--SPLAEAEVISLAS-ESLHEL-----GLDG--FEVHIGHLGILRGILGREEIP
SYH_METKA       EVFGSD--RPEADVEVIELTY-RIFDGI-----LPSGA-FEVRVGHLGILRGLLEEYGIG
SYH_PYRAB       ELIGSD--KIEADAEVIALFV-DSYLST-----GLKD--FTVNIGDRVLLDEFAKMLGVK
SYH_PYRHO       ELIGSD--KVEADAEVIALFV-ESYLST-----GLRD--FTVNIGDRILLDEFAGMLGVS
SYH_PYRFU       ELIGSD--KVEADAEVIALFV-ESYLAT-----GLRE--FTVNIGDRILLDEFAKMLGVK
SYH_SACS2       EMIGDS--SILADVEVLDLLY-NFYDKL-----NLSKD-ITIKINNIGIFRKIMDKYNIE
SYH_SULTO       ELLGSS--NIYSDLEILQILI-EIYREL-----NLINK-IRLKINNISLIRKILNKLNIS
SYH_PYRAE       ELVGSS--SPRADAEVIQLLI-ASLEAA-----GASN--FYVRINDRRAVDKLLEHLGVA
SYH_THEAC       DIFGSD--SPEADAEVIALAS-SILDRL-----GLQDI-YEIRINSRKIMEEIIGGMTSS
SYH_THEVO       DIFGPS--NEEADAEIISLAS-GILDGL-----GLSGA-YEIRVNSRIMMEDILNGMGIA
SYH_HALSA       DIFGTS--DPRADAEVLAVAA-DGLTSL-----GLTGADFEFRVSHRDILGGLLAAFDAT
SYH_AGRFC       DTVGAA--GVQADAEMCMMMADTMEAL------GIARGDYVIRVNNRKVLDGVMEAIGLG
SYH_RHIME       DTVGAA--GVQADAEMCMMMADTMEAL------GIARGDYVIRVNNRKVLDGVLEAIGLG
SYH_BRUME       DTVGAP--NVSADAEMCMMMADTLERL------GIQRGDYAIRVNNRKVLDGVLDAIGLE
SYH_BRUSU       DTVGAP--NVSADAEMCMMMADTLERL------GIQRGDYAIRVNNRKVLDGVLDAIGLE
SYH_RHILO       DTIGTP--GVAADAEMAMMMADVMEAL------GIKRGDYVIRVNNRKVLDGVLEAIGLG
SYH_BRADU       DTVGSA--TPAADAEICMMAADTMEAL------GVQRGQYVVKVNNRKVLDGVLEAIGLA
SYH_CAUVC       DTVGSA--RPEADAEIIAMAVEGLEAA------GLPRGTAVLKINNRKLLNGLLTAAGA-
SYH_CLOAB       DVVGNGNLSIKNDAFIINMASKALRKI--------GLDSYKFQISNRKILTGVLEGLNIT
SYH_CLOTE       DIIGNGSLSIINDAEIPSIIYQTFKEL--------GFEDFTIRINNRKVLNGFFEGTDVE
SYH_XANAC       DVIGKDALSIRYDAEVLAVIHAVFAEL--------GIGDFKVQLNNRKLLRGFFESLGVA
SYH_XANCP       DVIGKDALSIRYDAEVLAVIHAVFAEL--------GIGDFKVQLNNRKLLRGFFESLGVA
SYH_XYLFA       DVIGKQTLSIRYDAEVLAVIHAVFSEL--------GIGDFQVQLNNRKVLRGFLESQGVR
SYH_XYLFT       DVIGKQTLSIRYDAEVLAVIHAVFSEL--------GIGDFQVQLNNRKVLRGFLESQGVR
SYH_NOSS1       DVVGREKLSLLYDAQMPAIITEIFEAV--------NIGDFVIRINNRKVLTGFFQSLNIS
SYH_BIFLO       DVIGAGDLPDHYEVELPLVMVSALEELR-----AYGLPKATVHANNRKLSEGFYRGLGLT
SYH_HELPY       DFIGSE--SLVCDAEIIQVIVASLKAL--------DLEDFCVSINHRKILNGICEYFGIS
SYH_HELPJ       DFIGSE--SLVCDAEIIQVIIASLKAL--------DLEDFCVSINHRKILNGICEYFGIA
SYH_BACTN       DVVGSD--SLLNEVELMQIVDTVFSRF--------NIR-VCIKINNRKILSGIAEIIGEA
SYH_AERPE       DIVGSP--YPEADAEIVSLAVDSIDAL--------GLPGFRVRVNDRRLLAGVFEEELGF
SYH_BORBU       DIVGED--TFRGDAEILSVVYYGLEEIFLNFIEGINKK-FIIHYSHIGILNSFFEKLGLK
SYH_TREPA       DIVGSD--SVCADFEILKSIRHMLYMA-------GAEH-IRIHVAHRGLFDRFLRALSLS
SYH_LEPIN       DLFGVD--SHRAELEILLIAD-SILKKF-----GAPIGSYQIKVSHRKLLDSFLKNSLKL
                :                                        .                  

SYH_CHLMU       R-------EFFRKDLDKLSTLSQ--ERFHA----------------NLLRILDSKE-PED
SYH_CHLTR       R-------EFFRKDLDRLSPLSQ--ERYHA----------------NLLRILDSKE-PED
SYH_CHLPN       R-------AYLKESMGELSALSQ--QRFST----------------NVLRILDSKE-PED
SYH_CHLTE       R-------AYFQPYEADLDELSK--ERLKK----------------NPLRILDSKN-PAL
SYH_COREF       Q-------DFLLNL--PLDEETR--RRAEI----------------NPLRVLDDKR-AEV
SYH_CORGL       Q-------DFLFAL--PLDEETR--KRAEI----------------NPLRVLDDKR-PEV
SYH_MYCLE       Q-------EFLLQL--DLDEDTR--RRAEL----------------NPLRVLDDKR-PQV
SYH_MYCTU       Q-------EFLFGL--DLDEDTR--RRAGI----------------NPLRVLDDKR-PEL
SYH_STRCO       Q-------DFLRGL--DLDEETL--RRAEI----------------NPLRVLDDKR-PDV
SYH_DEIRA       R-------DLFSPHLGRLSDDSK--DRLER----------------NPMRILDSKS-ASD
SYH_THET8       R-------EVLSPHREALSEDSK--ERLEL----------------NPMRILDSKS-ERD
SYH_CLOPE       K-------QYLKENYDNLCETCK--TRFEK----------------NPMRIIDCKE-KRC
SYH_CALS4       K-------EFLKEHLDELCDDCK--VRYEV----------------NPLRVLDCKV-ESC
SYH_THEMA       K-------EYYGRILDNLCDDCK--RRYET----------------NILRLLDCKV-D--
SYH_FUSNN       I-------EHFKSHLDDMCEDCR--DRINR----------------NPLRLLDCKV-DGE
SYH_AQUAE       L-------NYLTGVKEELCSDCI--SRMDR----------------NPLRVLDCKV-ETC
SYH_BACHD       V-------NHFKPRIHEFCNDCQ--DRLEK----------------NPLRILDCKK-DRD
SYH_BACSU       V-------KHFEPRIEEFCSDCQ--SRLHT----------------NPLRILDCKK-DRD
SYH_OCEIH       I-------QHFEPHREELCHDCQ--NRLDK----------------NPLRVLDCKK-DRD
SYH_LISIN       V-------AHFEPHIDEFCAECQ--VRLHK----------------NPLRILDCKK-DHD
SYH_LISMO       V-------AHFEPHIDEFCAECQ--VRLHK----------------NPLRILDCKK-DHD
SYH_STAAM       V-------KHFEPVIHEFCSDCQ--SRLHT----------------NPMRILDCKV-DRD
SYH_STAES       V-------KHFEPVIDTFCSDCQ--SRLHT----------------NPMRILDCKI-DRD
SYH_STRA3       I-------DYLTPIREQLSKDSQ--RRLNE----------------NPLRVLDSKE-PED
SYH_STRP3       I-------DYLTPMRDQLSKDSQ--RRLDE----------------NPLRVLDSKE-KED
SYH_STRP8       I-------DYLTPMRDQLSKDSQ--RRLDE----------------NPLRVLDSKE-KED
SYH_STRP1       I-------DYLTPMRDQLSKDSQ--RRLDE----------------NPLRVLDSKE-KED
SYH_STREQ       I-------DYLSPMRDTLSKDSQ--RRLDE----------------NPLRVLDSKE-KED
SYH_STRMU       I-------DYLIPMKDKLSKDSQ--RRLEE----------------NPLRVLDSKE-KED
SYH_STRPN       I-------DYLTPLKETLSKDSQ--RRLEE----------------NPLRVLDSKE-KED
SYH_STRR6       I-------DYLTPLKETLSKDSQ--RRLEE----------------NPLRVLDSKE-KED
SYH_LACLA       I-------DYLTPFENQLSEDSR--RRLNE----------------NPLRVLDSKE-AED
SYH_LACPL       I-------DYLEPHFDELSDDSK--ERLHK----------------NPLRVLDSKA-PED
SYH_SALTI       V-------AFLEQHQETLDEDCK--RRMYT----------------NPLRVLDSKN-PDV
SYH_SALTY       V-------AFLEQHQETLDEDCK--RRMYT----------------NPLRVLDSKN-PDV
SYH_ECOLI       V-------AFLEQHKEKLDEDCK--RRMYT----------------NPLRVLDSKN-PEV
SYH_YERPE       V-------AFLEQHVEVLDEDCK--RRMYS----------------NPLRVLDSKN-PDV
SYH_VIBPA       V-------AFLEQHIDVLDEDCK--RRMHT----------------NPLRVLDTKN-PDI
SYH_VIBVU       I-------AFLEQHIDVLDEDCK--RRMHT----------------NPLRVLDTKN-PDV
SYH_VIBCH       I-------DYLEQYQNVLDEDCK--RRMYT----------------NPLRVLDSKN-PDV
SYH_HAEIN       V-------GFLENHQDLMSDEEK--ERLVR----------------NPLRILDTKN-PEL
SYH_PASMU       V-------AFLQQHVDLLSEEEK--ERLEK----------------NPLRILDTKN-QAL
SYH_SHEON       I-------AFLEQHKDKLDEDSQ--RRMYS----------------NPLRVLDSKD-PQV
SYH_PSEPK       V-------EFLSARLEQLDEDSQ--RRLKS----------------NPLRILDSKD-QNT
SYH_PSESM       V-------EFLSAHLDQLDEDSQ--RRLKT----------------NPLRVLDTKH-PET
SYH_PSEAE       V-------AYLQERFEQLDEDSQ--RRMTT----------------NPLRILDSKV-EST
SYH_NEIMA       V-------EYLTRYEDKLDEDSK--RRLKT----------------NPLRVLDTKN-PDL
SYH_NEIMB       V-------EYLTRYEDKLDEDSK--RRLKT----------------NPLRVLDTKN-PDL
SYH_RALSO       I-------KYLEGFQDILDEDSK--RRLYT----------------NPLRVLDTKN-PAL
SYH_THEEB       V-------DYLTPYKADLDPDSQ--ERLHR----------------NPLRILDSKD-PRT
SYH_SYNY3       I-------AYLTPFKAELDPDSQ--DRLER----------------NPLRILDSKA-KRT
SYH_PORPU       Q-------EYLEQYYDDLDTDSQ--NRLSS----------------NPIRILDTKN-KYT
SYH_BUCAI       V-------NFLKKREYLLDEDCK--RRLYT----------------NPLRILDSKN-QDI
SYH_BUCAP       V-------FFLEKYKNILDEDSK--KRLYT----------------NPFRILDSKN-DMM
SYH_BUCBP       F-------SYFKQYEACLDEDCK--RRLYV----------------NPLRILDSKD-KNI
SYH_WIGBR       K-------KFLLIHEDKIKKFFL--NDITK----------------NPIKIFNTNN-KYI
SYH_RICCN       V-------EYLNDFKDQLSEESK--IRLSK----------------NPMRILDSKS-ETD
SYH_RICPR       V-------EYLNDFKDQLSGESR--LRLNK----------------NPMRILDSKS-EID
SYH_CAMJE       V-------EFLDS-KEGFCEDCL--RRKNL----------------NPIRVLDCKN-EHC
SYH_MYCGE       K-------DYLTPYKLELTELSQ--KRLEK----------------NPLRILDDKI-DQK
SYH_MYCPN       Q-------AYLTQFKAQLTELSQ--SRLST----------------NPLRILDDKV-DGQ
SYH_MYCPE       K-------KYFNKYKDELSEDSK--NRIEK----------------NPLRILDDKV-DGS
SYH_UREPA       Q-------EYFHLHRTELTPLSQ--ERITT----------------NPLRILDDKL-ESQ
SYH_MYCPU       K-------NYLNQFENQLEEISK--ERLKN----------------NALRILDDKI-ESQ
SYH_METAC       P-------EIVSKVMRLVDKKE---YAGLE----------------SLLEEIGAEE-QLK
SYH_METMA       P-------EIVSNVMRLVDKKE---YAGLE----------------ALLDEIGAEE-QLK
SYH_ARCFU       E-------DRASKVMRLIDKGD---REGLE----------------SYLAEIRVNE-DLR
SYH_METJA       E-------EEEVKIRRLIDKED---YDNLK----------------IYLTQILGE--EKK
SYH_METTH       S-------ELQDRIMGVIDKGD---VEELE----------------ALLGEVEVSG-ESR
SYH_METKA       E-------DVQNKVAHLVDKGE---LDEVK----------------TLLPAEPAE----K
SYH_PYRAB       D-------DI--GLMRIIDKKDKLSQEEFL----------------KALGEFGLDE-NGI
SYH_PYRHO       D-------DI--GLMRIIDKRDKLSQEEFI----------------NLLKEFGLGE-SEI
SYH_PYRFU       D-------DI--GLMRIIDKKDKLPQEDFI----------------NALKEFGLDK-NGI
SYH_SACS2       D-------NLQEHVLHLIDKNK--VDEALV----------------ILEKNIKNKD-IMD
SYH_SULTO       D-------NLQEHFLHLIDKGK--IDEALS----------------LLPSSEYTEL-ITN
SYH_PYRAE       P-------YRDIIYKALDKKLK--LPREDV----------------IKIMTGGGVS-KEI
SYH_THEAC       --------DPFSVF-SIIDRYHKISREEFV----------------DQLRSAGIGE-DGV
SYH_THEVO       --------DPYTVF-SIVDRFHKVSKETFV----------------DDLMSVGLSE-ENS
SYH_HALSA       V-------DTEAAI-RTVDKREKIERAAYL----------------DDLAAAGLSY-DQA
SYH_AGRFC       GEDNAGRRLNVLRAIDKLDKFGPEGVKLLLGPGRKDES----GDFTKGAGLGDEQI-EKV
SYH_RHIME       GVEQTNTRLTVLRAIDKLDKFGPEGVRLLLGEGRKDES----GDFTKGAGLNEEQI-GKI
SYH_BRUME       GEGNAAKRLNVLRAIDKLDKFGPEGVRLLLGKGRLDES----GDFTKGAQLPEAAI-EKV
SYH_BRUSU       GEGNAAKRLNVLRAIDKLDKFGPEGVRLLLGKGRLDES----GDFTKGAQLPEAAI-EKV
SYH_RHILO       GEENIGRRLTVLRAIDKLDKLGPEGVKLLLGPGRWDGGKEGEGDFAKGAGLNNGQA-EAV
SYH_BRADU       GDENAARRLTVLRAIDKLDKFPADEVRKLLGPGRWDGGEEGKGDFTKGANLSAAEA-DVV
SYH_CAUVC       --DSAGQKLAVLRAVDKLDRLGVDGVRLLLGEGRLDES----GDFTKGAGLKGKAV-DQV
SYH_CLOAB       ---N---MQEVMILIDKYDKITEEQFLSEL----------------NKLIGEE-KA-KVI
SYH_CLOTE       ---D---RKGVLRAIDKIEKIGEDGVRKEL----------------QELGLEDSKI-DKI
SYH_XANAC       ---EGELQLAVLREVDKIDKRGADYVRDTLVG--------------EGFGIPAEQV-ARI
SYH_XANCP       ---EGELQLAVLREVDKIDKRGAEYVRDTLAG--------------EGFGIAAAQV-DKI
SYH_XYLFA       ---DGDLQLAVLREVDKLDKRGVLDVRDTLIG--------------QGFGIPAAQV-ENI
SYH_XYLFT       ---DGELQLAVLREVDKLDKRGVLDVRDTLIG--------------QGFGIPAAQV-ENI
SYH_NOSS1       ---ETQ-IKSCISIIDNLEKIGEAKVKLEL----------------EKEGINPEQT-QKI
SYH_BIFLO       ---D---VEGVLREIDKLDKIGADEVARLLT---------------ETCGATEAQA-RAC
SYH_HELPY       ---Q---VNEALRIVDKLEKIGLNGVEEELK---------------KECGLNSNTI-KEL
SYH_HELPJ       ---Q---VNEVLRIVDKLEKIGLNGVEEELK---------------KECDLDSNTI-KDL
SYH_BACTN       ---DK--IVDITVAIDKLDKIGLENVNAELK----------------EKGISDEAI-AKL
SYH_AERPE       ---DN--PLPIYRAIDKLDKIGVEGVRRELE----------------RLGLPGSTV-ERI
SYH_BORBU       E--K---SIFILRNIDKIDKIGIDKVKEAL-----------------LLEIEKEAV-DSI
SYH_TREPA       D--Q---AEHILRIIDKRAKMAPHVLTAQLES------------LCDPVRVQKIMTYVSA
SYH_LEPIN       N------GDQVHGVSKLLDKKSK-ISPEAFE---------------TEMKPFLNNFKEQF
                                                                            

SYH_CHLMU       QAFIEQAPS------ILDYVDD------------------QDLNYFDSVLAELKVLGI--
SYH_CHLTR       QEFIEKAPS------ILDYIDD------------------RDLSYFDAVLAQLKALGI--
SYH_CHLPN       QEIIRQAPP------ILDYVSD------------------EDLKYFNEILDALRVLEI--
SYH_CHLTE       QEMIMGAPR------LYHSLKP------------------ESVAEFEQVLAYLDDRQI--
SYH_COREF       REMTADAPL------MLDHLDD------------------GCRTHFETVTGLLDDMGV--
SYH_CORGL       QEMTADAPL------MLDHLDA------------------ECREHFETVTGLLDDMGV--
SYH_MYCLE       QAMTAAAPV------LLDHLSD------------------GAKQHFDTVLAHLDALRV--
SYH_MYCTU       RAMTASAPV------LLDHLSD------------------VAKQHFDTVLAHLDALGV--
SYH_STRCO       QKQLTEAPL------LRDYLCD------------------ACKAYHEEVRELITAAGV--
SYH_DEIRA       QELLAELSVRP----MLDFLGE------------------GAAADFRQVQAYLSDWGV--
SYH_THET8       QALLKELGVRP----MLDFLGE------------------EARAHLKEVERHLERLSV--
SYH_CLOPE       KEIVKEAPS------ILDYICE------------------ECSDHFSKLKAYLDVMGI--
SYH_CALS4       RRVTGEAPL------ITDYLCD------------------DCRNHFEELKKYLDAMGY--
SYH_THEMA       HEYSLNAPK------SVDYLCD------------------SCRAHYKKLKEYLNTFEI--
SYH_FUSNN       KDFYKSAPS------IIDYLFE------------------DERKHYDDVKKYLDIFGI--
SYH_AQUAE       KVAVREAPK------MIDFLCD------------------ECREHYEKLKNYLKALDI--
SYH_BACHD       HELMGTAPS------IHDYLST------------------ESKAYFEKVQSYLTALNI--
SYH_BACSU       HELMKSAPS------ILTYLNE------------------ESAAYFEKVKQYLNDLGI--
SYH_OCEIH       HPAMGTAPK------ITDFLNE------------------YSKTYFADVMTYLDALDI--
SYH_LISIN       NPLIQSAPS------ILDFLNE------------------ESVAYFENVKKYLTALEI--
SYH_LISMO       NPLIQSAPS------ILDFLNE------------------ESVAYFENVKNYLNALEI--
SYH_STAAM       KEAIKTAPR------ITDFLNE------------------ESKAYYEQVKAYLDDLGI--
SYH_STAES       KEAVKNAPR------ITDYLNN------------------DSKSYYEQVKLHLDNLNI--
SYH_STRA3       KLAVENAPS------ILDYLDE------------------SSQAHFDAVCHMLDALNI--
SYH_STRP3       KLAVEKAPS------ILDYLDE------------------ESQAHFEAVKAMLEALDI--
SYH_STRP8       KLAVEKAPS------ILDYLDE------------------ESQAHFEAVKDMLEALNI--
SYH_STRP1       KLAVEKAPS------ILDYLDE------------------ESQAHFEAVKDMLEALDI--
SYH_STREQ       KIAVANAPS------ILDYQDE------------------ESQAHFDAVRSMLEALAI--
SYH_STRMU       KEAVENAPS------ILDYLDD------------------DSQAHFQGVRDMLEVLDI--
SYH_STRPN       KVAVENAPS------ILDFLDE------------------ESQAHFDAVRQMLENLGV--
SYH_STRR6       KVAVENAPS------ILDFLDE------------------ESQTHFDAVRQMLENLGV--
SYH_LACLA       IAIVKNAPA------ILDYLNE------------------ASKAYFEEVKALLEALHI--
SYH_LACPL       QQFVADAPS------ILDYLSP------------------EAQAHFDQTKTYLDALAI--
SYH_SALTI       QALLNDAPV------LGDYLDD------------------DSREHFAGLCKLLDAAGI--
SYH_SALTY       QALLNDAPA------LGDYLDD------------------DSREHFAGLCKLLDAAGI--
SYH_ECOLI       QALLNDAPA------LGDYLDE------------------ESREHFAGLCKLLESAGI--
SYH_YERPE       QQLLDDAPK------LSDYLDE------------------ESKQHFAGLCELLDKASI--
SYH_VIBPA       QAILGDAPR------LSEYLGE------------------ESKAHFAGLCELLDAAGI--
SYH_VIBVU       QAILGDAPR------LSDYLDP------------------ESTQHFAGLCELLDAAGI--
SYH_VIBCH       QAILGDAPQ------LSDYLDA------------------ESKQHFAGLCELLDAAGI--
SYH_HAEIN       QKVLDNAPK------LLDYLDD------------------ESRTHFEQLCSLLDAVGI--
SYH_PASMU       QEVLNDAPK------LLAYLDD------------------DSREHFAQLCALLDAVGI--
SYH_SHEON       QSILADAPA------LMDYLGE------------------ESSQHFAQLRELLDAVGI--
SYH_PSEPK       QAVLVGAPK------LEDYLDE------------------ESRVHFEGLKARLDAAGI--
SYH_PSESM       QAVLVDAPK------LADYLDD------------------ESRIHFEGLKARLDAAGI--
SYH_PSEAE       QALLVGAPT------LHDYLDE------------------ESIAHFEGLKARLDAVGL--
SYH_NEIMA       QEICNAAPR------LVDYLGE------------------ASQNHYARFKAMLDGLGI--
SYH_NEIMB       QEICNAAPR------LVDYLGE------------------DSQNHYVRFKAMLDGLGI--
SYH_RALSO       QEMAAGAPK------LIDYLGE------------------ESCAHFEGVQKLLKANNI--
SYH_THEEB       QAIVKEAPR------LLDYLSA------------------RSRAHFEQVQSLLQALGI--
SYH_SYNY3       QEIVQDAPS------ILDHLGV------------------DSQRHFDQVQQLLTNLGI--
SYH_PORPU       QTILNDSPR------ISDFLSL------------------ESEKHFDDVCDYLTLLNV--
SYH_BUCAI       QNLLKEAPL------LSEYISF------------------SENNHFKNLCNMMNHHGI--
SYH_BUCAP       QKILKKAPL------LKNYINT------------------SAINHFNSLCNMMDSYGI--
SYH_BUCBP       KAIINNAPI------LMDFIDD------------------NSLIHFENLCKLMKNIGI--
SYH_WIGBR       KNLLKQAPK------IIDSIGI------------------NSRNTFFYLCDILKNLKI--
SYH_RICCN       QKIIANAPV------LSEYYTD------------------ESKEYFEELIQYLDILGV--
SYH_RICPR       QKIIAHAPI------LSEYHTN------------------ESKKYFDELQKYLDILGI--
SYH_CAMJE       QNLLENAPL------LINNLCT------------------SCQKDFETLQQILKDNGV--
SYH_MYCGE       KSFVKNAPK------ITDFLDA------------------SAKQDSELLKTQLKKHNI--
SYH_MYCPN       LPFISDAPQ------IEQFLDA------------------EQQALNTWLQQQLTQQQV--
SYH_MYCPE       KSFVKSCPK------IEEFLTK------------------EEKEESDNFIKCLKTIVN--
SYH_UREPA       KLVVKQAPK------ISHFLSN------------------EEKEEFNLIKKMLDDYNI--
SYH_MYCPU       KAFVKNAPK------IHDFLPK------------------ESLENFYQLQDLFKKFDI--
SYH_METAC       SDLFHLIHLEG--KYILPKVKE-IVG---------NI--P-ELVGFEKTLKLLDAYGV--
SYH_METMA       SDLFRLIHLQG--RYILPEVKG-IVG---------NI--P-ELVSFEKTLKLLDAYGV--
SYH_ARCFU       DKIFSLLELKGD-ESVIEEAKE-IID---------Y-----DFGHLESLSALLRDVGV--
SYH_METJA       ELIFEILKFKGS-REVLDELKE-ILK---------DF--PKSMEAINNLEEILEFVIH--
SYH_METTH       ELLMKLIGTQGG-PEVLDDVEE-YLG---------GY--SESLEALEEFRELVETLHYFG
SYH_METKA       --ALAVVTARS--ESEVEEAVS-GKE---------RA--ERALENLMEISDALREAGV--
SYH_PYRAB       EKVLNLIEIKGKPDDVLPLAEE-LFT---------SERAKEEISRLYNLVDILSWYEV--
SYH_PYRHO       EKVLELVEIKGRPDNVLPLAEE-LFK---------SKKAKEEISKLYKLTDLLEWYGV--
SYH_PYRFU       EKVLELINIKGKPDEVLPLAEE-LFT---------SEVAKNEINRLYALIDLLEAYEV--
SYH_SACS2       FLNMILTKKEAKLEDIESLAELEEVS---------KLDIKNEFEYLLRLSRILSSLNV--
SYH_SULTO       ILSVNNLDISSYNKIKEDLTE--KYN---------LKDLIQDLDRIMLLKNILDNLGV--
SYH_PYRAE       AEEIYNTATEITIQEAVELLYKLDKA---------LGASYEKIVKYLEASVPMERL----
SYH_THEAC       SMIADLCSGTRGIDEMARITG----------------KSSEEIARMAAVEDLLASYGVKN
SYH_THEVO       NTIYRMCSEASEPGGISGLFGS-------------G-KVSKAAERLIRTIDILKEYGVKS
SYH_HALSA       EQFDDLLDGD-DLDALVSFAGT-------------D-RVRDAVANLRNVLDAAETLGVRQ
SYH_AGRFC       LFFVGIKDY----AASADDLAKLVAG---------TSKGEEGVDELNTIGALVSGAGYD-
SYH_RHIME       LFFVGITDY----ARSADELAALVAG---------TARGAEGVNELNTIRGLVLSAGYE-
SYH_BRUME       LAFTAAGGAD-G-AQTIANLQAVVAG---------NAKGEEGVQELADMQALFFAGGY--
SYH_BRUSU       LAFTAAGGAD-G-AQTIANLQAVVAG---------NAEGEEGVQELADMQALFFAGGY--
SYH_RHILO       LQATARNAQ----AAQ----DSVVDS---------NATYQEGVGELATIEALVRAAGYG-
SYH_BRADU       LAITKPRDD--W-KEAIAAAEAYLAK---------SEVGQAGVSELEEIAKLVMASGYG-
SYH_CAUVC       LDFVQAGSTG-GRAATLDNIARVVAG---------SAEGDEGLLELSRIDAALSSLGIA-
SYH_CLOAB       SKVIKISGS---SDEVVENLKKVEIK---------NEMLEKGIEEVEEVIKYLKLFGVE-
SYH_CLOTE       INFINIKGT---KSEVIKSLKELDIE---------NDVFKEGVYELEKVVHYIKSFNVP-
SYH_XANAC       LAFVAVRSN--GHADALAQLQALEGSVG------ASATLGEGIAELREVLELVKALGVP-
SYH_XANCP       LAFVAVRSN--GHADALAQLQALETSVG------ASVTLGEGIAELREVLELVKALGVP-
SYH_XYLFA       LTFVATRST--SHADALVRLDALIEDSGPE----AHEMLRQGVAELREVLTLVNVLGVP-
SYH_XYLFT       LTFVATRST--SHADALARLDALIQDSGPE----AHDMLRQGVAELREVLTLVNVLGVP-
SYH_NOSS1       IDFVKIDGS---VDDVLDKLKHLSQTLP------ESEQFNLGVSELETVITGVRNLGVP-
SYH_BIFLO       LELAELTAS--DGAELAAKFDALCEAHGIVKDSEAYTLARQGLDTLAMIVDEAAAIRP--
SYH_HELPY       LELIQIKQNDLSHAEFFEKIAYLKDY---------NENLKKGIQDLERLYQLLGDLQIS-
SYH_HELPJ       LEMVQIKQNDLSHAEFFEKIAYLKDY---------NENLKKGIQDLERLYQLLGDLQIS-
SYH_BACTN       QPIILLSGT---NTEKLATLKSVLAA---------SETGMKGVEESEFILGTLETMGL--
SYH_AERPE       MEIISWRGR---PGEVLESVRRGYGS---------NEKVREALDHLEEMLSLAD------
SYH_BORBU       LSLVSLQGTFKDKIQALKSILG----------------DNESIKRVEDVFQHLSLLKIQ-
SYH_TREPA       GEVDGVAPSFEHTLSAIETLTGGVS---------------EESTRLRKIYELLCAVNIQ-
SYH_LEPIN       SLIETYLNSNLETVSKIPGIDT------------------NSVSFIQNLFQELGELGID-
                                                                            

SYH_CHLMU       --PYKINPRLVRGLDYYTDLVFEAVTVVGD--------HSYALGGGGRYDELVAQSGGPA
SYH_CHLTR       --SFAINPRLVRGLDYYTDLVFEAVTVVGE--------HSYALGGGGRYDELVAQSGGPS
SYH_CHLPN       --PYAINPRLVRGLDYYSDLVFEATTTFQE--------VSYALGGGGRYDGLISAFGGAS
SYH_CHLTE       --AYNVDHLLVRGLDYYCHTAFEVTSSELG--------AQDAIGGGGRYDGLARELGASA
SYH_COREF       --PYEINPRMVRGLDYYTKTTFEFIHDGLG--------AQSGIGGGGRYDGLMAQLGGQD
SYH_CORGL       --PYVINPRMVRGLDYYTKTCFEFVHDGLG--------AQSGIGGGGRYDGLMAQLGGQD
SYH_MYCLE       --PYVINPRMVRGLDYYTKTTFEFVHPGLG--------AQSGIGGGGRYDGLMRQLGGQD
SYH_MYCTU       --PYVINPRMVRGLDYYTKTAFEFVHDGLG--------AQSGIGGGGRYDGLMHQLGGQD
SYH_STRCO       --VFEDDPKLVRGLDYYTRTTFEFVHDGLG--------SQSAVGGGGRYDGLSEMIGGPS
SYH_DEIRA       --PFDLDPSIVRGLDYYRRTAWELHYEGIG--------AKSALGGGGRYDGLSEQLGGGS
SYH_THET8       --PYELEPALVRGLDYYVRTAFEVHHEEIG--------AQSALGGGGRYDGLSELLGGPR
SYH_CLOPE       --EYNIDPQIVRGLDYYSKTVFEVIKDGL------------TVCGGGRYDYLVEEVDGPK
SYH_CALS4       --DYIVDPRIVRGLDYYTKTAFEIISKDIG--------AQGTVCGGGRYDGLIEECGGPS
SYH_THEMA       --EYVEDHTLVRGLDYYTRTVFEVRHEGLG--------AQSAIAGGGRYDGLFAELGGSS
SYH_FUSNN       --KYTEDPTLVRGLDYYSSTVFEIVTNKLG--------SQGTVLGGGRYDNLLKELGDKD
SYH_AQUAE       --PFRENYNLVRGLDYYTRTVFEAVSDELG--------L--TLIAGGRYDYLVEELGGPP
SYH_BACHD       --PFVVDATLVRGLDYYNHTAFEVMVDG-EGF-----GAITTLCGGGRYNGLVEEIGGPE
SYH_BACSU       --SYEIDPNLVRGLDYYNHTAFEIMSNA-EGF-----GAITTLAGGGRYDGLVEQIGGPE
SYH_OCEIH       --EYVVDPNLVRGLDYYNHTAFEIMSEA-EGF-----GAITTLAGGGRYNGLVEEFGGPS
SYH_LISIN       --PFEIDPTMVRGLDYYNHTTFEIMSVE-EGF-----GAKTTLCGGGRYHGLVKEFGGPD
SYH_LISMO       --PFEIDPTMVRGLDYYNHTTFEIMSVE-EGF-----GAKTTLCGGGRYHGLVREFGGPD
SYH_STAAM       --PYIEDPNLVRGLDYYTHTAFELMMDNPNYD-----GAITTLCGGGRYNGLLELLDGPS
SYH_STAES       --SYVEDPNLVRGLDYYTHTAFELMIDNPEYD-----GAITTLCGGGRYNGLLQLLDGPD
SYH_STRA3       --PYIIDTNMVRGLDYYNHTIFEFITEIED--------NELTICAGGRYDGLVSYFGGPE
SYH_STRP3       --PYVIDTNMVRGLDYYNHTIFEFITSVEG--------SDLTICAGGRYDSLVGYFGGPE
SYH_STRP8       --PYVIDTNMVRGLDYYNHTIFEFITSVEG--------SDLTICAGGRYDSLVGYFGGPE
SYH_STRP1       --PYVIDTNMVRGLDYYSHTIFEFITSVEG--------SDLTICAGGRYDSLVGYFGGPE
SYH_STREQ       --PYVIDTNMVRGLDYYNHTIFEFITEVDQ--------SELTICAGGRYDGLVEYFGGPA
SYH_STRMU       --PYVIDTNMVRGLDYYNHTIFEFITQVDK--------SELTLCAGGRYDSLVEYFGGPA
SYH_STRPN       --DYIIDTNMVRGLDYYNHTIFEFITEIEG--------NDLTVCAGGRYDGLVAYFGGPE
SYH_STRR6       --DYIIDTNMVRGLDYYNHTIFEFITEIEG--------NDLTVCAGGRYDGLVAYFGGPE
SYH_LACLA       --EYTIDPNMVRGLDYYNDTIFEFIVDFDG--------KDLTVCGGGRYDGLVEYFDGPA
SYH_LACPL       --PYEIDATMVRGLDYYNHTIFEIMTHSKALG-----KGYTTICAGGRYNGLVKELGGPE
SYH_SALTI       --AYTVNQRLVRGLDYYNRTVFEWVTNSLG--------SQGTVCAGGRYDGLVEQLGGRA
SYH_SALTY       --AYTVNQRLVRGLDYYNRTVFEWVTNSLG--------SQGTVCAGGRYDGLVEQLGGRA
SYH_ECOLI       --AYTVNQRLVRGLDYYNRTVFEWVTNSLG--------SQGTVCAGGRYDGLVEQLGGRA
SYH_YERPE       --PYTVNERLVRGLDYYNRTVFEWVTHSLG--------AQGTVCAGGRYDGLVEQLGGRA
SYH_VIBPA       --EYTVNERLVRGLDYYNRTVFEWITESLG--------AQGTVCGGGRYDGLVEQLGGKP
SYH_VIBVU       --EYTVNERLVRGLDYYNRTVFEWITESLG--------SQGTVCGGGRYDGLVEQLGGKA
SYH_VIBCH       --EYTVNQRLVRGLDYYNRTVFEWITESLG--------SQGTVCGGGRYDGLVEQLGGKP
SYH_HAEIN       --QYEINPKLVRGLDYYNKTVFEWVTSALG--------AQGTVCGGGRYDGLVEQLGGHA
SYH_PASMU       --QYEVNPKLVRGLDYYNKTVFEWVTSALG--------AQGTVCGGGRYDGLVEQLGGHA
SYH_SHEON       --QYRVNSRLVRGLDYYNRTVFEWVTNSLG--------SQGTVLAGGRYDGLVAQLGGKE
SYH_PSEPK       --PFVINTKLVRGLDYYSKTVFEWVTDKLG--------AQGTVCAGGRYDGLVEQMGGKP
SYH_PSESM       --PYVINPKLVRGLDYYSKTVFEWVTDQLG--------AQGTVCAGGRYDGLVEQMGGKP
SYH_PSEAE       --RYEINQKLVRGLDYYCRTAFEWVTDKLG--------AQGTVCGGGRYDGLVSQFGGKP
SYH_NEIMA       --QYIENPRLVRGLDYYNQTVFEWTTDKLG--------AQATVCGGGRYDGLIEELGGKP
SYH_NEIMB       --QYIENPRLVRGLDYYNQTVFEWTTDKLG--------AQATVCGGGRYDGLIEELGGKP
SYH_RALSO       --PFTINPRLVRGLDYYNLTVFEWTTDKLG--------AQGTVAGGGRYDPLIEQIGGKP
SYH_THEEB       --AYQINPALVRGLDYYTHTAFEFQDMSLG--------NEGTVCGGGRYDHLVEELGGPP
SYH_SYNY3       --AYQLTPTLVRGLDYYTHTAFEIQSSDLG--------AQATVCGGGRYDGLVAELGGPV
SYH_PORPU       --PYKINTQLVRGLDYYNDTAFEIKILKSQ--------GQDTLCGGGRYDSLIHQLGGNK
SYH_BUCAI       --KYKCNPHLVRGLDYYNSTVFEWKSNKLG--------AQNTICAGGRYDSLVQEMGGRK
SYH_BUCAP       --KYIHNQNLVRGLDYYNSTVFEWKIDQIG--------SQNTICAGGRYDSLVQELGGNK
SYH_BUCBP       --SYVVNYKLVRGLDYYNKTVFEWKTNLLG--------AKDAICAGGRYDNLSKSLGVTF
SYH_WIGBR       --PYKINPFLFRGLDYYNDIVFEWMSKEINN-------TKIAICSGGRYDNLVKNMGGIY
SYH_RICCN       --KYSINPRLVRGLDYYCHTAFEFTTKKLG--------SQSTILAGGRYDGLAKIMGNND
SYH_RICPR       --KYSVNPRLVRGLDYYCHTVFEFTTKKLG--------SQSTILAGGRYDMLSRIMGNYD
SYH_CAMJE       --KFELDSKLVRGLDYYSKTAFEFISDEIG--------AKAAIAGGGRYDRLIEYLGGKS
SYH_MYCGE       --SFEWTDNLVRGLDYYTGFVFEYVKN------------QDTILAGGVYDNLVEELSSNP
SYH_MYCPN       --PFEWNPTLVRGLDYYTGVVFEFVKD------------DTTVLAGGVYDNLVEELGGTP
SYH_MYCPE       --EFEFDSTLVRGLDYYSGPVFEIVSQSNKL------TGQSTIIGGGRYTKLTKELGDND
SYH_UREPA       --KYYVNEGLVRGLDYYSGLVFEFISTSPKL------LGQSTIIGGGRYGELIKQTGGPN
SYH_MYCPU       --KFKVDPFLVRGLDYYSDFVFEFVSTNQNL------GAQKTLLGGGVYSSLLKELGGEN
SYH_METAC       --DYSLDFGIARGLDYYTGMVFEVYAEGLG--------AQKQVCGGGSY-QLIQLFGGGD
SYH_METMA       --DYSLDFGIARGLDYYTGMVFEVYAEGLG--------AQKQVCGGGSY-QLIQLFGGGD
SYH_ARCFU       --DFTLNLGIARGLDYYTGVVFECYAEGLG--------AQKQVCGGGSY-ELSSLFGGPV
SYH_METJA       -DKYTINLGIARGLDYYTGMVFEIYGKK----------GAKQICGGGRYDNLIETFGGEP
SYH_METTH       VDDYHVNLGIARGLDYYTGIVFEIYVPELG--------AQKQICGGGTY-NLVETFGGER
SYH_METKA       --DHELDFSVARGLDYYTGMVFEIHVPELG--------GGSQCAGGGRYDDLVKELGGPD
SYH_PYRAB       DEWIQIDLGIARGFDYYTSIVFEAIVPNDL--------GIGSIGGGGRYDNLIEVFGGKP
SYH_PYRHO       KDWIRIDLGIARGFDYYTSIVFEAISPNEL--------GIGSIGGGGRYDNLIEIFGGKP
SYH_PYRFU       KDWIRIDLGIARGFDYYTSIVFEAIAPNDL--------GIGSIGGGGRYDNLIEVFGGKP
SYH_SACS2       --KFKVDLGFVRGLAYYTGLIFEVLHPSV----------QFSIAGGGRYDKLIELYGGLP
SYH_SULTO       --NSYIDLGFVRGLAYYTGLIFEVLHPSV----------SFSIAGGGRYDNLVELYGGPQ
SYH_PYRAE       ----KFDMSIVRGLDYYTGIVFEAFVGEY----------KLAVGGGGRYDDLLELYSGVK
SYH_THEAC       ---VRYDFSIVRGLSYYTGIVFEAYDRSGQ---------FRAILGGGRYDNLASLMSGES
SYH_THEVO       ---VKYDFSIVRGLSYYTGLVFEAYDKSGQ---------FRAILGGGRYDNLAKLFSEQD
SYH_HALSA       Y--CDVSLTTARGLDYYTGVVFECFDSTGDV--------GRAVFGGGRYDDLIERFGGQP
SYH_AGRFC       ATRIKIDPSVVRGLEYYTGPVYEAELTFDVTNEKGEKVVFGSVGGGGRYDGLVSRFMGQP
SYH_RHIME       ADRIKIDPSVVRGLEYYTGPVFEAELQFAVTNEKGEKVVFGSVGGGGRYDGLVSRFMGQP
SYH_BRUME       EGRVKIDPSVVRGLEYYTGPVFEAELLFDVTNEDGQKVVFGSVGGGGRYDGLVSRFRGEP
SYH_BRUSU       EGRVKIDPSVVRGLEYYTGPVFEAELLFDVTNEDGQKVVFGSVGGGGRYDGLVSRFRGEP
SYH_RHILO       EDRIAMDRSVVRGLEYYTGPVFEAELLAEIPNEDGQIVRFGSVGGGGRYDGLVSRFRGEP
SYH_BRADU       ADRIKIDPSVVRGLEYYTGPVYEVELLLDTKDEKGRPVRFGSVGGGGRYDGLVSRFRGEP
SYH_CAUVC       DDQAFIDPSIVRGLEYYTGAVFEAELLLSTTDEKGNKVSFGSIGGGGRYDDLVARFTGNV
SYH_CLOAB       DSEYAINLKIIRGLDYYTGTVFETLLTGNES--------YGSICSGGRYDNLAQNYTENV
SYH_CLOTE       DKNYKIDLTIARGLDYYTGTVYETVLNNYPQ--------IGSVCSGGRYDNLAEHYTNQK
SYH_XANAC       ESAYCLNFSIARGLDYYTGTVYETTLTDHPQ--------IGSICSGGRYDSLASHYTKSK
SYH_XANCP       ETAYCLNFSIARGLDYYTGTVYETTLTDHPQ--------IGSICSGGRYENLASHYTKSK
SYH_XYLFA       EHAYRLNFSIARGLDYYTGTVYETSLINHPQ--------IGSICSGGRYENLANHYTQSK
SYH_XYLFT       EHAYRLNFSIARGLDYYTGTVYETALINHPQ--------IGSICSGGRYENLANHYTQSK
SYH_NOSS1       DKRFCIDLAIARGLNYYTGTVYETTLIGHEA--------LGSICSGGRYEELVGTFIGEK
SYH_BIFLO       -GSVIADLKIARGLDYYTGSVYETFLDGAAS--------LGSICSGGRYDNLASQ-GNRK
SYH_HELPY       QNLYKIDFSIARGLGYYTGIVYETTLNEMKS--------LGSVCSGGRYDHLTKNFSKEN
SYH_HELPJ       QNLYKIDFSIARGLGYYTGIVYETTLNDMKS--------LGSVCSGGRYDHLTKNFSKEN
SYH_BACTN       KNEIELDLTLARGLNYYTGAIFEVKALD-VQ--------IGSITGGGRYDNLTGVFGMAG
SYH_AERPE       DKRVELDMSLVRGLDYYTGPILEVVLDE-PR--------IGSVAGGGRYDGLVGMFAGRD
SYH_BORBU       -DSFNLNLKISRGLDYYTGIVFESEVFGSN---------MGSVCSGGRYDNLVSSFSNSI
SYH_TREPA       -SSYVFDPSITRGFDYYTGMVCETFLTQLP--------HIGSVCSGGRYDHLTALYMKDA
SYH_LEPIN       -KQLLFDPSIIRGFDYYTGCIFEVFDTNPE--------NRRSLYGGGRYDNLIGLFSKEQ
                           **: **     *                     .** *  *        

SYH_CHLMU       --MPAFGFGVGLERVIQTLLEQG--AALP-TAPRRLRLIPMDESA--DAFCFSWAKHLRH
SYH_CHLTR       --MPAFGFGVGLERVIQTLLEQG--NSLS-TSTRRLRLIPMDEQA--DAFCFSWANRLRN
SYH_CHLPN       --LPACGFGVGLERAIQTLLAQK--RIEP-QFPHKLRLIPMEPDA--DQFCLEWSQHLRR
SYH_CHLTE       D-LPAVGFAVGMERLMIVMEKQGLFATLN-PHGPLVSVIIQQKEL--AGHAMQVAFHLRK
SYH_COREF       --LSGIGYGLGVDRTILALEAEG-VTVGQ-ERRVDVYGVPLGQAA--KKAMAGIINDLRA
SYH_CORGL       --LSGIGYGLGVDRTMLALEAEG-VTVGA-ERRVDVYGVPLGKDA--KKALAGIVNTLRA
SYH_MYCLE       --LSGIGFGLGVDRTLLALHAEG-KTVGE-TTRCDVFGVSLGEAA--KLKVAMLAGQLRA
SYH_MYCTU       --LSGIGFGLGVDRTVLALRAEG-KTAGD-SARCDVFGVPLGEAA--KLRLAVLAGRLRA
SYH_STRCO       --LPSVGWALGVDRTVLALEAEG-IELDI-PSATSVFAVPLGEEA--RRILFAKVTELRK
SYH_DEIRA       --VPGIGWAFGVERLLLALEQEG-IEIPG-SGGPQLYVAALDEEN--VPLAARVALAARA
SYH_THET8       --VPGVGFAFGVERVALALEAEG-FGLPE-EKGPDLYLIPLTEEA--VAEAFYLAEALRP
SYH_CLOPE       --TPAMGFGLGLERLLLILDEEGIEI-PE-PVRCEVYIGSMGDRA--RLEAMKLAFNLRK
SYH_CALS4       --MPGVGFGMGIERLLLTLEQNGIEI-PK-PEGPDLFIAYIGDEA--KLFTFTLANKLRF
SYH_THEMA       --VPALGFAGGIERIILALKAEGIEI-PM-KNVHLVYIATLGEKA--FMDGVRLAGELRK
SYH_FUSNN       --IPAVGFATGVERIMMLLEEN-----YP-KNTPDVYIAWLGENT--SETALKIAESLRD
SYH_AQUAE       --TPALGFALGVERLMLLLPDE--------EEKEEVYFVIPFGDV--HEYALRVADILRK
SYH_BACHD       --TPGIGFALSIERAIMALEAQQAKP-AH-NQAIDCYVVTLGEAA--KDKGVELVYQLRN
SYH_BACSU       --APGIGFAMSIERLLAAIDAEKREL-PV-DKGIDCYIVTLGEKA--KDYSVSLVYKLRE
SYH_OCEIH       --SPGIGFGMGLERLIMALEAENITL-PI-DQQLDCFVANMGDES--KLEATKVVKRLRD
SYH_LISIN       --TPGIGFGIGVERILLALEKAEINI-PE-TKPLEVYVITAQPEA--ELKAVTLVNKLRQ
SYH_LISMO       --TPGMGFGIGVERILLALEKADIEI-PA-KKPLEVYVITAQPEA--ELKGVTLVNKLRQ
SYH_STAAM       --ETGIGFALSIERLLLALEEEGIEL-DI-EENLDLFIVTMGDQA--DRYAVKLLNHLRH
SYH_STAES       --ETGIGFALSIERLLMALDEEGISL-DV-SEDFDLFVVTMGEDA--DRYAVKLINDLRR
SYH_STRA3       --TPAFGFGLGLERLLLILDKQGISL-PI-ENTIDLYIAVLGSEA--NLAALDLAQSIRH
SYH_STRP3       --TPGFGFGLGLERLLMVIEKQGITL-PI-ETEMDVYLAVLGDGA--NSKALELVQAIRR
SYH_STRP8       --TPGFGFGLGLERLLMVIEKQGITL-PI-ETEMDVYLAVLGDGA--NSKALELVQAIRR
SYH_STRP1       --TPGFGFGLGLERLLMIIEKQGITL-PI-ETEMDIYLAVLGDGA--NSKALELVQAIRR
SYH_STREQ       --TPGFGFGLGLERLLLILDKQGVEL-PV-EEGLDVYIAVLGADA--NVAALALTQAIRR
SYH_STRMU       --TAGFGFGLGLERLLLVIDKQKINL-PV-DNSLDVYIAVLGAAA--NSTALELIQAIRK
SYH_STRPN       --TAGFGFGLGVERLLLILEKQGVTL-PI-ENALDVYIAVLGEGA--NIKALELVQALRQ
SYH_STRR6       --TAGFGFGLGVERLLLILEKQGVAL-PI-ENALDVYIAVLGDGA--NVKALELVQALRQ
SYH_LACLA       --TPAFGFGLGIERLLMIAQKQEINF-IP-EETLDVYIAVMGEKA--NLEATKLAESLRE
SYH_LACPL       --VSGVGFGLGVERLLVLMDAENIAV-PT-DDQLDVYVVGIGDTA--SATTLKLVQALRA
SYH_SALTI       --TPAVGFAMGLERLVLLVQAVNPEF-IA-SPVVDIYLVAAGAQT--QSAAMTLAERLRD
SYH_SALTY       --TPAVGFAMGLERLVLLVQAVNPEF-IA-SPVVDIYLVAAGAQT--QSAAMTLAERLRD
SYH_ECOLI       --TPAVGFAMGLERLVLLVQAVNPEF-KA-DPVVDIYLVASGADT--QSAAMALAERLRD
SYH_YERPE       --TPAVGFAMGLERLVLLVQAVNADF-QV-PATVDAYVISSGEGA--QSAAMLLAESLRD
SYH_VIBPA       --TPAVGFAMGLERLVLMLETLELT--DV-RRSVDVYVVTAGEGT--MMAGMKLAEQLRE
SYH_VIBVU       --TPAVGFAMGLERLVLMLETLELT--DV-RRSVDVYVVTAGEGT--MMAGMKLAEQVRE
SYH_VIBCH       --TPAVGFAMGLERLVLMMETLGNT--DV-RRSVDVYMVTAGEGT--MMAGMKLAEQLRE
SYH_HAEIN       --TPSIGFAMGLERLVLLVQEVNPNV-PA-KSAVDIYVVYQGEGA--TLAAFELAEKVRS
SYH_PASMU       --TTGVGFAMGLERLVLLVQEVNQSI-RL-PSAVDIYVVYQGEGT--TLAAFQLAETLRT
SYH_SHEON       --TPAVGFAMGLERIVLLLETLALTQ-DI-PAEVDVYVAAMGDNC--LVEAIKVAQELRS
SYH_PSEPK       --TTGVGFAMGIERLILLLETLGKVPESI-SRQIDVYLCAFGEQA--ELAGLRLSEGLRD
SYH_PSESM       --TAGVGFAMGIERLVLLLETLEQVPEEI-ARQVDVYLCAFGEAA--ELAALALTEQVRD
SYH_PSEAE       --TPGVGFAMGVERLVLLLETLGVIPAEL-NRPADLYVCAFGEPA--ELAALTLAEQLRS
SYH_NEIMA       --APSIGFAMGIERLLLLVSEYGSLE--V-NAAPDVYAMHQGEGA--DLQVMKYAQALRA
SYH_NEIMB       --APSIGFAMGIERLLLLVSEYGSLE--V-NAAPDVYAMHQGEGA--DLQVMKYAQALRA
SYH_RALSO       --APACGWAMGVERIIELLREENLAP--E-PQGSDVYIVHQGDEA--QVQALVAAERLRD
SYH_THEEB       --TPAIGWAMGLERLILLLRD-RPLP--A-RNQPYLYMVTRGAAA--ERQGLILAQQLRH
SYH_SYNY3       --TPAVGWAMGLERLIILLQQ-MATP--P-APSPDLYLISKGEKA--EPQALILAQKLRN
SYH_PORPU       --TPAVGCAIGLERLLLVAKD-NILL--P-HMSIDCYIVSKGIKA--RKIGIIITQFLRN
SYH_BUCAI       --TPAIGFAIGIERLVLLVKSLK-IFSEV-IEESNVYIIFIGDNN--KCHAINLSEEIRD
SYH_BUCAP       --TSAIGFAIGIERLVLLIKSLN-IISCK-EEDINIYIIFIGELN--KIYAISLSEEIRN
SYH_BUCBP       --IPAIGCAIGMERLVLLIKSLK-LKPKT-NNAIDVFIIFLKDNI--QIEAIKLSELVRT
SYH_WIGBR       --TPAVGCAIGLERLIMLVSSLS-KEIKK-KSSIDICIIPINIKI--EKEVLIFSEKLRD
SYH_RICCN       D-VPAIGFAAGIERIALMREYNI-SEVKP------VFVLPIGKNN--ICYALEIVDKLRT
SYH_RICPR       --VHAIGFAAGIERIALMREYKI-SVIKP------VFVLPIGKNN--ICYALDIVDKLRL
SYH_CAMJE       --GYGIGFAMGIERIITILEQKE-EKIQR-E---GIYLCAMDEIY--IQKLLHIATNLRK
SYH_MYCGE       --TPALGFACGIERLINCLEIDKKAF--I-LNTKPKQMLVICLFE--EALEELVWLAKLW
SYH_MYCPN       --TKALGFACGIERSINCLSAVKKQA--I-LANQPPRLLVIGLTE--AALEKLLQLSLGW
SYH_MYCPE       --YICFGFALGMERLMLAYRDENQFL--S-NNSVDVYIASIGSVE--SELVAMNFANQLR
SYH_UREPA       --YEGIGFGIGIERLLIALSETNKNI--L-NTDDDKYLIAFFDKE--LENEAIKLTQILR
SYH_MYCPU       --IEGIGFGFGLERIMEVIDLNN-------FKDDAKKITAFASNE--DDLIALLKLRNNF
SYH_METAC       --VPSTGFGIGFDRIMEICPLVPP-------ASKNLVLVSKPATH---IEAVKVASELRN
SYH_METMA       --VPSTGFGIGFDRIMEICPLVPP-------AQKSLVVVSKPDTH---LEAVKVATELRN
SYH_ARCFU       --TPSTGFAIGFDRVCEACSVEAG-------EKSVVAVVSFKGLE---SQAFRVASMLRE
SYH_METJA       --TPAVGFAYGFDRIM--MNIDDLD-----IEEESILIIPVKKDKELIKKSLIIADKLRK
SYH_METTH       --VESTGFAFGFDRLMNALGMDEEN-----MRMVDVFVIPIQDST--VPEAIRITQELRA
SYH_METKA       --VPAVGMAIGFDRLLLAAELYDRIP-DG-VEETRALLIPLVRSG----KIWEIAAKLRK
SYH_PYRAB       --TPATGFAIGIERLIPILEWKGLLP-EL-KAGPDVFVIPVGD---SRDVATAIVTRLRK
SYH_PYRHO       --TPATGFAIGIERLLPILEWKGLIP-KP-QTGPEVFVIPLKD---MEKVAINIAVKLRR
SYH_PYRFU       --TPATGFAIGIERLIPILEAKGLIP-EV-QIAPDVYVVPIGER--MKKVAIRIATSLRK
SYH_SACS2       --SPAIGFAIGVERTLLVIKDL-KVE-EP-INVI-VVGISEEAI----PAMFTVSRMLRK
SYH_SULTO       --TPAIGFAIGVERTALVLEEPNTVK-EK-QNKIGVIVLSDEAI----LYAIRIVDKLRS
SYH_PYRAE       --TPALGFAIGVERLMEAVGIQ-NVE-RP-LDYY-IYIFDDDAY----KYAAAVAKKLRT
SYH_THEAC       --VPAVGFGMGDAVISLLLKRENVQI--P-REKKSVYICRVGKIN--SSIMNEYSRKLRE
SYH_THEVO       --IPAVGFGMGDAVISLLLKSKGVKA--P-HAKKSVYVCRVGTVK--AERIASISKMLRS
SYH_HALSA       --TPAVGVAPGHATLNLLLENAGVLP--D-DEFTPDYYVLQVGDT--DAEAADVASALRE
SYH_AGRFC       --VPATGFSIGVSRLMTALKNLGKLGQ-V-KPLAPVLITVMDGDVESMGRYQRFTQALRA
SYH_RHIME       --VPATGFSIGVSRLMTALKNLGKLGA-E-QVTAPVVVCVMDRDIESMGRYQRFVQDLRH
SYH_BRUME       --VPATGFSIGVSRLMTALKNLGKLDV-S-DTVGPVVVLVMDKDTQNLSRYQKMVSDLRK
SYH_BRUSU       --VPATGFSIGVSRLMTALKNLGKLDV-S-DTVGPVVVLVMDKDTQNLGRYQKMVSDLRK
SYH_RHILO       --VPATGFSIGVSRLMTALKNLGKLDN-A-DVIAPVVVLVMDKDTESLGRYQKMVSELRA
SYH_BRADU       --VPATGFSIGVSRLQAALTLLGKLDT-R-PEFGPVVVTVFDRD--RVADYQKMVASLRT
SYH_CAUVC       --TPATGFSFGVSRLAAALRAAGREPG-G-AARGPVVVITFDQA--HMGEYFSVVGQLRA
SYH_CLOAB       --LPGVGMSIGITRLFFVLREIGFIENYN-SSLNEKYLIVPIGD--TFEYCTKILNKLLV
SYH_CLOTE       --LPGVGISIGLTRLFYQLREAKIIGENA-SSTLSQALVIPVGD--TMEYSIKVANKLRE
SYH_XANAC       --LPGVGISIGLTRLFWQLREAGLIQGIA-ESSVQAMVALMDET--RLDDALDIARRLRI
SYH_XANCP       --LPGVGISIGLTRLFWQLREAGLIAGIA-ESSVHAMVALMDES--RLDDALDIARRLRI
SYH_XYLFA       --LPGVGISIGLTRLFWQLRDAGVMDGIA-ESSVQAMVVLMDEA--TLDDALDIARCLRI
SYH_XYLFT       --LPGVGISIGLTRLFWQLRDAGLIDGIA-ESSVQAMVVLMDEA--TLDDALDIARRLRI
SYH_NOSS1       --MPGVGISIGLTRLISRLLKAGILNTLP-PTPAQVVVVNMQDE--LMPTYLKVSQQLRQ
SYH_BIFLO       --YPGVGLSIGLSRLVSYMLHTAGAHANR-VSPAAVLVAVWNEE--DRPAANRIANQLRA
SYH_HELPY       --LQGVGASIGIDRLIVALSEMQLLDE-R-STQAKVLIACMHEE--YFSYANRLAESLRQ
SYH_HELPJ       --LQGVGASIGIDRLIVALSEMQLLDE-R-STQAKVLIACMHEE--YFSYANRLAESLRQ
SYH_BACTN       --VSGVGISFGADRIFDVLNQLELYPKEA-VNGTELMFVNFGDK--EAAFSMSMLAKVRA
SYH_AERPE       --IPATGVSIGIERIIDAGLELGVYSLDV-KTVAQVAVVVLDRR--YYRYAWEAARILRR
SYH_BORBU       QKISGVGGSFGVDRIKDIIDLEKFSYIKIFVTKARSKVLIVNLDSALQNYYYELATRFRN
SYH_TREPA       --VSGVGASIGLDRLYAAFQQLGMSR----EHVCFVQALIFCQDSALMDVYQKLCSYFAV
SYH_LEPIN       --LSGIGFGLGDVTLKNFLEGHNLIPNLS--REKTIFLPIMDESL--FVDTFKLSKELRE
                      * . .                                                 

SYH_CHLMU       L------GVATEVDWAH---KKPKTALKDAADQQVGFVCFVGEQELSTKQFI-----VKD
SYH_CHLTR       L------GIATEVDWSH---KKPKLSLKDAADQQVSFVCLLGEQELATKQFI-----VKD
SYH_CHLPN       L------GIPTEVDWSH---KKVKGALKAASTEQVSFVCLIGERELISQQLV-----IKN
SYH_CHLTE       A------GIKTEIDLAE---RSMKAQMRDANRMGSAYALFVGQSEFESGIYA-----LKN
SYH_COREF       A------GISADMSYGD---RGLKGAMKGADRSGSLYTLVLGENELDNGTVA-----VKD
SYH_CORGL       A------GISTDMSYGD---RGLKGAMKGADRSNALYTLVLGEQELENNTIA-----VKD
SYH_MYCLE       A------GVRVDLIYGD---RGIRGAMRAAGRSGARIALIVDDCAIKADGVG-----VRD
SYH_MYCTU       A------GVRVDLAYGD---RGLKGAMRAAARSGARVALVAGDRDIEAGTVA-----VKD
SYH_STRCO       N------GVAADFSYGG---KGLKAAMKAANRSGARYTLVLGERDLAEGVVQ-----LKD
SYH_DEIRA       S-------CRAEFAYRA---MKPGSAFKDAERRGAVWVGLIGSEEAAAGTLS-----LKN
SYH_THET8       R-------LRAEYALAP---RKPAKGLEEALKRGAAFAGFLGEDELRAGEVT-----LKR
SYH_CLOPE       S------GIKAEIDHLG---KSVKAQMKYANKIGAKYTFVIGDSEIEENKIK-----IKR
SYH_CALS4       N------GLKVEIDHME---RSLKAQMKYANKLNAKFAVVIGEEELESKKVK-----LKN
SYH_THEMA       K------GLSVDVDIMD---RKLSGQLKHASRMGSRYAVIIGDEELEKGIVI-----LRD
SYH_FUSNN       N------DIKVYIDYSE---KGMKSHMKKADKLETRYCVILGEDEFNKGIVL-----LKD
SYH_AQUAE       K------GKVVEYSYRK---GGLKKQLEFADKLGVKYAVIIGEDEVKNQEVT-----IKD
SYH_BACHD       A------GISAEKDYLD---RKMKGQLKAADRLHAKWTVILGEDELAVGKVN-----VKN
SYH_BACSU       A------GISSEIDYEN---KKMKGQFKTADRLKARFIAILGEDELAQNKIN-----VKD
SYH_OCEIH       N------GIQADMDYQK---RKMKGQLKAADRYQSKFVIFLGDDEIEKQEVT-----LKE
SYH_LISIN       N------GISAEKDYLK---RKLKAQLKDANRKKAIYTVILGEEELQTGNYQ-----LKN
SYH_LISMO       N------GISAEKDYLK---RKFKAQLKDANRKNAVYTIILGEEELQTGNYQ-----LKN
SYH_STAAM       N------GIKADKDYLQ---RKIKGQMKQADRLGAKFTIVIGDQELENNKID-----VKN
SYH_STAES       N------GIKVDKDYLN---RKIKGQMKQADRLNAKYTVVIGDQELENNEIG-----VKN
SYH_STRA3       Q------GFKVERDYLG---RKIKAQFKSADTFNAKVIMTLGSSEVDSKEVG-----LKN
SYH_STRP3       Q------GFTAERDYLG---RKIKAQFKSADTFKAKLVMTLGESEVEAGKAV-----IKN
SYH_STRP8       Q------GFTAERDYLG---RKIKAQFKSADTFKAKLVMTLGESEVEAGKAV-----IKN
SYH_STRP1       Q------GFTAERDYLG---RKIKAQFKSADTFKAKLVMTLGESEVEAGKAV-----IKN
SYH_STREQ       Q------GFTVERDYLG---RKIKAQFKSADTFKAKVVITLGESEIKAGQAV-----LKH
SYH_STRMU       Q------GFSAERDYLS---RKIKAQFKSADVFKTKLIMTLGESEVETGQVA-----VKN
SYH_STRPN       Q------GFKAERDYLN---RKLKAQFKSADVFAAKTLITLGESEVESGQVT-----VKN
SYH_STRR6       Q------GFKAERDYLN---RKLKAQFKSADVFAAKTLITLGESEVESGQVT-----VKN
SYH_LACLA       Q------AFKVERDFSN---RKLGAQFKTAEKLGAELIITLGEDEIRTGQIK-----VKH
SYH_LACPL       A------GYKAERDYLD---RKPKAQFKSADRLNARYTMTVGETELADQVVN-----LKA
SYH_SALTI       EMP----GVKLMTNHGG---GNFKKQFARADKWGARIALVLGESEVADGTVV-----VKD
SYH_SALTY       EMP----GVKLMTNHGG---GNFKKQFARADKWGARIALVLGESEVADGTVV-----VKD
SYH_ECOLI       ELP----GVKLMTNHGG---GNFKKQFARADKWGARVAVVLGESEVANGTAV-----VKD
SYH_YERPE       ALP----TLKIMTNYGG---GNVKKQFTRADKWGARVALMLGESEVAAQQVV-----VKD
SYH_VIBPA       AIS----GVRVMNHFGG---GNFKKQFKRADKVGAVVALVLGENEVADNTVV-----LKD
SYH_VIBVU       AIP----GVRVMNHFGG---GNFKKQFKRADKVGAVVALVLGENEVADNTVV-----LKD
SYH_VIBCH       QVP----GLRVMTHFGG---GNFKKQFKRADKVGAAIALVLGEDEVAAQTVV-----VKD
SYH_HAEIN       ELP----HLNTMLHCSS---GNFKKQFKRADKSGATLALVIGESEVQNKQVV-----VKH
SYH_PASMU       ELP----QLRVMTHCSG---GNFKKQFKRADKSGATLALVIGESEVQNQQVV-----VKH
SYH_SHEON       ALP----TLRVMSHCGG---GNLKKQMKRADKSGAQVALLIGEEELAEGVVT-----VKY
SYH_PSEPK       RLP----GLRLAVNAGG---GSFKSQFKKADKSGALFALILGDDELAKQEIG-----LKP
SYH_PSESM       RLP----NLRLQVNAGA---GSFKSQFKKADKSGALYALILGEEELAAKIIG-----VKP
SYH_PSEAE       AIP----GIRLLVNAGA---GSFKSQFKKADKSGARFALILGEDEVANRVVG-----FKP
SYH_NEIMA       QGF----NVMQHSGYQ-----SLKAQMKKADNSGARFALIVAQDELANGTVT-----LKD
SYH_NEIMB       QGF----NVMQHSGYQ-----SLKAQMKKADNSGARFALIVAQDELANGTVT-----LKD
SYH_RALSO       AGL----DVILHASAEGRN-GSFKSQFKRADASGAAYAVIIGDDEVASGVVQ-----IKP
SYH_THEEB       QGY----TVDVDLSGS-----AFGKQVKRADRVGATVCLVIGESEATDGTVQ-----VKW
SYH_SYNY3       QGL----AVALDLSAS-----AFGKQFKRADKSGAIACLVLGDGEIATGTVQ-----LKW
SYH_PORPU       QLV----KTELDISSS-----NFGKQLKQAHKKRAIACLILGDNEIQQETIT-----IKW
SYH_BUCAI       LYP----KLRIFINFLH---QNLTKKIKNAISSLARIIILIGDNEIKKGFFL-----VKD
SYH_BUCAP       IYP----KLKIFVDFMT---CSLSKKIKNAVDSLAHIAILIGANEIKKNCFL-----LKD
SYH_BUCBP       QFP----KKKIMLSILS---SNLRKQFSTANKIKARIVLLLGPNEVKNNLIL-----LKD
SYH_WIGBR       IFSY---KLRIKVDNSQ---KNFKKKLKDADKLGSKIVIILGENEIKNKQIT-----IKN
SYH_RICCN       ENI-------AIIIESL---GKIAKRMQRIFNENAQFIIFIGDEEQANNNLK-----IKD
SYH_RICPR       QNI-------VSIIDPI---GKIAKRIQRVLNEDAKFIIFIGDEEKMNNNLK-----FKD
SYH_CAMJE       EYK-------VLLSYEA---RKLAKHLENADKNNTEIFLCMGENEAQNESLF-----YKN
SYH_MYCGE       -------REYNQVTIYPKV-IKVDNGIRLANRLGYTFIGIVGKTDFDKKAIT-----IKN
SYH_MYCPN       -------RAYHPVTIYPKV-IRIINGIRAAQRLGYRFLGVIGGNNLEQQTIT-----VKD
SYH_MYCPE       -------NLNYRVEVNFDL-KKIDKQFKNSNKYNPKIILIYGDEDHKNKQVT-----LKN
SYH_UREPA       I------NNQLNVDIILSS-TKADKIFKLAQRLNVKKLIILAKKEWSDKKII-----LKD
SYH_MYCPU       -------GDLIKIDCINKV-VNFKKIFK-SKQIKESDFLIFKELNNAQNEVS-----LKN
SYH_METAC       Y-------LPVQIDLME---RNFKAQFSYANTINADYVVIVGEKELEAGKLT-----LRD
SYH_METMA       Y-------LPVQIDLME---RNFKAQLSYANTINADYVIIVGEKELEAGKLT-----LRD
SYH_ARCFU       RG------FTAVVDVMG---RNLKKQMSFASEMGVKYAVILGPDEVKSGRVA-----IKN
SYH_METJA       AG------KIVELEIMG---RKLRKALDYANSRGFKKVIIVGEKELNEGKVT-----VKD
SYH_METTH       AG------VSADLEVSG---RKLRKALSHADNLGARFAVLTGEREIQDGKVT-----VKD
SYH_METKA       LG------WVVNVEVSG---KHIRKALSLADSLEYDYAVIVGERELKEGYVS-----VKN
SYH_PYRAB       AG------IRSDIELSG---RKLRKALDYANRIGVRLSIIVGKRDLERGVVT-----IRD
SYH_PYRHO       EK------IKTDIELSG---RKLGKALDYANRVGAKLVIIVGKRDVERGVVT-----IRD
SYH_PYRFU       SG------IKTEIELMG---RKLKKAMDYANKVGVKKTIIVGEKDLERGVVT-----VRD
SYH_SACS2       EE------YKVVINTKD---QPLSKLLPYYASQGFKLAIIIGKQELEKNMIT-----VRN
SYH_SULTO       NN------YIATINLKS---ISISKLIPSYAEEGYSFLIFIGKKEYEDKTIT-----LKN
SYH_PYRAE       EG------YSVVVELGE---KGLKDAFEYALKVGARHIIIIGRKELEKGVIK-----VRD
SYH_THEAC       R------GMNVTVEIME---RGLSAQLKYASAIGADFAVIFGERDLERGVVT-----IRN
SYH_THEVO       S------GFIVSAEIMD---RSLSSQLKYASYEGCEYAVIAGERDLENNSVT-----VRD
SYH_HALSA       R------GNRVDTDITG---RSFGAQMNYADNVGADTVVIVGEQDLADGNVT-----IKN
SYH_AGRFC       E------GIRAEMYQGNW--KKFGNQLKYADRLGSPIAIIQGGDERAEGVVQ-----IKD
SYH_RHIME       A------GIRAEMYQGNK--KNFGDQLKYADRRGSPIAVIQGGDERASGVVQ-----IKD
SYH_BRUME       A------GIRAEMYVGG---SGMKAQMKYADRRAAPCVVIQGSQEREAGEVQ-----IKD
SYH_BRUSU       A------GIRAEMYVGG---SGMKAQMKYADRRAAPCVVIQGSQEREAGEVQ-----IKD
SYH_RHILO       A------GIRSEMYLGG---AGMKAQLKYADRRGCPVAIIQGGDERAKGELQ-----IKD
SYH_BRADU       A------GIRAELYLGNP--KNMGNQLKYADRRNSPCVIIQGSDEKARGELQ-----IKD
SYH_CAUVC       A------GIAAEVYLGT---SGMKPQMKYADRRGAPAVVMLGGDEIAAGTVT-----IKD
SYH_CLOAB       N------GKSAEIYFEE---GKLKKKLTYANKLDIKYVILIGEDEVTNKELV-----IKD
SYH_CLOTE       N------EIISELYLED---AKIGKKFAYADKLKIPYVILIGEDELKEEKVS-----VKN
SYH_XANAC       G------GINTEVQMEP---KKIGKQFQYAARAGIRFVVLAGDDELARGVVA-----VKD
SYH_XANCP       G------GINTEVQMEP---KKVGKQFQYAARAGIRFVVLAGDDELARGVVA-----VKD
SYH_XYLFA       G------GINTEVQMEA---KKVSKQFQYASRAGIRFVVLAGDDERARGVVA-----VKD
SYH_XYLFT       G------GINTEVQMEA---KKLSKQFQYASRAGIRFVVLAGDDERARGVVA-----VKD
SYH_NOSS1       A------GLNVITNFEK---RQLGKQFQAADKQGIRFCVIIGADEAAAQKSS-----LKD
SYH_BIFLO       R------GIATDVAPTA---AKLGKQIKYADKLGIPYVWFPATAAEGAEGAEPAGDEVKN
SYH_HELPY       S------GIFSEVYPEA---QKIKKPFSYANHKGHEFVAVIGEEEFKSETLS-----LKN
SYH_HELPJ       S------GIFSEVYPEA---QKIKKPFSYANHKGHEFVAVIGEEEFKSETLS-----LKN
SYH_BACTN       A------GIRAEIFPDA---AKMKKQMSYANAKSVPFVAIVGENEMNEGKAM-----LKN
SYH_AERPE       G------GLNVRIDLSR---ASGQVQRRKASRLGIPVLAFVGAKEAEGGFLT-----LYS
SYH_BORBU       HDYSKVKNISCEVYFKNKNGKNIKEQIEYALSKEIRFLVFVGQEEYKENKMK-----VRD
SYH_TREPA       Q-------VATEVFPDP---RKLSQQYAFAEKKGIRWGIFVEQRNAVVEDCL---LVLRD
SYH_LEPIN       N------EILTETMLDS---AKIGKQIQIAEKKGYRYVLFLGESEIRTETVQ-----IKD
                                                                            

SYH_CHLMU       MSL---HQ----SFSGAQQDV----------------------EQRLVYEVQNA------
SYH_CHLTR       MSL---HQ----SFSGAQQDV----------------------EQRLVYEVQNA------
SYH_CHLPN       MSL---RK----EFFGTKEEV----------------------EQRLLYEIQNTPL----
SYH_CHLTE       LVT---SE----QTSLDLDAI----------------------IEVLREPAARESLRP--
SYH_COREF       MRA---HD----QQDIALSEV----------------------VSALRAKLA--------
SYH_CORGL       MRA---HE----QHDVALDEV----------------------VAFLQGKLI--------
SYH_MYCLE       LAT---GE----QISVAVDSV----------------------VAEVISRIAPS------
SYH_MYCTU       LTT---GE----QVSVSMDSV----------------------VAEVISRLAG-------
SYH_STRCO       MES---GE----QTAIGVNEI----------------------VAELESRLG--------
SYH_DEIRA       LHT---GE----QKTVP--------------------------VGELGQALA--------
SYH_THET8       LAT---GE----QVRLSREEV----------------------PGYLLQALG--------
SYH_CLOPE       MSD---GEQ--FEVSLDINEI----------------------VNIVK------------
SYH_CALS4       MAT---GE----ETEILIDEI----------------------EKAIKN-----------
SYH_THEMA       LET---GDQVEIDRDFAADYI----------------------AERVSKD----------
SYH_FUSNN       FST---RE----QKEIKIEEI----------------------INYIK------------
SYH_AQUAE       MET---GE----QRRVKLSEL---------------------------------------
SYH_BACHD       MET---GE----QTDVALTDL----------------------VSHMKQQVEGGNES---
SYH_BACSU       AQT---GE----QIEVALDEF----------------------IHVMKANQKG-------
SYH_OCEIH       MST---GD----QSEVSMSQL----------------------VEVLQEKLNGGKIYE--
SYH_LISIN       MET---GE----QEAVSETTI----------------------IEKLTNTKEEK------
SYH_LISMO       MET---GE----QEAVSETTI----------------------LEKLSNTKGEK------
SYH_STAAM       MTT---GE----SETIELDAL----------------------VEYFKK-----------
SYH_STAES       MIS---GE----SENVQLDEL----------------------VNYFKSRKEV-------
SYH_STRA3       NQT---RQ----EVKVSFENI----------------------KTDFSSVLKQLGL----
SYH_STRP3       NRS---RQ----EVEVSFEDM----------------------MTNFANISEQLLS----
SYH_STRP8       NRS---RQ----EVEVSFEDM----------------------MTNFANISEQLLS----
SYH_STRP1       NRS---RQ----EVEVSFEDM----------------------MTNFANISEQLLS----
SYH_STREQ       NQT---RQ----EMTVSFDQI----------------------QTDFASIFAECVQ----
SYH_STRMU       NFT---RQ----EIAVSFEEI----------------------KTDFASVFKQLGSDRP-
SYH_STRPN       NQT---RE----EVQVSLETI----------------------SQNFSEIFEKLGFYTQ-
SYH_STRR6       NQT---RE----EVQVSLETI----------------------SQNFSEIFEKLGFYTQ-
SYH_LACLA       NQT---RK----QVETTLKAV----------------------HESFAPIFEEIYADEEL
SYH_LACPL       MAT---GE----ETKVAMADI----------------------YQDAHQVLDK-------
SYH_SALTI       LRS---G-E---QTAVAQDSV----------------------AAHLRTLLG--------
SYH_SALTY       LRS---G-E---QTAVAQDSV----------------------AAHLRTLLG--------
SYH_ECOLI       LRS---G-E---QTAVAQDSV----------------------AAHLRTLLG--------
SYH_YERPE       LRN---G-E---QETLAQADV----------------------AARLALMLG--------
SYH_VIBPA       LVG---G-E---QETYNQAEV----------------------AEKIAALI---------
SYH_VIBVU       LAG---G-E---QVTYSQQEI----------------------ASKIAELI---------
SYH_VIBCH       LAG---G-E---QNTVAQAEV----------------------AKLLAHLA---------
SYH_HAEIN       LQG---GTD---QQTLDLVNI----------------------IDYLQTQF---------
SYH_PASMU       LLG---GAE---QQTLALDDI----------------------VDYIKNNF---------
SYH_SHEON       LRN---DNE---QQRVARNAL----------------------SAFLAELTK--------
SYH_PSEPK       LRG---QGE---QQNIAWDAL----------------------AEHLETAIAQA------
SYH_PSESM       LRG---QGE---QQNIAWDAL----------------------SEHLASCVVQG------
SYH_PSEAE       LRD---EGE---QQSIAWDAL----------------------PEHLAACLAQA------
SYH_NEIMA       MNG---AHD---QQTVAAADL----------------------TNTLQQWKNA-------
SYH_NEIMB       MNG---AHG---QQTVAAEDL----------------------TPTLQQWKNA-------
SYH_RALSO       LRGDPNADA---QQTVPSDQL----------------------VDRLIDAMVANSD----
SYH_THEEB       LAS----GE---QVLVPQQEL--------------------LSENWRSRFLTPHDGLLSH
SYH_SYNY3       LAD----KA---QETLQLQDLMGNITELKQRLAGHREKYPHLTSNFSVTCHDPMDNLV--
SYH_PORPU       MYT----QE---QENMSIIEF-------------------KNKISYLKKKIAFNKKFNSY
SYH_BUCAI       LKEKK-------EYHLLKKEL----------------------ILKIQEIFK--------
SYH_BUCAP       LKRGR-------EYFFSKSEL----------------------ILKIKKIFYKQGN----
SYH_BUCBP       LTSGY-------QKSFLKNKI----------------------IEELELAFKN-------
SYH_WIGBR       LSTRK-------QYTLYIDDA----------------------IEKIKKIFTKNIQ----
SYH_RICCN       LKKAE-------EYIVDFAKA----------------------LELLKK-----------
SYH_RICPR       LKNQK-------EYIIDFEKV----------------------LELLKQ-----------
SYH_CAMJE       LAKKE-------EKMIKISDL----------------------KKVL-------------
SYH_MYCGE       LVS---------KQQTIYTWN----------------------ELGERNVF---------
SYH_MYCPN       LAT---------EQQTTYTWD----------------------EFRQRQVL---------
SYH_MYCPE       QKT---------LENKVIKL------------------------NELNNKIKEFFESDK-
SYH_UREPA       LLN---------FKQDLLSL------------------------DEIKGIR---------
SYH_MYCPU       KFN---------DQKLVVDLI----------------------NPNIENIKKYIKENSD-
SYH_METAC       MVSGE-------QELLTLEEI----------------------IEKITGQQD--------
SYH_METMA       MVSGE-------QELLTLEEI----------------------IEKISGQ----------
SYH_ARCFU       LETQE-------QVVVAEEEL----------------------FSILQ------------
SYH_METJA       MITGE-------QKLIGIDEL----------------------TNF--------------
SYH_METTH       MERNS-------QETLPRDEM----------------------VDKIKGRC---------
SYH_METKA       LKTGV-------QEEVPLDQL----------------------ERAAEV-----------
SYH_PYRAB       LESGN-------QVEVPVDNV----------------------VTKVRELLNQ-------
SYH_PYRHO       MESGE-------QYNVSLNEI----------------------VDKVKNLLKR-------
SYH_PYRFU       MESGE-------QNEVKIDDI----------------------VEFMKNALKT-------
SYH_SACS2       LITRK-------QISIPLENV----------------------LDAIKQTL---------
SYH_SULTO       LSTKE-------QVTIKEENL----------------------LDYLKQII---------
SYH_PYRAE       LEKRI-------EVEKPLSQF----------------------LA---------------
SYH_THEAC       MYT----GS---QENVGLDSV----------------------VEHLISQAT--------
SYH_THEVO       LST----GE---QEIVTLGDL----------------------VPFLEKSTSY-------
SYH_HALSA       MAS----GE---QTTAPIAAF----------------------PGAHDAPRVEDFA----
SYH_AGRFC       LIE----GK---RLSGEIEDN----------------------ASWREARVAQVSVPEAE
SYH_RHIME       LIE----GK---RLSGEIEDN----------------------VAWREARVAQVSVPEGE
SYH_BRUME       LVE----GK---RLSAEIEDN----------------------VTWRESRPAQITVREDG
SYH_BRUSU       LVE----GK---RLSAEIEDN----------------------VTWRESRPAQITVREDG
SYH_RHILO       LIE----GA---RMSAEITDN----------------------AEWRAARPAQVTVAESE
SYH_BRADU       LIE----GA---KAAAAIASN----------------------QEWRESRPAQFSCAEAD
SYH_CAUVC       LDA----GR---MAAEGLTDN----------------------AAWKAERPGQQTIPRDQ
SYH_CLOAB       MIT----GE---QKKLNIEEI---------------------------------------
SYH_CLOTE       MET----GN---QESMSLEEA----------------------IKIIKNA----------
SYH_XANAC       LVR----EQ---QFDVARDEL----------------------ASTLQVELEQARAMLVA
SYH_XANCP       LVR----EQ---QFDVARDEL----------------------ASTLQVELEQAKAMLVS
SYH_XYLFA       LTR----EQ---QFEIPREEL----------------------ASTLQVELEQAKVM---
SYH_XYLFT       LTR----EQ---QFEIPREEL----------------------ASTLQVELEQAKVM---
SYH_NOSS1       LQS----GE---QVEVALADL----------------------AEEIKRRLT--------
SYH_BIFLO       IVT----GE---QVAADCTSW----------------------EPDTVVAQQTVEI----
SYH_HELPY       MHS----GM---QLNCLSFLK----------------------ALEIIGENDEDL-----
SYH_HELPJ       MHS----GM---QLNCLSFLK----------------------ALEIIGENDEDL-----
SYH_BACTN       MET----GE---QNLVSVEEL----------------------IAALRN-----------
SYH_AERPE       AAK----GE---RVAVPLGEA----------------------VKAVERLLPS-------
SYH_BORBU       LTKKE-------ELLLSFEES----------------------INLIKCNEKLLCTPF--
SYH_TREPA       LSTRK-------DTRLPAHEV----------------------RRRMAAEG---------
SYH_LEPIN       LISGE-------QKSLPRKGL----------------------SDTLKKDFQL-------
                                                                            

SYH_CHLMU       -----------------------
SYH_CHLTR       -----------------------
SYH_CHLPN       -----------------------
SYH_CHLTE       -----------------------
SYH_COREF       -----------------------
SYH_CORGL       -----------------------
SYH_MYCLE       -----------------------
SYH_MYCTU       -----------------------
SYH_STRCO       -----------------------
SYH_DEIRA       -----------------------
SYH_THET8       -----------------------
SYH_CLOPE       -----------------------
SYH_CALS4       -----------------------
SYH_THEMA       -----------------------
SYH_FUSNN       -----------------------
SYH_AQUAE       -----------------------
SYH_BACHD       -----------------------
SYH_BACSU       -----------------------
SYH_OCEIH       -----------------------
SYH_LISIN       -----------------------
SYH_LISMO       -----------------------
SYH_STAAM       -----------------------
SYH_STAES       -----------------------
SYH_STRA3       -----------------------
SYH_STRP3       -----------------------
SYH_STRP8       -----------------------
SYH_STRP1       -----------------------
SYH_STREQ       -----------------------
SYH_STRMU       -----------------------
SYH_STRPN       -----------------------
SYH_STRR6       -----------------------
SYH_LACLA       -----------------------
SYH_LACPL       -----------------------
SYH_SALTI       -----------------------
SYH_SALTY       -----------------------
SYH_ECOLI       -----------------------
SYH_YERPE       -----------------------
SYH_VIBPA       -----------------------
SYH_VIBVU       -----------------------
SYH_VIBCH       -----------------------
SYH_HAEIN       -----------------------
SYH_PASMU       -----------------------
SYH_SHEON       -----------------------
SYH_PSEPK       -----------------------
SYH_PSESM       -----------------------
SYH_PSEAE       -----------------------
SYH_NEIMA       -----------------------
SYH_NEIMB       -----------------------
SYH_RALSO       -----------------------
SYH_THEEB       -----------------------
SYH_SYNY3       -----------------------
SYH_PORPU       -----------------------
SYH_BUCAI       -----------------------
SYH_BUCAP       -----------------------
SYH_BUCBP       -----------------------
SYH_WIGBR       -----------------------
SYH_RICCN       -----------------------
SYH_RICPR       -----------------------
SYH_CAMJE       -----------------------
SYH_MYCGE       -----------------------
SYH_MYCPN       -----------------------
SYH_MYCPE       -----------------------
SYH_UREPA       -----------------------
SYH_MYCPU       -----------------------
SYH_METAC       -----------------------
SYH_METMA       -----------------------
SYH_ARCFU       -----------------------
SYH_METJA       -----------------------
SYH_METTH       -----------------------
SYH_METKA       -----------------------
SYH_PYRAB       -----------------------
SYH_PYRHO       -----------------------
SYH_PYRFU       -----------------------
SYH_SACS2       -----------------------
SYH_SULTO       -----------------------
SYH_PYRAE       -----------------------
SYH_THEAC       -----------------------
SYH_THEVO       -----------------------
SYH_HALSA       -----------------------
SYH_AGRFC       LVAKVREILEHQAEDVRRAAEGR
SYH_RHIME       LVAKVRQILAEQAEDRKRAG---
SYH_BRUME       LVDAVREILDAQARDRAEQSK--
SYH_BRUSU       LVDAVREILDAQARDRAEQSK--
SYH_RHILO       LVAEVKKILAAQAEERARGK---
SYH_BRADU       LVAKVREVLARHDVSWG------
SYH_CAUVC       LVDAVRKIIGG------------
SYH_CLOAB       -----------------------
SYH_CLOTE       -----------------------
SYH_XANAC       GSVQGD-----------------
SYH_XANCP       GIAAN------------------
SYH_XYLFA       -----------------------
SYH_XYLFT       -----------------------
SYH_NOSS1       -----------------------
SYH_BIFLO       -----------------------
SYH_HELPY       -----------------------
SYH_HELPJ       -----------------------
SYH_BACTN       -----------------------
SYH_AERPE       -----------------------
SYH_BORBU       -----------------------
SYH_TREPA       -----------------------
SYH_LEPIN       -----------------------