CLUSTAL format seed alignment for MF_00129

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

MNMG_NOSS1       --------MTMHNSVEFQDAFDVIVVGAGHSGCEAALATARLGCRTLLLTLNLDKIAWQP
MNMG_TRIV2       --------MTMHNSVEFQDAFDVIVVGAGHSGCEAALATARLGCRTLLLTLNLDKIAWQP
MNMG_TRIEI       ----------MNQTFDFQDEYDIIVVGAGHSGCEAALATARLGCHTLLLTLNLDKIAWQP
MNMG_SYNY3       --------MTLRSPVEFQDQFDVIVVGAGHAGCEAALATARLGCRTLLLTLNLDRIAWQP
MNMG_SYNP2       ---------MLRTPVDFQDEFDVIVIGAGHSGCEAALASARLGCRTLMLTLNLDKIAWQP
MNMG_MICAN       --------MTFSSAADFQDEFDVIVVGAGHSGCEAALACARLGCRTLLLTLNLDKIAWQP
MNMG_ACAM1       --------MTSPQAVEFLDEFEVIVVGAGHAGCEAALASARMGCSTLLLTLNLDKIAWQP
MNMG_SYNP6       --------------MPHTEEFDVIVIGAGHAGCEAALAAARLGCQTLLLTLNLDRIGWQP
MNMG_SYNE7       --------------MPHTEEFDVIVIGAGHAGCEAALAAARLGCQTLLLTLNLDRIGWQP
MNMG_THEEB       ----------MSTLPAFQDEFDVIVVGAGHAGCEAALATARLGCRTLLLTLNLDKIAWQP
MNMG_SYNJB       ------MLRVGRDSIDFLDHYDVVVVGGGHSGCEAALAAARLGCNTLMLTLNLDKIAWQP
MNMG_SYNJA       ------MLKVGRDNVDFLDHYDVIVVGGGHAGCEAALAAARLGCNTLMLTLNLDKIAWQP
MNMG_PROM1       ----------MITKQSSNESFDVIVVGGGHAGCEAALTSARLGLNTALFTLNLDRIAWQP
MNMG_PROMT       ----------MITKQSSNESFDVIVVGGGHAGCEAALTSARLGLNTALFTLNLDRIAWQP
MNMG_PROMA       ----------MSNYSNAKEKFDVIVVGGGHAGCEAAIATAKLGLSTALFTLNLDRIAWQP
MNMG_PROM3       ----------MPFSAPPTEHFDVIVVGGGHAGCEAALTAARLGLSTALFTLNLDRIAWQP
MNMG_PROMM       ----------MPFSAPPTEHFDVIIVGGGHAGCEAAITAARLGLSTALFTLNLDRIAWQP
MNMG_SYNSC       ----------MSFSAAPTESFDVIVVGGGHAGCEAAITAARLGLNTALFSLNLDRIAWQP
MNMG_SYNPX       ----------MALTTAPTESFDVIVVGGGHAGCEAAITAARLGLNTALFTLNLDRIAWQP
MNMG_SYNS9       ----------MSFTAAPTESFDVIVVGGGHAGCEAAITTARLGLNTALFSLNLDRIAWQP
MNMG_SYNPW       ----------MANSFSPTEIFDVIVVGGGHAGCEAAITSARLGLNTALFTLNLDRIAWQP
MNMG_SYNS3       ----------MSFSPPPTEVFDVIVVGGGHAGCEAAITAARLGLSTALFTLNLDRIAWQP
MNMG_SYNR3       ----------MEPAALPTESFELIVVGGGHAGCEAALTAARLGISTALFSLNLDRIAWQP
MNMG_PROMS       ----------MQDHNSTNESFDVIVIGGGHAGCEAAITTAKLGFSTALFTINLDRIAWQP
MNMG_PROM0       ----------MQDHHSTNESFDVIVIGGGHAGCEAAITTAKLGFSTALFTINLDRIAWQP
MNMG_PROM9       ----------MQDHHSTNESFDIVVIGGGHAGCEAAITSAKLGFSTALFTINLDRIAWQP
MNMG_PROM2       ----------MQDHQATNESFDIIVIGGGHAGCEAAITTAKLGFSTALFTINLDRIAWQP
MNMG_PROM5       ----------MKKQQSSNESFDVIVIGGGHAGCEAAITTAKLGFSTALFTINLDRIAWQP
MNMG_PROMP       ----------MKDPQSPNESFDIIVIGGGHAGCEAAITTAKLGFSTALFTINLDRIAWQP
MNMG_CHLTR       ----------MWTFPV---DYDVIVIGAGHAGCEAAYCAAKMGASVLLLTSNLDTIAKLS
MNMG_CHLTA       ----------MWTFPV---DYDVIVIGAGHAGCEAAYCAAKMGASVLLLTSNLDTVAKLS
MNMG_CHLT2       ----------MWTFPV---DYDVIVIGAGHAGCEAAYCAAKMGASVLLLTSNLDTIAKLS
MNMG_CHLTB       ----------MWTFPV---DYDVIVIGAGHAGCEAAYCAAKMGASVLLLTSNLDTIAKLS
MNMG_CHLMU       ----------MWTFPV---EYDVIVIGAGHAGCEAAYCAAKMGASVLLLTSNLDTIAKLS
MNMG_CHLAB       ----------MWTHPI---NYDVIVVGAGHAGCEAAFCSAKMGASVLILSSNLDTIAKLS
MNMG_CHLCV       ----------MWTHPI---NYDVIVVGAGHAGCEAAFCSAKMGASVLILTSNLDTIAKLS
MNMG_CHLFF       ----------MWTHPI---SYDVIVVGAGHAGCEAAFCSAKMGASVLILTSNLDTIAKLS
MNMG_CHLPN       ----------MWTHPI---AYDVIVVGAGHAGCEAAYCSAKMGVSVLMLTSNLDTIAKLS
MNMG_PARUW       --------MMLWKFPV---RYDVIVIGGGHAGCEAALASARMGLRTLLLTMNLDTIAKMS
MNMG_RHOBA       ---------MTANNPQNRYDYDVVVIGAGHAGTEAAAAAARLGAKTALLTTNLDTVGQMS
MNMG_OPITP       ---------MRFNSEP----FDVIVCGAGHAGIEASLAAARVGAFTLLLTGNLDTVGQMS
MNMG_AQUAE       ---------MAWVVDE----FDVVVIGGGHAGIEAALAAARMGAKTAMFVLNADTIGQMS
MNMG_ECOLI       --------------MFYPDPFDVIIIGGGHAGTEAAMAAARMGQQTLLLTHNIDTLGQMS
MNMG_ECOL6       --------------MFYPDPFDVIIIGGGHAGTEAAMAAARMGQQTLLLTHNIDTLGQMS
MNMG_ECO24       --------------MFYPDPFDVIIIGGGHAGTEAAMAAARMGQQTLLLTHNIDTLGQMS
MNMG_ECODH       --------------MFYPDPFDVIIIGGGHAGTEAAMAAARMGQQTLLLTHNIDTLGQMS
MNMG_ECOL5       --------------MFYPDPFDVIIIGGGHAGTEAAMAAARMGQQTLLLTHNIDTLGQMS
MNMG_ECOHS       --------------MFYPDPFDVIIIGGGHAGTEAAMAAARMGQQTLLLTHNIDTLGQMS
MNMG_ECOLC       --------------MFYPDPFDVIIIGGGHAGTEAAMAAARMGQQTLLLTHNIDTLGQMS
MNMG_SHIBS       --------------MFYPDPFDVIIIGGGHAGTEAAMAAARMGQQTLLLTHNIDTLGQMS
MNMG_SHISS       --------------MFYPDPFDVIIIGGGHAGTEAAMAAARMGQQTLLLTHNIDTLGQMS
MNMG_ECOUT       --------------MFYPDPFDVIIIGGGHAGTEAAMAAARMGQQTLLLTHNIDTLGQMS
MNMG_ECOK1       --------------MFYPDPFDVIIIGGGHAGTEAAMAAARMGQQTLLLTHNIDTLGQMS
MNMG_ECOSM       --------------MFYPDPFDVIIIGGGHAGTEAAMAAARMGQQTLLLTHNIDTLGQMS
MNMG_ECO57       --------------MFYPDPFDVIIIGGGHAGTEAAMAAARMGQQTLLLTHNIDTLGQMS
MNMG_SHIDS       --------------MFYPDPFDVIIIGGGHAGTEAAMAAARMGQQTLLLTHNIDTLGQMS
MNMG_SHIFL       --------------MFYPDPFDVIIIGGGHAGTEAAMAAARMGQQTLLLTHNIDTLGQMS
MNMG_SHIF8       --------------MFYPDPFDVIIIGGGHAGTEAAMAAARMGQQTLLLTHNIDTLGQMS
MNMG_SALCH       --------------MFYQDPFDVIIIGGGHAGTEAAMAAARMGQQTLLLTHNIDTLGQMS
MNMG_SALTY       --------------MFYQDPFDVIIIGGGHAGTEAAMAAARMGQQTLLLTHNIDTLGQMS
MNMG_SALPB       --------------MFYQDPFDVIIIGGGHAGTEAAMAAARMGQQTLLLTHNIDTLGQMS
MNMG_SALPA       --------------MFYQDPFDVIIIGGGHAGTEAAMAAARMGQQTLLLTHNIDTLGQMS
MNMG_SALTI       --------------MFYQDPFDVIIIGGGHAGTEAAMAAARMGQQTLLLTHNIDTLGQMS
MNMG_CITK8       --------------MFYPDPFDVIIIGGGHAGTEAAMAAARMGQQTLLLTHNIDTLGQMS
MNMG_SALAR       --------------MFYPDPFDVIIIGGGHAGTEAAMAAARMGQQTLLLTHNIDTLGQMS
MNMG_ENT38       --------------MFYQDPFDVIIIGGGHAGTEAAMAAARMGQQTLLLTHNIDTLGQMS
MNMG_KLEP7       --------------MFYQDPFDVIIIGGGHAGTEAAMAAARMGQQTLLLTHNIDTLGQMS
MNMG_CROS8       --------------MFYPDPFDVIIIGGGHAGTEAAMAAARMGQQTLLLTHNIDTLGQMS
MNMG_PECAS       --------------MFYPDPFDVIVIGGGHAGTEAAMASARMGQQTLLLTHNIDTLGQMS
MNMG_YERPE       --------------MFYPDQFDVIIIGGGHAGTEAAMAAARMGRQTLLLTHNIDTLGQMS
MNMG_YERPY       --------------MFYPDQFDVIIIGGGHAGTEAAMAAARMGRQTLLLTHNIDTLGQMS
MNMG_YERPA       --------------MFYPDQFDVIIIGGGHAGTEAAMAAARMGRQTLLLTHNIDTLGQMS
MNMG_YERPN       --------------MFYPDQFDVIIIGGGHAGTEAAMAAARMGRQTLLLTHNIDTLGQMS
MNMG_YERPP       --------------MFYPDQFDVIIIGGGHAGTEAAMAAARMGRQTLLLTHNIDTLGQMS
MNMG_YERPS       --------------MFYPDQFDVIIIGGGHAGTEAAMAAARMGRQTLLLTHNIDTLGQMS
MNMG_YERP3       --------------MFYPDQFDVIIIGGGHAGTEAAMAAARMGRQTLLLTHNIDTLGQMS
MNMG_YERE8       --------------MFYPDQFDVIIIGGGHAGTEAAMAAARMGRQTLLLTHNIDTLGQMS
MNMG_SERP5       --------------MFYPEQFDVIIIGGGHAGTEAAMAAARMGRQTLLLTHNIDTLGQMS
MNMG_PHOLL       --------------MFYPEQFDVIIIGGGHAGTEAAMAAARMGRQTLLLTHNIDTLGQMS
MNMG_SODGM       --------------MFYPDHFDVIIIGGGHAGTEAAMASARMGCQTLLLTHNIDTLGQMS
MNMG_VIBCH       --------------MLYHETFDVIVVGGGHAGTEAALAAARTGQRTLLLTHNIDTLGQMS
MNMG_VIBC3       --------------MLYHETFDVIVVGGGHAGTEAALAAARTGQRTLLLTHNIDTLGQMS
MNMG_VIBCB       --------------MLYHENFDVIVVGGGHAGTEAALASARTGQKTLLLTHNIDTLGQMS
MNMG_VIBPA       --------------MLYHENFDVIVVGGGHAGTEAALASARTGQKTLLLTHNIDTLGQMS
MNMG_VIBVU       --------------MLYHETFDVIVVGGGHAGTEAALASARTGQKTLLLTHNIDTLGQMS
MNMG_VIBVY       --------------MLYHETFDVIVVGGGHAGTEAALASARTGQKTLLLTHNIDTLGQMS
MNMG_ALIF1       --------------MFYQDNFDVIVIGGGHAGTEAALAAARTGQNTLLLTHNIDTLGQMS
MNMG_PHOPR       --------------MFYQENFDVIVVGGGHAGTEAALAAARMGQKTLLLTHNIDTLGQMS
MNMG_AERHH       --------------MQYHEQFDVIVVGGGHAGTEAATAAARMGLNTLLLTHNIDTLGHMS
MNMG_AERS4       --------------MQYHEQFDVIVVGGGHAGTEAATAAARMGLNTLLLTHNIDTLGHMS
MNMG_COLP3       --------------MWYQESYDVIVVGGGHAGTEASLAAARMGCKTLLLTHNIDTLGQMS
MNMG_PSEA6       --------------MFYQQQFDVIVVGGGHAGTEAALAAARMGSKTLLLTHNVETLGQMS
MNMG_IDILO       ------------MSQQSQQHFDVIVVGGGHAGTEAALAAARLGVKTLLLTHNIDTLGQMS
MNMG_PSET1       --------------MIFHENFDVIVVGGGHAGTEAALAAARMGMNTLLLTHNMDTLGQMS
MNMG_SHEB5       --------------MHFHERFDVIVVGGGHAGTEAALAAARMGSKTLLLTHNIDTLGQMS
MNMG_SHEB8       --------------MHFHERFDVIVVGGGHAGTEAALAAARMGSKTLLLTHNIDTLGQMS
MNMG_SHEB9       --------------MHFHERFDVIVVGGGHAGTEAALAAARMGSKTLLLTHNIDTLGQMS
MNMG_SHEPC       --------------MHFHERFDVIVVGGGHAGTEAALAAARMGSKTLLLTHNIDTLGQMS
MNMG_SHESW       --------------MHFHERFDVIVVGGGHAGTEAALAAARMGSKTLLLTHNIDTLGQMS
MNMG_SHESM       --------------MHFHERFDVIVVGGGHAGTEAALAAARMGSKTLLLTHNLDTLGQMS
MNMG_SHESR       --------------MHFHERFDVIVVGGGHAGTEAALAAARMGSKTLLLTHNLDTLGQMS
MNMG_SHESA       --------------MHFHERFDVIVVGGGHAGTEAALAAARMGSKTLLLTHNLDTLGQMS
MNMG_SHEON       --------------MHFHERFDVIVVGGGHAGTEAALAAARMGSKTLLLTHNLDTLGQMS
MNMG_SHEDO       --------------MHFHERFDVIVVGGGHAGTEAALASARMGSKTLLLTHNIDTLGQMS
MNMG_SHEFN       --------------MHFHERFDVIVVGGGHAGTEAALAAARMGSKTLLLTHNIDTLGQMS
MNMG_SHEHH       --------------MQFHERFDVIVVGGGHAGTEAALASARMGSKTLLLTHNIDTLGQMS
MNMG_SHEPA       --------------MQFHERFDVIVVGGGHAGTEAALASARMGSKTLLLTHNIDTLGQMS
MNMG_SHESH       --------------MHFHERFDVIVIGGGHAGTEAALAAARMGSKTLLLTHNIDTLGQMS
MNMG_SHEWM       --------------MHFHERFDVIVIGGGHAGTEAALAAARMGSKTLLLTHNIDTLGQMS
MNMG_SHELP       --------------MHFHERFDVIVVGGGHAGTEAALASARMGSKTLLLTHNIDTLGQMS
MNMG_SHEAM       --------------MQFHERFDVIVVGGGHAGTEAALAAARMGCKTLLLTHNVDTLGQMS
MNMG_PSYIN       --------------MNYHEHFDVIVIGGGHAGTEAAAAAARMGMNTLLLTHNIETLGQMS
MNMG_ACTP2       --------------MIYHEIYDVIVVGGGHAGTEAALAPARMGLKTLLLTHNVDTLGQMS
MNMG_ACTPJ       --------------MIYHEIYDVIVVGGGHAGTEAALAPARMGLKTLLLTHNVDTLGQMS
MNMG_HAEDU       --------------MIYPEHYDVIVVGGGHAGTEAALAPARMGLKTLLLTHNVDTLGQMS
MNMG_HAEIN       --------------MFYTETYDVIVIGGGHAGTEAALAPARMGFKTLLLTHNVDTLGQMS
MNMG_HAEIG       --------------MFYTETYDVIVIGGGHAGTEAALAPARMGFKTLLLTHNVDTLGQMS
MNMG_HAEIE       --------------MFYTETYDVIVIGGGHAGTEAALAPARMGFKTLLLTHNVDTLGQMS
MNMG_HAEI8       --------------MFYTETYDVIVIGGGHAGTEAALAPARMGLKTLLLTHNVDTLGQMS
MNMG_HAES1       --------------MFYTENYDVIVIGGGHAGTEAALATARMKLKTLLLTHNIDTLGQMS
MNMG_HISS2       --------------MFYTENYDVIVIGGGHAGTEAALATARMKLKTLLLTHNIDTLGQMS
MNMG_MANSM       --------------MFYSENYDVIVIGGGHAGTEAALAPARMGLKTLLLTHNIDTLGQMS
MNMG_PASMU       --------------MFYTENYDVIVIGGGHAGTEAALAPARMGLKTLLLTHNVDTLGQMS
MNMG_ACTSZ       --------------MFYTENYDVIVIGGGHAGTEAALAPARMGLKTLLLTHNVDTLGQMS
MNMG_HYDCU       -------------MDSKITNFDVIVVGGGHAGTEAALAAARMGVRTLLLTDNIDTLGQMS
MNMG_ACIAC       --------------MLYPQEFDVIVVGGGHAGTEAALAAARMGSRTLLLTHNIETLGQMS
MNMG_ACISJ       --------------MLYPQDFDVIVVGGGHAGTEAALAAARMGSRTLLLTHNIETLGQMS
MNMG_VEREI       --------------MLYPQEFDVIVVGAGHAGTEAALAAARLGQRTLLLTQSLETLGQMS
MNMG_POLNA       --------------MFYPQEFDVIVVGGGHAGTEAALAAARMGCKTLLLTHNIETLGQMS
MNMG_POLSJ       ----------MQSPYIYPQEFDVIVVGGGHAGTEAALASARMGCKTLLLSHNIETLGQMS
MNMG_RHOFT       --------------MLYPQHFDVIVVGGGHAGTEAALAAARMGCKTLLLSHNIETLGQMS
MNMG_LEPCP       --------------MLYPQEFDVIVVGGGHAGTEAALAAARMGCDTLLLTHNIETLGQMS
MNMG_METPP       --------------MLYPQEFDVIVVGGGHAGTEAALAAARMGCATLLLTHNIETLGQMS
MNMG_BURCA       --------------MLFPTEFDVIVVGGGHAGTEAALASARMGAKTLLLTHNIETLGQMS
MNMG_BURCH       --------------MLFPTEFDVIVVGGGHAGTEAALASARMGAKTLLLTHNIETLGQMS
MNMG_BURCC       --------------MLFPTEFDVIVVGGGHAGTEAALASARMGAKTLLLTHNIETLGQMS
MNMG_BURCM       --------------MLFPTEFDVIVVGGGHAGTEAALASARMGAKTLLLTHNIETLGQMS
MNMG_BURA4       --------------MLFPTEFDVIVVGGGHAGTEAALASARMGAKTLLLTHNIETLGQMS
MNMG_BURL3       --------------MLFPTEFDVIVVGGGHAGTEAALASARMGAKTLLLTHNIETLGQMS
MNMG_BURVG       --------------MLFPTEFDVIVVGGGHAGTEAALASARMGAKTLLLTHNIETLGQMS
MNMG_BURMA       --------------MLYPTEFDVIVVGGGHAGTEAALASARMGAKTLLLTHNIETLGQMS
MNMG_BURM9       --------------MLYPTEFDVIVVGGGHAGTEAALASARMGAKTLLLTHNIETLGQMS
MNMG_BURP0       --------------MLYPTEFDVIVVGGGHAGTEAALASARMGAKTLLLTHNIETLGQMS
MNMG_BURM7       --------------MLYPTEFDVIVVGGGHAGTEAALASARMGAKTLLLTHNIETLGQMS
MNMG_BURMS       --------------MLYPTEFDVIVVGGGHAGTEAALASARMGAKTLLLTHNIETLGQMS
MNMG_BURP1       --------------MLYPTEFDVIVVGGGHAGTEAALASARMGAKTLLLTHNIETLGQMS
MNMG_BURPS       --------------MLYPTEFDVIVVGGGHAGTEAALASARMGAKTLLLTHNIETLGQMS
MNMG_BURP6       --------------MLYPTEFDVIVVGGGHAGTEAALASARMGAKTLLLTHNIETLGQMS
MNMG_BURTA       --------------MLYPIEFDVIVVGGGHAGTEAALASARMGAKTLLLTHNIETLGQMS
MNMG_PARXL       --------------MLFPTEFDVIVVGGGHAGTEAALASARMGNTTLLLTHNIETLGQMS
MNMG_CUPNH       --------------MLYPKEFDVIVVGGGHAGTEAALAAARMGCQTLLLTHNIETLGQMS
MNMG_CUPPJ       --------------MLYPKEFDVIVVGGGHAGTEAALAAARMGCQTLLLTHNIETLGQMS
MNMG_CUPMC       --------------MLYPKEFDVIVVGGGHAGTEAALAAARMGCQTLLLSHNIETLGQMS
MNMG_RALSO       --------------MLYPVEFDVIVVGGGHAGTEAALAAARMGCQTLLLTHNIETLGQMS
MNMG_JANMA       --------------MIFPTKFDVIVVGGGHAGTEAALASARMGQSTLLLSHNIETLGQMS
MNMG_HERAR       --------------MIFPTKFDVIVVGGGHAGTEAALASARMGQSTLLLTHNIETLGQMS
MNMG_BORBR       --------------MDFPREFDVIVVGGGHAGTEAALAAARAGAQTLLLTHNIETLGQMS
MNMG_BORPA       --------------MDFPREFDVIVVGGGHAGTEAALAAARAGAQTLLLTHNIETLGQMS
MNMG_BORPE       --------------MDFPREFDVIVVGGGHAGTEAALAAARAGAQTLLLTHNIETLGQMS
MNMG_BORPD       --------------MDYPREFDVIVVGGGHAGTEAALAAARIGAKTLLLTHNIETLGQMS
MNMG_BORA1       --------------MNYPHEFDVIVVGGGHAGTEAALAAARSGAKTLLLTHNIETLGQMS
MNMG_AZOSB       --------------MLYPTRFDVIVVGGGHAGTEAALAAARMGCRTLLLSHNIETLGQMS
MNMG_AROAE       --------------MLYPSRFDVIVVGGGHAGTEAALAAARIGAKTLLLTHNIETLGQMS
MNMG_DECAR       --------------MLYPTRFDVIVVGGGHAGTEAALAAARAGANTLLLTHNLDTLGAMS
MNMG_METFK       --------------MRFSEKFDVIIVGGGHAGTEAALASARMGQKTLLLTHNIETLGQMS
MNMG_THIDA       --------------MKFPESFDVIVVGGGHAGTEAALAAARMGAKTLLLTHNIETLGAMS
MNMG_NITMU       --------------MTVPEIFDVIVIGGGHAGTEAALAAARIGQKTLLLSHNIETLGQMS
MNMG_NEIG1       --------------MIYPKTYDVIVVGGGHAGTEAALAAARMGAQTLLLTHNIETLGQMS
MNMG_NEIMA       --------------MIYPKTYDVIVVGGGHAGTEAALAAARMGAQTLLLTHNIETLGQMS
MNMG_NEIMB       --------------MIYPKTYDVIVVGGGHAGTEAALAAARMGAQTLLLSHNIETLGQMS
MNMG_NEIM0       --------------MIYPKTYDVIVVGGGHAGTEAALAAARMGAQTLLLTHNIETLGQMS
MNMG_NEIMF       --------------MIYPKTYDVIVVGGGHAGTEAALAAARMGAQTLLLTHNIETLGQMS
MNMG_CHRVO       --------------MIYPTSFDVIVVGGGHAGTEAALAAARMGCATLLLTHNIETLGQMS
MNMG_POLAQ       --------------MRYSKNFDVIVVGGGHAGTEAALASARMGCDTLLITHSIENLGAMS
MNMG_ACIBT       --------------MHYPKVYDVIVIGGGHAGTEAALAAARMGRQTLLLTHNIETLGQMS
MNMG_ACIBY       --------------MHYPKVYDVIVIGGGHAGTEAALAAARMGRQTLLLTHNIETLGQMS
MNMG_ACIAD       --------------MHYPKVYDVIVIGGGHAGTEAALAAARMGRQTLLLTHNIETLGQMS
MNMG_PSYA2       --------------MQYPKNYDVVVIGGGHAGTEAALAAARMGAQTLLLTHNIETLGQMS
MNMG_PSYCK       --------------MQYPKNYDVVVIGGGHAGTEAALAAARMGAQTLLLTHNIETLGQMS
MNMG_PSYWF       ---MSSTSTSNTAGITYPKAYDVVVIGGGHAGTEAALAAARMGAQTLLLTHNIETLGQMS
MNMG_PSEAE       --------------MDFPTRFDVIVIGGGHAGTEAALAAARMGVKTLLLTHNVETLGQMS
MNMG_PSEAB       --------------MDFPTRFDVIVIGGGHAGTEAALAAARMGVKTLLLTHNVETLGQMS
MNMG_PSEA7       -------------MVDFPTRFDVIVIGGGHAGTEAALAAARMGVKTLLLTHNVETLGQMS
MNMG_PSEPU       --------------MDFPSRFDVIVIGGGHAGTEAALASARMGVKTLLLTHNVETLGHMS
MNMG_PSEPK       -------------MVDFPSRFDVIVIGGGHAGTEAALASARMGVKTLLLTHNVETLGHMS
MNMG_PSEP1       --------------MDFPSRFDVIVIGGGHAGTEAALASARMGVKTLLLTHNVETLGHMS
MNMG_PSEPG       --------------MDFPSRFEVIVIGGGHAGTEAALASARMGVKTLLLTHNVETLGHMS
MNMG_PSEPW       --------------MDFPSRFEVIVIGGGHAGTEAALASARMGVKTLLLTHNVETLGHMS
MNMG_PSEE4       --------------MDFPSRFEVIVIGGGHAGTEAALASARMGVKTLLLTHNVETLGHMS
MNMG_PSEF5       --------------MDFPSRFEVIVIGGGHAGTEAALASARMGAKTLLLTHNVETLGAMS
MNMG_PSEPF       --------------MDFPSRFEVIVIGGGHAGTEAALASARMGAKTLLLTHNVETLGAMS
MNMG_PSE14       --------------MDFPSRFEVIVIGGGHAGTEAALASARMGVKTLLLTHNVETLGQMS
MNMG_PSEU2       -------------MVDFPSRFEVIVIGGGHAGTEAALASARMGVKTLLLTHNVETLGQMS
MNMG_PSESM       --------------MDFPSRFEVIVIGGGHAGTEAALASARMGVKTLLLTHNVETLGQMS
MNMG_PSEMY       --------------MDFPSRFDVIVIGGGHAGTEAALAAARMGVKTLLLTHNVETLGQMS
MNMG_PSEU5       --------------MDFPSRFDVIVIGGGHAGTEAALAAARMGVKTLLLTHNVETLGQMS
MNMG_ALCBS       --------------MDFSQRFGVIVIGGGHAGTEAALASARMGVSTLLLTHNIETLGQMS
MNMG_HAHCH       --------------MDFPKSFDVIVIGGGHAGTEAALAAARMGSQTLLLTHNIETLGQMS
MNMG_MARMS       --------------MDFPSRFDVIVVGGGHAGTEAALAAARMGVKTLLLSHNIETLGQMS
MNMG_SACD2       --------------MIYPTQYDVIVIGGGHAGTEACLAAARMGCKTLLLTHNIETLGQMS
MNMG_CHRSD       --------------MDYPDRFDVIVIGGGHAGTEAALAAARMGCQTLLLTHNIETLGQMS
MNMG_MARHV       --------------MEFPTRFDVIVIGGGHAGTEAALAAARMGSQTLLLTHNIETLGQMS
MNMG_ALKEH       --------------MDHPERFDVIVVGGGHAGTEAAMAAARIGARTLLLTHSIETVGQMS
MNMG_NITOC       --------------MSVFYQYEVIVVGGGHAGTEAALAAARQGVRTLLLTHNIETLGQMS
MNMG_METCA       --------------MFFDDEFDVIVVGGGHAGTEAALAAARTGARTLLLTQNVETLGQMS
MNMG_XANAC       -------------MSDSFYRYDVIVIGGGHAGTEAALASARAGARTLLLTHNIETVGAMS
MNMG_XANC5       -------------MSDSFYRYDVIVIGGGHAGTEAALASARTGARTLLLTHNIETVGAMS
MNMG_XANOR       -------------MSDSFYRYDVIVIGGGHAGTEAALASARAGAHTLLLTHTIETVGAMS
MNMG_XANOM       -------------MSDSFYRYDVIVIGGGHAGTEAALASARAGAHTLLLTHTIETVGAMS
MNMG_XANCP       -------------MSDSFYRYDVIVIGGGHAGTEAALAAARAGARTLLLTHNIETVGAMS
MNMG_XANC8       -------------MSDSFYRYDVIVIGGGHAGTEAALAAARAGARTLLLTHNIETVGAMS
MNMG_XANCB       -------------MSDSFYRYDVIVIGGGHAGTEAALAAARAGARTLLLTHNIETVGAMS
MNMG_XYLFA       -------------MTDSFYGYDVIVIGAGHAGSEAALAAARTGAHTLLLTHNIETIGAMS
MNMG_XYLFT       -------------MTDSFYRYDVIVIGAGHAGSEAALAAARTGAHTLLLTHNIETIGAMS
MNMG_COXBU       -------------MQSTSQQFDVIVVGGGHAGTEAALVAARMGARTLLLTHNIETLGQMS
MNMG_COXBN       -------------MQSTSQQFDVIVVGGGHAGTEAALVAARMGARTLLLTHNIETLGQMS
MNMG_COXBR       -------------MQSTSQQFDVIVVGGGHAGTEAALVAARMGARTLLLTHNIETLGQMS
MNMG_LEGPC       --------------MNLEQLYDVIVVGGGHAGTEAALAAARLGVKTLLLTHNIDLLGQMS
MNMG_LEGPA       --------------MNLEQLYDVIVVGGGHAGTEAALAAARLGVKTLLLTHNIDLLGQMS
MNMG_LEGPL       --------------MNLEQLYDVIVVGGGHAGTEAALAAARLGVKTLLLTHNIDLLGQMS
MNMG_LEGPH       --------------MNLEQLYDVIVVGGGHAGTEAALAAARLGVKTLLLTHNIDLLGQMS
MNMG_NITEU       --------------MHFSKDFDIIVVGGGHAGTEAALAAARMGQKTLLLTQNLDTLGQMS
MNMG_NITEC       --------------MHFSRDFDIIVVGGGHAGTEAALAAARMGQKTLLLTQNLDTLGQMS
MNMG_FRATF       --------------MIYDYGYDVIVVGGGHAGVEAASASARIGAKTLLLTHNIDTIGQMS
MNMG_FRATH       --------------MIYDYGYDVIVVGGGHAGVEAASASARIGAKTLLLTHNIDTIGQMS
MNMG_FRATO       --------------MIYDYGYDVIVVGGGHAGVEAASASARIGAKTLLLTHNIDTIGQMS
MNMG_FRATW       --------------MIYDYGYDVIVVGGGHAGVEAASASARIGAKTLLLTHNIDTIGQMS
MNMG_FRATT       --------------MIYDYGYDVIVVGGGHAGVEAASASARIGAKTLLLTHNIDTIGQMS
MNMG_FRAT1       --------------MIYDYGYDVIVVGGGHAGVEAASASARIGAKTLLLTHNIDTIGQMS
MNMG_FRATN       --------------MIYDYGYDVIVVGGGHAGVEAASASARIGAKTLLLTHNIDTIGQMS
MNMG_FRAP2       --------------MIYNNTYDVIVVGGGHAGVEAAAASARIGAKTLLLTHNIDTIGQMS
MNMG_VESOH       --------------MKQSKRYLVIVIGGGHAGTEAALASARMGVSTLLISHNIETLGQMS
MNMG_RUTMC       ------------MNMGQAKSYSVIVIGGGHAGTEAALSSARMGVCTLLISHNIETLGQMS
MNMG_DICNV       --------------MHYPDLFDVIVVGGGHAGVEAACAAARMGCDTLLLTQNIETIGQMS
MNMG_BLOFL       --------------MSDLSNFDVIIVGGGHAGTESALASSRMKCKTLLITHNVDTIGQMS
MNMG_BLOPB       --------------MFYPIHFDVIVVGGGHAGTEAALASARMQCNTLLITHNIDTLGQMS
MNMG_BAUCH       --------------MLKNYFFDVIIIGGGHAGTEAAVASAKIGCNTLLLTHNIKTIGEMS
MNMG_BUCAI       --------------MFNLRNFDVIVVGAGHAGTEAAMASSRMGCKTLLLTQKISDLGALS
MNMG_BUCAP       ------------MSKSYLKNFDVIVIGGGHAGTEAAAASARVGCKTLLLTQKITDIGVLS
MNMG_BUCBP       --------------MLREQNFDVIIVGGGHAGTEAALACSRMKKKTLLLTQNINTIGALS
MNMG_WIGBR       -------------MCSCYKEIDIIIVGGGHAGTEAAAVAAKMKCNTMLITQNIDTIGQMS
MNMG_BUCCC       --------------MFFYEKFDIIVIGAGHAGTEAASASSRMGQKTLLITQKRSTIGTLS
MNMG_HALHL       ---------------MNTNRFDVIVIGGGHAGTEAAAAAARLGRSTLLITHNLETIGALS
MNMG_RHIME       -----------------MTDYDVIVIGGGHAGCEAASASARLGARTVLITHKMDTIGVMS
MNMG_SINMW       -----------------MADYDVIVIGGGHAGCEAAAASARLGARTLLITHKKDTIGVMS
MNMG_RHIEC       ---------------MTNSGYNVIVIGGGHAGTEAASAAARLGAKTALVTHRRDTIGVMS
MNMG_RHIL3       ---------------MTDNVFDVIVIGGGHAGSEAASAAARLGAKTALITHRRDTIGVMS
MNMG_AGRFC       ----------------MHQSFDVVVIGGGHAGSEAAAAAARHGAKTALVTHKREAIGVMS
MNMG_BARHE       -----------------MQLYDVVVIGGGHAGCEAAYASARAGAQTALITHKISALGTMS
MNMG_BARQU       -----------------MQLYDVVIIGGGHAGCEAASASARSGACTALVTHKISALGTMS
MNMG_BART1       -----------------MQSYDVIIVGGGHAGCEAASASARVGAQTALLTHKISALGTMS
MNMG_BARBK       -----------------MQSYDVIIVGGGHAGCEAASASARTGARTALVTYRLSDMGTMS
MNMG_BRUAB       ------------MSSAEALAFDVIVIGGGHAGCEAASAAARAGARTALVTHRFDTIGVMS
MNMG_BRUA2       ------------MSSAEALAFDVIVIGGGHAGCEAASAAARAGARTALVTHRFDTIGVMS
MNMG_BRUC2       ------------MSSAEALAFDVIVIGGGHAGCEAASAAARAGARTALVTHRFDTIGVMS
MNMG_BRUSU       ------------MSSAEALAFDVIVIGGGHAGCEAASAAARAGARTALVTHRFDTIGVMS
MNMG_BRUSI       ------------MSSAEALAFDVIVIGGGHAGCEAASAAARAGARTALVTHRFDTIGVIS
MNMG_BRUME       ------------MSSAEALAFDVIVIGGGHAGCEAASAAARAGARTALVTHRFDTIGVMS
MNMG_BRUO2       ------------MNSAEALAFDVIVIGGGHAGCEAASAAARAGARTALVTHRFDTIGVMS
MNMG_BRUA4       ------------MSSTEATVFDVIVIGGGHAGCEAASAAARAGARTALVTHRFDTIGVMS
MNMG_RHILO       ----------------MTDHYDVVVVGGGHAGCEAASAAARAGAKTALVTLRFDTIGVMS
MNMG_CHESB       ----------------MIHKFDVVVVGGGHAGCEAAAAAARAGARTALVTMRRDTIGVMS
MNMG_BRASB       -------------MSDHLTSYDVIVIGGGHAGCEAAEASARMGARTALVTHHFATIGAMS
MNMG_BRASO       -------------MTEH-TSYDVIVIGGGHAGCEAAAASARMGARTALVTHRFATIGAMS
MNMG_BRADU       -------------MRPERESFDVIVIGGGHAGCEAAAASARMGAATALVTHRFSTVGAMS
MNMG_NITHX       ----------------MTASFDVIVIGGGHAGCEAATAAARMGARTALVTHRLSTVGAMS
MNMG_NITWN       ----------------MTASFDVIVIGGGHAGCEAAAASARTGARTALVTHRFATIGAMS
MNMG_RHOPS       ----------------MRNSYDVIVIGGGHAGCEAAAAAARLGATTALVTHRFATIGAMS
MNMG_RHOP2       ----------------MRNSYDVIVIGGGHAGCEAAAAAARLGAATALVTHRFATVGAMS
MNMG_RHOPA       ----------------MRTSFDVIVIGGGHAGCEAAAAAARIGAATALVTHRFATVGAMS
MNMG_RHOP5       ----------------MQTAFDVIVIGGGHAGCEAAAAAARLGARTALLTHRFSTVGAMS
MNMG_RHOPB       ----------------MQTSFDVIVIGGGHAGCEAAAAAARLGATTALVTHRFATVGAMS
MNMG_AZOC5       ----------------MSKAFDVMVVGGGHAGCEAAAAAARLGARTALVTHRADTIGAMS
MNMG_METPB       -------------MHAESTRYDVIVVGGGHAGVEAAAAAARVGARTALVTHRAETIGTMS
MNMG_METRJ       ------------MLTTSSARFDVAVVGGGHAGVEAAAAAARCGARTALVTHDPATIGAMS
MNMG_METS4       ------------MQRIDRTRFDVIVVGGGHAGVEAAAAAARLGAATALVTHRRATLGAMS
MNMG_BEII9       ----------------MKGTYDVVVVGGGHAGCEAAAASARLGARTALVTQAFATIGSMS
MNMG_PARL1       ----------------MTRDFDVIVIGGGHAGCEAASAAARAGARTALITHKLATIGEMS
MNMG_RHORT       ----------------MTNHWDVIVVGGGHAGTEAAAAAARLGAKTLLATHKLETVGTMS
MNMG_MAGSA       ----MRLTKYGVFHVKQTSSCDVVVIGAGHAGCEAAAAAARFGARTVLLTQRLETIGEMS
MNMG_CAUVC       ----------------MSKSWDVIVIGGGHAGCEAAAASARAGARTLLLTHKLETIGEMS
MNMG_CAUSK       ----------------MSNTWDVIVIGGGHAGCEAASASARAGARTLLLTHKRETVGEMS
MNMG_MARMM       -----------------MQTWDVIVIGGGHAGCDAAAASARLGARTLLLTHKLETIGEMS
MNMG_HYPNA       --------------MPDFPDFDVIVIGGGHAGCEAAAASARFGARTALITHKRSTIGEMS
MNMG_GLUOX       -----------------MSDFDVIVIGGGHAGCEAAAASARFGARTLLLTHRLETIGAMS
MNMG_GLUDA       ----------------MTTEYDVIVIGGGHAGCEAAAAAARCGARTLLLTHRRDTIGAMS
MNMG_GRABC       ---------MNTSDHPAPAAYDVIVVGGGHAGCEAAAAAARTGAITALVTHQAATIGEMS
MNMG_ACICJ       -------------MTSLREMFDVVVIGGGHAGTEAAAAAARMGARTALLTHRRDRIGEMS
MNMG_RUEPO       ---------------MKHSDFDIVVIGAGHAGAEAAHAAARMGMRTALVSLSERDIGVMS
MNMG_RUEST       ------------MFHVKHSHYDVVVVGGGHAGTEAAHASARMGVRTALVTLRRDGIGVMS
MNMG_ROSDO       ------------MFHVKH--FDVLVIGGGHAGTEAAHAAARMGSQTGLITMSRSGIGVMS
MNMG_DINSH       ---------------MKQQAFDVIVIGGGHAGTEAAAAAARLGVQVALITLERSGIGVMS
MNMG_RHOS1       ---------------MKH--FDVVVIGGGHAGCEAAATAARMGVQVALITLRKSGLGVMS
MNMG_CERS4       ----------MRVFHVKH--FDVVVIGGGHAGCEAAAAAARMGVQVALFTLRKSGLGVMS
MNMG_CERS5       ------------MFHVKQ--FDVIVIGGGHAGCEAAAAAARMGVRAALVTLRPSDLGVMS
MNMG_PARDP       ---------------MKQ--FDVIVIGGGHAGVEAAMAAARMGVKTALVTLHRDDIGTMS
MNMG_JANSC       ------------MFHVKHRHFDVIVVGGGHAGVEAADAACRAGARTALVTLRKDDLGVMS
MNMG_NOVAD       -----------------MQQFDIIVVGGGHAGVEAAAVAARMGARTALVSFDPQTIGAMS
MNMG_ERYLH       -------------MGRAMHDFDILVVGGGHAGVEAACAAARMGVRTALVSFDPARIGAMS
MNMG_SPHAL       --------------MHSSATFDVIVVGGGHAGTEAAAAAARLGARVALVSFDPTLIGTMS
MNMG_SPHWW       ----------------MADSFDVIVVGGGHAGCEAAAAAARTGARTALVSMRRDMIGAMS
MNMG_ZYMMO       ----------MIFIPVMKEFFDIVVIGGGHAGCEAAAVAARMGAKTALVTMDSEQIGAMS
MNMG_ANAMM       --------MFDIIWLVVVLSYDVVVVGGGHAGCEAAAAAARVGAKTLLITHKIGSIGEMS
MNMG_ANAPZ       -----------------MQNYDVVVVGGGHAGCEAAAAAARVGAKTLLVTHKVESIGEMS
MNMG_EHRCJ       -----------------MSHYDVVVIGGGHAGCEAAAAASRIGAKTLLITHSISTIGEMS
MNMG_EHRCR       -----------------MDHYDVVVIGGGHAGCEAAAAAARIGAKTLLITHSTSTIGEMS
MNMG_EHRRG       -----------------MKKYDVVVIGGGHSGCEAAAAAARIGAKTLLITHSISTIGEMS
MNMG_EHRRW       -----------------MKKYDVVVIGGGHSGCEAAAAAARIGAKTLLITHSISTIGEMS
MNMG_WOLPM       -----------------MHKYDVVVVGGGHAGCEAAAAAARLGANTLLITHKISTIGEMS
MNMG_WOLTR       -----------------MHRYDVVVVGGGHAGCEAAAAAARLGASTLLITHKISTIGEMS
MNMG_NEOSM       -------------------MQYVVVIGGGHAGVEAAAASARLGVETLLVTNNVMNIGEMS
MNMG_RICRO       -----------------MLKYDVIVIGGGHAGVEAAAASARLGVPTLLITLKPENLGEMS
MNMG_RICRS       -----------------MLKYDVIVIGGGHAGVEAAAASARLGVPTLLITLKPENLGEMS
MNMG_RICCN       -----------------MLKYDVIVIGGGHAGVEAAAASARLGVPTLLITLKPENLGEMS
MNMG_RICM5       -----------------MLKYDVIVIGGGHAGVEAAAASARLGVPTLLITLKPENLGEMS
MNMG_RICFE       -----------------MLKYDVIVIGGGHAGVEAAAASARLGASTLLITLKPENLGEMS
MNMG_RICAH       -----------------MLKYDVIVIGGGHAGVEAAAASARLGVSTLLITLKPDNLGEMS
MNMG_RICCK       -----------------MLKYDVIVIGGGHAGVEAAAASARLGVPTLLITLKPGNLGEMS
MNMG_RICB8       -----------------MQKYDVIVIGGGHAGVEAAAASARLGVSTLLITPKSENLGEMS
MNMG_RICBR       -----------------MQKYDVIVIGGGHAGVEAAAASARLGVSTLLITPKSENLGEMS
MNMG_RICPR       -----------------MLKYGVIIIGGGHAGVEAAAASARLGVHTLLITLKPENLGEMS
MNMG_RICTY       -----------------MLKYGVIIIGGGHAGVEAAAASARLGVHTLLITLKPENLGEMS
MNMG_ORITB       -----------------MNKFDVVVVGGGHAGCEAAAAAARIGVKVALITLKPENLGEMP
MNMG_PELUB       --------------MKNDLSFEVVVIGGGHAGCEAAAASARLGINTALFTHKIETIGEMS
MNMG_KORVE       --------------MGFTEQYDVVVVGAGHAGCEAAMAAARMGLRTALYTLNVDLIAQMS
MNMG_SOLUE       -------------MVAMPERYDVVVIGAGHAGCEAARACARIGLRTAMVTMNLDLIAQMS
MNMG_MAGMM       ---------------MFNQHFDVVVVGAGHAGCEAAHAAATLGCRTLLSTQVIDSIGQMS
MNMG_CAMJE       -------------------MFDVIVIGGGHAGVEASAAAARMGKKTLLLTTLIEQIGAAS
MNMG_CAMJJ       -------------------MFDVIVIGGGHAGVEASAAAARMGKKTLLLTTLIEQIGAAS
MNMG_CAMJR       -------------------MFDVIVIGGGHAGVEASAAAARMGKKTLLLTTLIEQIGAAS
MNMG_CAMJ8       -------------------MFDVIVIGGGHAGVEASAAAARMGKKTLLLTTLIEQIGAAS
MNMG_CAMJD       -------------------MFDVIVIGGGHAGVEASAAAARMGKKTLLLTTLIEQIGAAS
MNMG_CAMC1       ------------------MDYEIIVVGGGHAGIEASLAAARMGKQTLLITILAEQIGAAS
MNMG_CAMC5       -----------------MDKFNVIVVGGGHAGIEASLAAAKMGKKTLLITILAEQIGAAS
MNMG_CAMFF       ------------------MNYDVIVVGGGHAGIEASLAAAKMGAKTLLITILAEQIGAAS
MNMG_CAMHC       ------------------MQYDIIVIGGGHAGIEACLAAARMGAKTLLITILAEQIGAAS
MNMG_NITSB       ------------------MKFDVIVIGGGHAGIEAALASARMGMKTLMITILAEQIGAAS
MNMG_SULDN       ------------------MNYDVIIIGGGHAGVEASLASARMGNKTLLISMLAENVGATS
MNMG_ARCB4       ------------------MNYDVIVVGGGHAGIEASLASARMGKKTLLITMLVEQIGAAS
MNMG_SULNB       ------------------MNYDVIVIGGGHAGIEASLASARMGVKTLLITILAEQIGASS
MNMG_HELPY       ----------------MVKESDILVVGGGHAGIEASLIAAKMGARVHLITMLIDTIGLAS
MNMG_HELPH       ----------------MVKESDILVVGGGHAGIEASLIAAKMGARVHLITMLIDTIGLAS
MNMG_HELPJ       ----------------MVKESDILVVGGGHAGIEASLIAAKMGVRVHLITMLIDTIGLAS
MNMG_HELAH       ----------------MVKESDILVVGGGHAGIEASLIAAKMGAKTHLITMLIDTIGLAS
MNMG_HELHP       -----------------------MVIGGGHAGVEASIVSAKMGAKTHLITLLIQNIALAS
MNMG_WOLSU       -----------------MRDFDVIVVGGGHAGIEAAHASARMGCKTLLLTILVEQIGAAS
MNMG_LEPIN       -------MIESKNQSFFPNRFDCVVVGAGHAGSEAAYISSKGGARTLLITMNLDTIGQMS
MNMG_LEPIC       -------MIESKNQSFFPNRFDCVVVGAGHAGSEAAYISSKGGARTLLITMNLDTIGQMS
MNMG_LEPBJ       -------MIESKNQSFFPNRFDCVVVGAGHAGSEAAYIASKGGAKTLLITMNLDTIGQMS
MNMG_LEPBL       -------MIESKNQSFFPNRFDCVVVGAGHAGSEAAYIASKGGAKTLLITMNLDTIGQMS
MNMG_LEPBA       -----------MNPSFYPNQFDCIVVGAGHAGTEAAYISAKAGLKTLLITMNLDTIGQMS
MNMG_LEPBP       -----------MNPSFYPNQFDCIVVGAGHAGTEAAYISAKAGLKTLLITMNLDTIGQMS
MNMG_GEOMG       -----------MEFIDYDKQYDVIVVGAGHAGCEAALAAARMGCETLLLTINLDAIALMS
MNMG_GEOSL       -----------MNLIDYEKQYDVIVAGAGHAGCEAALAAARMGCETLLLTINLDAIALMS
MNMG_GEOUR       -------------MIAYDKSYDVVVVGGGHAGCEAALAAARMGCCTLLLSINLDAIALMS
MNMG_PELPD       -------------MMTYDFEYDVIVVGAGHAGCEAALAAARMGCRTLLLTINLDAIALMS
MNMG_PELCD       -------------MAEYGKDYEVIVVGAGHAGCEAALASARMGCNTLLLNLHLDAVAQMS
MNMG_DESPS       -----MTYEIHPLPIILMSDFDIVVIGAGHAGCEAALAAARLGHKTLLAVMNVDTIGAMS
MNMG_DESVH       --------MSTIRKPSPPDMYDCIVVGAGHAGCEAAMALARMGHATLLLTGNADRIGHLS
MNMG_DESVV       --------MSTIRKPSPPDMYDCIVVGAGHAGCEAAMALARMGHATLLLTGNADRIGHLS
MNMG_DESAG       ---------MSVKKASFPELFDLVVVGAGHAGCEAAMASARLGLKTLLLTINADRIGHLS
MNMG_LAWIP       ----------------MRTTFDCIVVGGGHAGCEASMALARLGQKVLLITGNVDRIGHLS
MNMG_SYNFM       -----------------MNKYEVIVVGAGHAGCEAALAAARMGCRTLVLSICLDTVAHMP
MNMG_SYNAS       -----------------MRQFDVIVVGAGHAGCEAALAASRMGCETLLFNINLDSIALMS
MNMG_CHLTE       -------------------MYDVIVVGAGHAGCEAALAVARGGLHCLLITSDLSAVARMS
MNMG_CHLCH       -------------------MYDVIVVGAGHAGCEAILAAARMGATCLLITSDLTAIARMS
MNMG_CHLPM       -------------------MYDIIVAGAGHAGCEAALAAARSGSSCLLISSDLTAVARMS
MNMG_CHLL3       -------------------MYDVIVAGAGHAGTEAALAVSRSGLSCLLVTTDLNAVARMS
MNMG_CHLPD       -------------------MYDIIVAGAGHAGCEAVLAAARTGMSCLLITSDLSAIARMS
MNMG_BACFR       ----------------MDFKYDVIVIGAGHAGCEAAAAAANLGSKTCLITMDMNKVAQMS
MNMG_BACFN       ----------------MDFKYDVIVIGAGHAGCEAAAAAANLGSKTCLITMDMNKVAQMS
MNMG_BACTN       ----------------MDFKYDVIVIGAGHAGCEAAAAAANLGSKTCLITMDMNKIGQMS
MNMG_PHOV8       ----------------MDFKYDVIVIGAGHAGCEAAAAAANMGSKTCLITMDMNKIGQMS
MNMG_PARD8       ----------------MTFNYDVIVVGAGHAGCEAAAAAANLGSKTLLITMDMNKIAQMS
MNMG_PORGI       ----------------MQFNYDVIVVGAGHAGCEAAAAAAKLGSQVLLITPDMNKIAQMS
MNMG_FLAJ1       ---------------MFLEEYDVIVVGAGHAGSEAAAAAANLGSKTLLVTMSLQNIAQMS
MNMG_FLAPJ       ---------------MFLEEYDVIVVGAGHAGCEAAAASANLGCSTLLVTMSLQNIAQMS
MNMG_GRAFK       ---------------MFEKQYDVIVVGAGHAGSEAAAAAANMGSKTLLITMNLQNIAQMS
MNMG_CYTH3       ----------------MFPEYDVIVVGAGHAGCEAAAAAANMGSKVLLATMNMQTIAQMS
MNMG_SULMW       ---------------MFVKQYDVIVVGGGHSGSEAALAASNLGSNTLLITTNLYNIGQMS
MNMG_SALRD       -------------MHQDYFEHDVIVVGGGHSGSEAAAAAANMGADTLLITMKLADIGQMS
MNMG_BORAP       ------------------MDFDAIVIGGGHAGIEAALAISRLNFKTLMITQNLDTIGKLS
MNMG_BORBP       ------------------MDFDAIVIGGGHAGIEAALALSRLDFKTLMITQNLDTIGKLS
MNMG_BORBU       ------------------MDFDAIVIGGGHAGIEAALALSRLNFKTLMITQNLDTIGKLS
MNMG_TREDE       --------------MYRFSDYDVIVVGAGHAGIEAALASARMGEAVLLITQTLDSAGRLS
MNMG_TREPA       -------------MGFRFSDYDVIVVGGGHAGAEAALAAARMGEHTLLITQTIDSIGRLS
MNMG1_FUSNN      ----------------MNKDYDVIVVGAGHAGVEAALASARLGNKTALITLYLDTISMMS
MNMG2_FUSNN      -----------------MQEFDIIVVGGGHAGCEAALASARMGMKTAIFTISLDTIGVMS
MNMG_ENDTX       ----------------MERKYNVAVVGAGHAGCEASLACARMGLKTLIITLNADSMARMP
MNMG_ONYPE       ------------------MIYDSIVIGAGHAGVEAALILAK-KHNTLLITGSLKQVASLP
MNMG_AYWBP       ------------------MIYDSIVIGAGHAGIESALILAK-KHNTLLITGSLKQVASLP
MNMG_ACHLI       ------------------MIYDGIIVGAGHAGVEAALAMAKMKLNTLLITGDLTKVATLP
MNMG_MYCCT       ----MKSNYDV------------IVVGGGHAGVEAALASARLNKKTALINLYEDKIATMP
MNMG_MYCMS       ----MKSNYDV------------IVVGGGHAGVEAALASARLNKKTALINLYEDKIATMP
MNMG_MESFL       ----MNKHFDV------------IVIGGGHAGVEAALASARLNKKTALINLYKDRIAAMP
MNMG_MYCGE       --------MSFII----------TVIGAGHAGLEAAFIVSKFNIKVNLLVLDINHLGSCP
MNMG_MYCPN       --------MSFTL----------TVIGGGHAGLEAAFIASKLGLKVNLLVLDPNHVGSCP
MNMG_MYCGA       -------------------MNKFIVVGAGHAGLEAAFILSKLNNKVYLCVLDRKYVANCP
MNMG_UREPA       -----MKKYDV------------IVIGAGHAGLEAAFATSNLNLQTALITLDEKGIGMMP
MNMG_UREP2       -----MKKYDV------------IVIGAGHAGLEAAFATSNLNLQTALITLDEKGIGMMP
MNMG_MYCPE       -----MKKYDC------------LVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMP
MNMG_MYCH7       -----MSKKSKNSSI----EFDAIVVGGGHAGIEAVYALLKKKLKVVLITLDKKKLASMP
MNMG_MYCHJ       -----MSKKSKNSSI----EFDAIVVGGGHAGIEAVYALLKKKLKVVLITLDKKKLASMP
MNMG_MYCH2       -----MSKKSKNSSI----EFDAIVVGGGHAGIEAVYALLKKKLKVVLITLDKKKLASMP
MNMG_MYCPU       -----MIRKN----------FDVIVIGGGHAGVEATFALAKMNLKVALITIYKDKIGAMP
MNMG_MYCS5       -----MNNN-----------FDAIVIGAGHAGVEAAFALAKSNNKVALITFDLSKITMMP
MNMG_MYCMO       ----MAAKI-----------YDAIVIGGGHAGVEAAFILSKKNFNVALISLNQNRLASMP
MNMG_MYCAP       -----MNKK-----------YDAIVIGGGHAGLEAAFAISHKGRNTLLLTFNSKKLGMMP
MNMG_THEM4       -MFFERPKDDIE--------FDVIVVGTGHAGIEAALAPARLGLRTLILTTNLDNVGWAP
MNMG_FERNB       MNFFTRPDDDYR--------FEVIVVGGGHAGIEAAFASARMGFKTLLITGNPDNIGWAS
MNMG_THEMA       -MIGLRPEDDRV--------YDVIVVGAGHAGIEAALAAARMGFRVLVLTVNPDTVGWAP
MNMG_THESQ       ----MRPEDDRV--------YDVIVVGAGHAGIEAALAAARMGFRVLVLTVNPDTVGWAP
MNMG_THEP1       ----MRPEDDRV--------YDVIVVGAGHAGIEAALAAARMGFRVLVLAVNPDTVGWAP
MNMG_PETMO       -----MENKENS--------FDVIVVGAGHAGIEAALASAKMGMNTLILNINLDTLGWAP
MNMG_BDEBA       -----MANKKY----------DVIVVGAGHAGIEACLSSARLGLNTLMVTTNTDRIGYMS
MNMG_ALKMQ       -------------MKYNAGTFDVIVVGAGHAGCEAALAAARMGAKTLMLTMTLDSIAMMP
MNMG_ALKOO       ------------MITYNGGNYDVVVVGAGHAGCEAALATARMGYSTMMLTMSLDAIAMLP
MNMG_CLOD6       ------------MIKFEAGKYDVIVVGAGHAGCEAALATARMGYKTLIITMSLDSIALMP
MNMG_FINM2       -----------MDRLYYENPYDVVVVGAGHAGCEAALATARLGLKTAIMSISLDSVADLP
MNMG_CALS8       -------------MEFVAGEYDIVVVGAGHAGCEAALACARLGLKTIVFAINLDSIGNMP
MNMG_ACET2       -------------MEFLAGEYDVAVVGAGHAGCEAALAAARLGVKTVVFAINLDSIANMP
MNMG1_CALS4      -------------MRFVAGEYDVCVVGLGHAGSEAALASARLGLSTVGFATNLDAIALMA
MNMG2_CALS4      -------------MRYIAGEYDVCVVGLGHAGSEAALASARLGLATVGFATNLDAIALMA
MNMG_THEP3       -------------MNFIAGEYDVAVVGLGHAGSEAALACARLGLKTVGFAVNLDSIALMA
MNMG_THEPX       -------------MNFIAGEYDVAVVGLGHAGSEAALACARLGLKTVGFAVNLDSIALMA
MNMG_CLOB1       -------------MKYSAGDFDVVVIGAGHAGCEAALASARMGCKTLICTMNLDSIALMA
MNMG_CLOBH       -------------MKYSAGDFDVVVIGAGHAGCEAALASARMGCKTLICTMNLDSIALMA
MNMG_CLOBL       -------------MKYLAGDFDVVVIGAGHAGCEAALASARMGCKTLICTMNLDSIALMA
MNMG_CLOBK       -------------MKYLAGDFDVVVIGAGHAGCEAALASARMGCKTLICTMNLDSIALMA
MNMG_CLOBM       -------------MKYLAGDFDVVVIGAGHAGCEAALASARMGCKTLICTMNLDSIALMA
MNMG_CLONN       -------------MSYFAGEFDVAVIGAGHAGCEAALASARLGVSTVVFATDLASVAMMP
MNMG_CLOAB       ------------MIKYFSGDYDVIVIGGGHAGCEAALAASRMGCRTLMCTMNLDSIAMMP
MNMG_CLOTE       -------------MKYYAGDYDVVVVGAGHAGCEAALAAARIGCKVLICTISLDSVALMP
MNMG_CLOK5       -------------MEYFSERYDVIVIGAGHAGCEAGLAAARMGCRTLMCTMNLDSIGFMP
MNMG_CLOP1       -------------MRYNAGSYDIVVIGAGHAGCEAGLAAARMGCKTLVCTLTLDSVAMMP
MNMG_CLOPS       -------------MRYNAGSYDIVVIGAGHAGCEAGLAAARMGCKTLVCTLTLDSVAMMP
MNMG_CLOPE       -------------MRYNAGSYDIVVIGAGHAGCEAGLAAARMGCKTLVCTLTLDSVAMMP
MNMG_CLOB8       -----------MAVNYDGGQFDIVVVGAGHAGCEAALASARLGLNTLVCTINLDSIALMP
MNMG_LACP7       -------------MTNLYEAYDVVVVGAGHAGCEAALACARLGFNTIMLTVSMDNIALMP
MNMG_NATTJ       -------------MAYYGGNYDLIVVGAGHAGCEAALAGARIGAKTLLLTLNLDQIALMP
MNMG_BACVZ       -------------MGYEAGQYDVIVIGAGHAGVEAALASARQGAKTLVLTINLDMVAFMP
MNMG_BACSU       -------------MGYEAGQYDVIVIGAGHAGVEAALASARQGAKTLVLTINLDMVAFMP
MNMG_BACLD       -------------MGYEAGQYDVVVVGAGHAGVEAALASARQGAKTLVLTINLDMVAFMP
MNMG_BACP2       -------------MGYEAGNYDVIVVGAGHAGVEAALASARQGAKTLVLTINLDMVAFMP
MNMG_BACAH       -------------MGYNAGSYDVIVIGAGHAGCEAGLAAARMGSKTLMLTINLDMVAFMP
MNMG_BACHK       -------------MGYNAGSYDVIVIGAGHAGCEAGLAAARMGSKTLMLTINLDMVAFMP
MNMG_BACAN       -------------MGYNAGSYDVIVIGAGHAGCEAGLAAARMGSKTLMLTINLDMVAFMP
MNMG_BACCZ       -------------MGYNAGSYDVIVIGAGHAGCEAGLAAARMGSKTLMLTINLDMVAFMP
MNMG_BACC1       -------------MGYNAGSYDVIVIGAGHAGCEAGLAAARMGSKTLMLTINLDMVAFMP
MNMG_BACCR       -------------MGYNIGSYDVIVIGAGHAGCEAGLAAARMGSKTLMLTINLDMVAFMP
MNMG_BACMK       -------------MGYNAGSYDVIVIGAGHAGCEAGLAAARMGSKTLMLTINLDMVAFMP
MNMG_BACCN       -------------MGYNAGSYDVIVIGAGHAGCEAGLAAARMGSKTLMLTINLDMVAFMP
MNMG_GEOKA       -------------MDYHGGTYDVIVVGAGHAGCEAALASARIGAKTLVITLNLDMIAFMP
MNMG_GEOTN       -------------MEYHGGSYDVIVIGAGHAGCEAALASARIGAKTLVITLNLDMIAFMP
MNMG_LYSSC       -----------MPTKYEAGTFDVIVIGAGHAGSEAAHAAAKMGAKTLMLTINLDMIAFMP
MNMG_STAA2       ----------------MVQEYDVIVIGAGHAGVEAGLASARRGAKTLMLTINLDNIAFMP
MNMG_STAA9       ----------------MVQEYDVIVIGAGHAGVEAGLASARRGAKTLMLTINLDNIAFMP
MNMG_STAAR       ----------------MVQEYDVIVIGAGHAGVEAGLASARRGAKTLMLTINLDNIAFMP
MNMG_STAAS       ----------------MVQEYDVIVIGAGHAGVEAGLASARRGAKTLMLTINLDNIAFMP
MNMG_STAA1       ----------------MVQEYDVIVIGAGHAGVEAGLASARRGAKTLMLTINLDNIAFMP
MNMG_STAAM       ----------------MVQEYDVIVIGAGHAGVEAGLASARRGAKTLMLTINLDNIAFMP
MNMG_STAAW       ----------------MVQEYDVIVIGAGHAGVEAGLASARRGAKTLMLTINLDNIAFMP
MNMG_STAAN       ----------------MVQEYDVIVIGAGHAGVEAGLASARRGAKTLMLTINLDNIAFMP
MNMG_STAAB       ----------------MVQEYDVIVIGAGHAGVEAGLASARRGAKTLMLTINLDNIAFMP
MNMG_STAA8       ----------------MVQEYDVIVIGAGHAGVEAGLASARRGAKTLMLTINLDNIAFMP
MNMG_STAA3       ----------------MVQEYDVIVIGAGHAGVEAGLASARRGAKTLMLTINLDNIAFMP
MNMG_STAAC       ----------------MVQEYDVIVIGAGHAGVEAGLASARRGAKTLMLTINLDNIAFMP
MNMG_STAAE       ----------------MVQEYDVIVIGAGHAGVEAGLASARRGAKTLMLTINLDNIAFMP
MNMG_STAAT       ----------------MVQEYDVIVIGAGHAGVEAGLASARRGAKTLMLTINLDNIAFMP
MNMG_STAES       ----------------MVQEYDVVVIGAGHAGIEAGLASARRGAKTLMLTINLDNIAFMP
MNMG_STAEQ       ----------------MVQEYDVVVIGAGHAGIEAGLASARRGAKTLMLTINLDNIAFMP
MNMG_STAHJ       ----------------MVQEYDVIVIGAGHAGIEAGLASARRGAKTLMLTINLDNIAFMP
MNMG_STAS1       ----------------MAQEYDVIVIGAGHAGIEAGLASARRGAKTLMLTINLDNIAFMP
MNMG_LISMO       ------------MQTYDAGTFDVIVVGAGHAGVEAGLASGRMGAKTLMLTINLDMVAFMP
MNMG_LISMF       ------------MQTYNAGTFDVIVVGAGHAGVEAGLASGRMGAKTLMLTINLDMVAFMP
MNMG_LISIN       ------------MQTYDAGTFDVIVVGAGHAGVEAGLASGRMGAKTLMLTINLDMVAFMP
MNMG_LISW6       ------------MQTYDAGTFDVIVVGAGHAGVEAGLASGRMGAKTLMLTINLDMVAFMP
MNMG_OCEIH       -------------MTYNAGNYDVIVVGAGHAGVESAYAAARMGAKTLMLTLNLDMIAFMP
MNMG_BACSK       -------------MSYQGGTFDVIVIGAGHAGVEAGLAAARMGANTLMLTLNLDAVAFMP
MNMG_ALKHC       -------------MSYQGGEFDVIVVGAGHAGVEAGLAAARMGANTLMLTLNLDAVAFMP
MNMG_EXIS2       -------------MAYQAGEFDVIVIGAGHAGIEASLAAARMGSKTVMLTMNPDMVGFMY
MNMG_LEVBA       ---------MTEVKEYAGQDYDVIVVGAGHAGSEAALAAARMGNRTLLMTINLDMVAFMP
MNMG_LACPL       ---------MTEVKQYPGRDYDVIVVGAGHAGSEAALAAARMGNRTLLMTINLDMVAFMP
MNMG_PEDPA       ---------MSEVKQYEGREYDVIVVGAGHAGSEAALAAARMGNKTLLMTINLDMVAFMP
MNMG_LACS1       ---------MEFGKRYKAKDYDVIVVGAGHAGCEAALASARMGNETLLITINLEMVAFMP
MNMG_ENTFA       ------------MNQYQAESYDVIVVGAGHAGSEAALAAARMGVKTLLLTINLDMVAFMP
MNMG_LACSS       ------------MREYDAAHYDVIVVGAGHAGSEAALAAARMGRETLLLTINLDMVAFMP
MNMG_LACP3       ---------MPDVKKFEAGTYDVIVVGAGHAGCEAALAAARMGQKTLLLTISLEMLAFMP
MNMG_LACAC       -----------MIKTYDSNEYDVIVVGAGHAGCEAALASAHMGQKTLLVTIGLDMVAFMP
MNMG_LACH4       -----------MIKTYDSNEYDVIVVGAGHAGCEAALASAHMGQKTLLVTIGLDMVAFMP
MNMG_LACJO       ------------MKTYESNEYDVIVVGAGHAGVEAALASARMGEKTLLLTINLDMVAFMP
MNMG_LACGA       ------------MKTYESNEYDVIVVGAGHAGVEAALAAARMGEKTLLLTINLDMVAFMP
MNMG_LACDA       ------------MKTYVSNEYDVIVVGAGHAGCEAALASARMGEKTLLLTISLDMVAFMP
MNMG_LACDB       ------------MKTYVSNEYDVIVVGAGHAGCEAALASARMGEKTLLLTISLDMVAFMP
MNMG_LACLM       --------------MNFQENYDVIVIGGGHAGVEASLAAARMGSKTLLMTINLNMVAFMP
MNMG_LACLS       --------------MNFQENYDVIVIGGGHAGVEASLAAARMGSKTLLMTINLNMVAFMP
MNMG_LACLA       --------------MNFQENYDVVVIGGGHAGVEASLAAARMGSKTLLMTINLNMVAFMP
MNMG_STRA3       ------------MTHNFAENYDIIVVGAGHAGVEASLAASRMGCKTLLATINLEMLAFMP
MNMG_STRA5       ------------MTHNFAENYDIIVVGAGHAGVEASLAASRMGCKTLLATINLEMLAFMP
MNMG_STRA1       ------------MTHNFAENYDIIVVGAGHAGVEASLAASRMGCKTLLATINLEMLAFMP
MNMG_STRP1       ------------MTHEFTESYDVIVIGAGHAGVEASLATSRMGCKTLLATINLDMLAFMP
MNMG_STRPD       ------------MTHEFTESYDVIVIGAGHAGVEASLATSRMGCKTLLATINLDMLAFMP
MNMG_STRPB       ------------MTHEFTESYDVIVIGAGHAGVEASLATSRMGCKTLLATINLDMLAFMP
MNMG_STRPC       ------------MTHEFTESYDVIVIGAGHAGVEASLATSRMGCKTLLATINLDMLAFMP
MNMG_STRPG       ------------MTHEFTESYDVIVIGAGHAGVEASLATSRMGCKTLLATINLDMLAFMP
MNMG_STRP8       ------------MTHEFTESYDVIVIGAGHAGVEASLATSRMGCKTLLATINLDMLAFMP
MNMG_STRPF       ------------MTHEFTENYDVIVIGAGHAGVEASLATSRMGCKTLLATINLDMLAFMP
MNMG_STRPM       ------------MTHEFTESYDVIVIGAGHAGVEASLATSRMGCKTLLATINLDMLAFMP
MNMG_STRP3       ------------MTHEFTESYDVIVIGAGHAGVEASLATSRMGCKTLLATINLDMLAFMP
MNMG_STRP6       ------------MTHEFTESYDVIVIGAGHAGVEASLATSRMGCKTLLATINLDMLAFMP
MNMG_STRT2       ------------MSYEFDENFDVIVVGAGHAGVEASLAAARMGCKVLLATINLEMLAFMP
MNMG_STRT1       ------------MSYEFDENFDVIVVGAGHAGVEASLAAARMGCKVLLATINLEMLAFMP
MNMG_STRTD       ------------MSYEFDENFDVIVVGAGHAGVEASLAAARMGCKVLLATINLEMLAFMP
MNMG_STRMU       ------------MTHEFTENYDVIVIGAGHAGVEASLATSRMGCKTLLATINLEMLAFMP
MNMG_STRGC       ------------MSHNFTESYDIIVIGAGHAGVEASLAASRMGCKVLLATINIEMLAFMP
MNMG_STRSV       ------------MSHNFTESYDIIVIGAGHAGVEASLAASRMGCKVLLATINIEMLAFMP
MNMG_STRR6       ------------MIYHFTEEYDIIVIGAGHAGVEASLAASRMGCKVLLATINIEMLAFMP
MNMG_STRP2       ------------MIYHFTEEYDIIVIGAGHAGVEASLAASRMGCKVLLATINIEMLAFMP
MNMG_STRPN       ------------MTYHFTEEYDIIVIGAGHAGVEASLAASRMGCKVLLATINIEMLAFMP
MNMG_STRPI       ------------MIYHFTEEYDIIVIGAGHAGVEASLAASRMGCKVLLATINIEMLAFMP
MNMG_STRSY       ------------MTHTFAENYDVIVIGAGHAGVEAGLAASRMGCKTLLATINLDMVAFMP
MNMG_STRS2       ------------MTHTFAENYDVIVIGAGHAGVEAGLAASRMGCKTLLATINLDMVAFMP
MNMG_DESRM       -------------MRYHAGDYDVIIVGAGHAGCEAGLAAARMGCKTLVLTLNLDNIALMP
MNMG_PELTS       ------------MLEYRAGTYDVVVVGAGHAGCEAGLAAARMGCRTLVLTLNMDNVALMP
MNMG_CARHZ       -------------MEYHAGDYDVIVVGAGHAGVEAALASARMGLKTLLLTLSLDNVALMP
MNMG_MOOTA       --------------MYNAGNYDVIVIGAGHAGCEAALAAAKLGCRTLMLTISLESIAMMP
MNMG_HELMI       ------------MTEYVAGKYDVIVIGAGHAGCEAALASARLGAKTLILTISWDNVALMP
MNMG_SYNWW       -------------MIYKAGSYEVIVIGAGHAGCEAALASARMGCQTLLVTMSIDHIALMP
MNMG_DESAP       -------------MEYTAGKYDVIVVGGGHAGCEAALASARLGCRTLLLTLSIDFVALMP
MNMG_SYMTH       --------------MGLTKEYDVIVVGAGHAGIEAALAAARKGMRTACFTTTLENIGAMN
MNMG_DESHY       -------------MEYLAGNYDVIVVGAGHAGCEAALAAARMGGRTLLITLSLDNIAHMD
MNMG_ROSCS       ------------MDSIHPFIYDLIVVGAGHAGCEAAHAAARMGCRTLLLTIDLDKLAHMS
MNMG_ROSS1       ------------MHSTHPYIYDVIVVGAGHAGCEAAHAAARMGCRTLLLTIDLDKLAHMS
MNMG_CHLAA       ----------------MQTRYDVIVVGAGHAGCEAAHAAARLGCRTLLLTIDLDKLAHMS
MNMG_DEIRA       -----------------MKGWNVIVIGGGHAGLEAAWAAAKFS-RVALLVGNPATVGRMP
MNMG_DEIGD       -----------------MRGWNVMVIGGGHAGLEAAWAAAKFA-RVAVLVSNPATVGRMP
MNMG_THET2       -----------------MAGYDVVVVGGGHAGLEAAWAAAALGVRVALVTVNPDRIGMMP
MNMG_THET8       -----------------MAGYDVVVVGGGHAGLEAAWAAAALGVRVALVTVNPDRIGMMP
MNMG_MYXXD       ----------------MGLRYDVIVVGLGHAGSEAALACARMGLATLGLTLKRERSAVLS
                                         : * **:* ::                         

MNMG_NOSS1       CNPAVGGPAKSQLTHEVDALGGEIGKMADRTYLQKRILNSSRGPAVWALRAQTDKREYAA
MNMG_TRIV2       CNPAVGGPAKSQLTHEVDALGGEIGKMADRTYLQKRILNSSRGPAVWALRAQTDKREYAA
MNMG_TRIEI       CNPAVGGPAKSQLTHEVDALGGEIGKMADRTYLQKRILNSSRGPAVWALRAQTDKREYAT
MNMG_SYNY3       CNPAVGGPAKSQLTHEVDALGGEIGKMADRTYLQKRVLNISRGPAVWALRAQTDKREYAA
MNMG_SYNP2       CNPAVGGPAKSQLTHEVDALGGEIGKMADRTYLQKRVLNASRGPAVWALRAQTDKREYAA
MNMG_MICAN       CNPAVGGPAKSQLTHEVDALGGEIGKMADRTYLQKRVLNASRGPAVWALRAQTDKREYAA
MNMG_ACAM1       CNPAVGAPAKSQLTHEVDALGGEIGKMADRTYLQKRLLNHSRGPAVWALRAQTDKREYAA
MNMG_SYNP6       CNPAVGGPAKSQLAHEVDALGGEIGKMADRTYLQKRVLNASRGPAVWALRAQTDKREYAA
MNMG_SYNE7       CNPAVGGPAKSQLAHEVDALGGEIGKMADRTYLQKRVLNASRGPAVWALRAQTDKREYAA
MNMG_THEEB       CNPAVGGPAKSQLVHEVDALGGEIGRVSDRTYVQKRLLNASRGPAVWALRAQTDKREYSA
MNMG_SYNJB       CNPAVGGPAKSQLVHEIDALGGEMGKVTDRTYLQKRVLNRSRGPAVWALRAQTDKREYAR
MNMG_SYNJA       CNPAVGGPAKSQLVHEIDALGGEMGKVTDRTYLQKRVLNRSRGPAVWALRAQTDKREYAR
MNMG_PROM1       CNPAVGGPAKSQLVHEVDALGGIIGKLADLTALQKRVLNASRGPAVRALRAQTDKRSYAH
MNMG_PROMT       CNPAVGGPAKSQLVHEVDALGGIIGKLADLTALQKRVLNASRGPAVRALRAQTDKRSYAH
MNMG_PROMA       CNPAVGGPAKSQLVHEVDALGGVIGRLADSTALQKRILNASRGPAVWALRAQTDKRQYSI
MNMG_PROM3       CNPAVGGPAKSQLVHEVDALGGVIGRLADATALQKRVLNASRGPAVWALRAQTDKRLYSR
MNMG_PROMM       CNPAVGGPAKSQLVHEVDALGGVIGRLADATALQKRVLNASRGPAVWALRAQTDKRLYSR
MNMG_SYNSC       CNPAVGGPAKSQLVHEVDALGGVIGRLADATAIQKRILNASRGPAVWALRAQTDKRLYSR
MNMG_SYNPX       CNPAVGGPAKSQLVHEVDALGGVIGRLADGTAIQKRILNASRGPAVWALRAQTDKRLYSH
MNMG_SYNS9       CNPAVGGPAKSQLVHEVDALGGVIGRLADATAIQKRTLNASRGPAVWALRAQTDKRLYSR
MNMG_SYNPW       CNPAVGGPAKSQLVHEVDALGGVIGRLADATAIQKRILNASRGPAVWALRAQTDKRQYSR
MNMG_SYNS3       CNPAVGGPAKSQLVHEVDALGGVIGRLADATAIQKRVLNASRGPAVWALRAQTDKRHYSR
MNMG_SYNR3       CNPAVGGPAKSQLVHEVDALGGVIGRLADATALQKRVLNASRGPAVWALRAQTDKRQYAR
MNMG_PROMS       CNPAVGGPAKSQLVHEVDALGGIIGKLADETAIQKRILNASRGPAVWALRAQTDKREYSK
MNMG_PROM0       CNPAVGGPAKSQLVHEVDALGGIIGKLADETAIQKRILNASRGPAVWALRAQTDKREYSK
MNMG_PROM9       CNPAVGGPAKSQLVHEVDALGGIIGKLADKTAIQKRILNASKGPAVWALRAQTDKREYSK
MNMG_PROM2       CNPAVGGPAKSQLVHEVDALGGIIGKLADETAIQKRILNASRGPAVWALRAQTDKREYSK
MNMG_PROM5       CNPAVGGPAKSQLVHEVDALGGIIGKLADETAIQKRILNASRGPAVWALRAQTDKREYSK
MNMG_PROMP       CNPAVGGPAKSQLVHEIDALGGIIGQLADETAIQKRILNASRGPAVWALRAQTDKREYSK
MNMG_CHLTR       CNPAVGGIGKGHIVREIDALGGIMAEITDLSGIQFRILNQTKGPAVRAPRAQVDKQLYHI
MNMG_CHLTA       CNPAVGGIGKGHIVREIDALGGIMAEITDLSGIQFRILNQTKGPAVRAPRAQVDKQLYHI
MNMG_CHLT2       CNPAVGGIGKGHIVREIDALGGIMAEITDLSGIQFRILNQTKGPAVRAPRAQVDKQLYHI
MNMG_CHLTB       CNPAVGGIGKGHIVREIDALGGIMAEITDLSGIQFRILNQTKGPAVRAPRAQVDKQLYHI
MNMG_CHLMU       CNPAVGGIGKGHIVREIDALGGVMAEVTDLSGIQFRILNQTKGPAVRAPRAQVDKQLYHI
MNMG_CHLAB       CNPAVGGIGKGHIVREIDALGGIMAEVTDQSGIQFRILNQTKGPAVRAPRAQVDKQMYHI
MNMG_CHLCV       CNPAVGGIGKGHIVREIDALGGIMAEVTDQSGIQFRILNQTKGPAVRAPRAQVDKQMYHI
MNMG_CHLFF       CNPAVGGIGKGHIVREIDALGGIMAEITDRSGIQFRILNQTKGPAVRAPRAQVDKQMYHI
MNMG_CHLPN       CNPAVGGIGKGHIVREIDALGGIMAEVTDQSGIQFRILNQTKGPAVRAPRAQVDKQLYHI
MNMG_PARUW       CNPAVGGIAKGHIVREIDALGGEMGKVIDVTGIQYRMLNATKGPAVWAPRAQADKLAYQS
MNMG_RHOBA       CNPAIGGVAKGQIVREVDALGGLMGEAIDATGIQFRMLNRRKGPAMHSPRAQADKKAYQN
MNMG_OPITP       CNPAIGGQAKGQIVREIDALGGEMAINTDVTGIQFRLLNHTKGPAVQSPRAQCDKKAYQF
MNMG_AQUAE       CNPAIGGIAKGIVVREIDALGGEMGKAIDQTGIQFKMLNTRKGKAVQSPRAQADKKRYRE
MNMG_ECOLI       CNPAIGGIGKGHLVKEVDALGGLMAKAIDQAGIQFRILNASKGPAVRATRAQADRVLYRQ
MNMG_ECOL6       CNPAIGGIGKGHLVKEVDALGGLMAKAIDQAGIQFRILNASKGPAVRATRAQADRVLYRQ
MNMG_ECO24       CNPAIGGIGKGHLVKEVDALGGLMAKAIDQAGIQFRILNASKGPAVRATRAQADRVLYRQ
MNMG_ECODH       CNPAIGGIGKGHLVKEVDALGGLMAKAIDQAGIQFRILNASKGPAVRATRAQADRVLYRQ
MNMG_ECOL5       CNPAIGGIGKGHLVKEVDALGGLMAKAIDQAGIQFRILNASKGPAVRATRAQADRVLYRQ
MNMG_ECOHS       CNPAIGGIGKGHLVKEVDALGGLMAKAIDQAGIQFRILNASKGPAVRATRAQADRVLYRQ
MNMG_ECOLC       CNPAIGGIGKGHLVKEVDALGGLMAKAIDQAGIQFRILNASKGPAVRATRAQADRVLYRQ
MNMG_SHIBS       CNPAIGGIGKGHLVKEVDALGGLMAKAIDQAGIQFRILNASKGPAVRATRAQADRVLYRQ
MNMG_SHISS       CNPAIGGIGKGHLVKEVDALGGLMAKAIDQAGIQFRILNASKGPAVRATRAQADRVLYRQ
MNMG_ECOUT       CNPAIGGIGKGHLVKEVDALGGLMAKAIDQAGIQFRILNASKGPAVRATRAQADRVLYRQ
MNMG_ECOK1       CNPAIGGIGKGHLVKEVDALGGLMAKAIDQAGIQFRILNASKGPAVRATRAQADRVLYRQ
MNMG_ECOSM       CNPAIGGIGKGHLVKEVDALGGLMAKAIDLAGIQFRILNASKGPAVRATRAQADRVLYRQ
MNMG_ECO57       CNPAIGGIGKGHLVKEVDALGGLMAKAIDQAGIQFRILNASKGPAVRATRAQADRVLYRQ
MNMG_SHIDS       CNPAIGGIGKGHLVKEVDALGGLMAKAIDQAGIQFRILNASKGPAVRATRAQADRVLYRQ
MNMG_SHIFL       CNPAIGGIGKGHLVKEVDALGGLMAKAIDQAGIQFRILNASKGPAVRATRAQADRVRYRQ
MNMG_SHIF8       CNPAIGGIGKGHLVKEVDALGGLMAKAIDQAGIQFRILNASKGPAVRATRAQADRVRYRQ
MNMG_SALCH       CNPAIGGIGKGHLVKEVDALGGLMAKAIDQAGIQFRILNASKGPAVRATRAQADRVLYRQ
MNMG_SALTY       CNPAIGGIGKGHLVKEVDALGGLMAKAIDQAGIQFRILNASKGPAVRATRAQADRVLYRQ
MNMG_SALPB       CNPAIGGIGKGHLVKEVDALGGLMAKAIDQAGIQFRILNASKGPAVRATRAQADRVLYRQ
MNMG_SALPA       CNPAIGGIGKGHLVKEVDALGGLMAKAIDQAGIQFRILNASKGPAVRATRAQADRVLYRQ
MNMG_SALTI       CNPTIGGIGKGHLVKEVDALGGLMAKAIDQAGIQFKILNASKGPAVRATRAQADRVLYRQ
MNMG_CITK8       CNPAIGGIGKGHLVKEVDALGGLMAKAIDQAGIQFRILNASKGPAVRATRAQADRVLYRQ
MNMG_SALAR       CNPAIGGIGKGHLVKEVDALGGLMAAAIDRAGIQFRILNASKGPAVRATRAQADRVLYRQ
MNMG_ENT38       CNPAIGGIGKGHLVKEVDALGGLMAKAIDHAGIQFRILNASKGPAVRATRAQADRVLYRQ
MNMG_KLEP7       CNPAIGGIGKGHLVKEVDALGGLMAKAIDQAGIQFRILNASKGPAVRATRAQADRVLYRQ
MNMG_CROS8       CNPAIGGIGKGHLVKEVDALGGLMAKAIDQAGIQFRILNASKGPAVRATRAQADRVLYKQ
MNMG_PECAS       CNPAIGGIGKGHLVKEIDAMGGLMARAVDQAGIQFRILNSSKGPAVRATRAQADRVLYRQ
MNMG_YERPE       CNPAIGGIGKGHLVKEIDALGGLMAKATDLAGIQFRILNASKGPAVRATRAQADRVLYRL
MNMG_YERPY       CNPAIGGIGKGHLVKEIDALGGLMAKATDLAGIQFRILNASKGPAVRATRAQADRVLYRL
MNMG_YERPA       CNPAIGGIGKGHLVKEIDALGGLMAKATDLAGIQFRILNASKGPAVRATRAQADRVLYRL
MNMG_YERPN       CNPAIGGIGKGHLVKEIDALGGLMAKATDLAGIQFRILNASKGPAVRATRAQADRVLYRL
MNMG_YERPP       CNPAIGGIGKGHLVKEIDALGGLMAKATDLAGIQFRILNASKGPAVRATRAQADRVLYRL
MNMG_YERPS       CNPAIGGIGKGHLVKEIDALGGLMAKATDLAGIQFRILNASKGPAVRATRAQADRVLYRL
MNMG_YERP3       CNPAIGGIGKGHLVKEIDALGGLMAKATDLAGIQFRILNASKGPAVRATRAQADRVLYRL
MNMG_YERE8       CNPAIGGIGKGHLVKEIDALGGLMAMATDQAGIQFRILNASKGPAVRATRAQADRVLYRQ
MNMG_SERP5       CNPAIGGIGKGHLVKEIDALGGLMATAIDHAGIQFRILNASKGPAVRATRAQADRVLYRQ
MNMG_PHOLL       CNPAIGGIGKGHLVKEIDALGGLMAKATDQAGIQFRTLNASKGPAVRATRAQADRVLYRQ
MNMG_SODGM       CNPAIGGIGKGHLVKEIDAMGGLMAQAIDKGGIQFRILNASKGPAVRATRAQADRVLYRQ
MNMG_VIBCH       CNPAIGGIGKGHLVKEVDAMGGLMAQAIDHAGIQFRTLNASKGPAVRATRAQADRALYKA
MNMG_VIBC3       CNPAIGGIGKGHLVKEVDAMGGLMAQAIDHAGIQFRTLNASKGPAVRATRAQADRALYKA
MNMG_VIBCB       CNPAIGGIGKGHLVKEVDAMGGLMAEAIDHAGIQFRTLNASKGPAVRATRAQADRALYKA
MNMG_VIBPA       CNPAIGGIGKGHLVKEVDAMGGLMAEAIDHAGIQFRTLNASKGPAVRATRAQADRALYKA
MNMG_VIBVU       CNPAIGGIGKGHLVKEVDAMGGLMAQAIDHAGIQFRTLNASKGPAVRATRAQADRALYKA
MNMG_VIBVY       CNPAIGGIGKGHLVKEVDAMGGLMAQAIDHAGIQFRTLNASKGPAVRATRAQADRALYKA
MNMG_ALIF1       CNPAIGGIGKGHLVKEVDALGGLMAQAIDHSGIQFRTLNASKGPAVRATRAQADRALYKA
MNMG_PHOPR       CNPAIGGIGKGHLVKEVDALGGLMAKATDKGGIQFRTLNSSKGPAVRATRAQADRALYKA
MNMG_AERHH       CNPAIGGIGKGHLVKEVDALGGIMARAIDLGGIQFRTLNSSKGPAVRATRAQADRLLYKA
MNMG_AERS4       CNPAIGGIGKGHLVKEVDALGGIMARATDLAGIQFRTLNSSKGPAVRATRAQADRLLYKA
MNMG_COLP3       CNPAIGGIGKGHLVKEIDALGGLMATAIDHSAIQFRTLNSSKGPAVRATRAQADRILYRN
MNMG_PSEA6       CNPAIGGIGKGHLVKEIDALGGSMAKAIDKGGIQFRTLNSSKGPAVRATRAQADRSLYRS
MNMG_IDILO       CNPAIGGIGKGHLVKEIDALGGVMAKAADKAGIQFRTLNSSKGPAVRATRAQADRQLYKQ
MNMG_PSET1       CNPAIGGIGKGHLVKEIDALGGAMAQAIDKGGIQFRTLNSSKGPAVRATRAQADRALYKA
MNMG_SHEB5       CNPAIGGIGKGHLVKEIDALGGAMAIATDYAGIQFRTLNSSKGPAVRATRAQADRALYRQ
MNMG_SHEB8       CNPAIGGIGKGHLVKEIDALGGAMAIATDYAGIQFRTLNSSKGPAVRATRAQADRALYRQ
MNMG_SHEB9       CNPAIGGIGKGHLVKEIDALGGAMAIATDYAGIQFRTLNSSKGPAVRATRAQADRALYRQ
MNMG_SHEPC       CNPAIGGIGKGHLVKEIDALGGAMAIATDYAGIQFRTLNSSKGPAVRATRAQADRALYRQ
MNMG_SHESW       CNPAIGGIGKGHLVKEIDALGGAMAIATDYAGIQFRTLNSSKGPAVRATRAQADRALYRQ
MNMG_SHESM       CNPAIGGIGKGHLVKEIDALGGAMAIATDYAGIQFRTLNSSKGPAVRATRAQADRALYRQ
MNMG_SHESR       CNPAIGGIGKGHLVKEIDALGGAMAIATDYAGIQFRTLNSSKGPAVRATRAQADRALYRQ
MNMG_SHESA       CNPAIGGIGKGHLVKEIDALGGAMAIATDYAGIQFRTLNSSKGPAVRATRAQADRALYRQ
MNMG_SHEON       CNPAIGGIGKGHLVKEIDALGGAMAIATDYAGIQFRTLNSSKGPAVRATRAQADRALYRQ
MNMG_SHEDO       CNPAIGGIGKGHLVKEIDALGGAMAIATDFAGIQFRTLNSSKGPAVRATRAQADRALYRQ
MNMG_SHEFN       CNPAIGGIGKGHLVKEIDALGGAMATATDFAGIQFRTLNSSKGPAVRATRAQADRALYRQ
MNMG_SHEHH       CNPAIGGIGKGHLVKEIDALGGAMAVATDFAGIQFRTLNSSKGPAVRATRAQADRALYRH
MNMG_SHEPA       CNPAIGGIGKGHLVKEIDALGGAMAVATDFAGIQFRTLNSSKGPAVRATRAQADRALYRH
MNMG_SHESH       CNPAIGGIGKGHLVKEIDALGGAMAIATDYAGIQFRTLNSSKGPAVRATRAQADRALYRA
MNMG_SHEWM       CNPAIGGIGKGHLVKEIDALGGAMAIATDYAGIQFRTLNSSKGPAVRATRAQADRALYRA
MNMG_SHELP       CNPAIGGIGKGHLVKEIDALGGAMAVATDHAGIQFRTLNSSKGPAVRATRAQADRALYRA
MNMG_SHEAM       CNPAIGGIGKGHLVKEIDALGGAMAIATDFSGIQFRTLNSSKGPAVRATRAQADRALYKA
MNMG_PSYIN       CNPAIGGIGKGHLVREIDALGGLMANAADKAGIQFRILNGSKGPAVRATRAQADRLLYKA
MNMG_ACTP2       CNPAIGGIGKGHLVKEIDAMGGLMAIAIDQAGIQFRTLNSSKGPAVRATRAQADRVLYRQ
MNMG_ACTPJ       CNPAIGGIGKGHLVKEIDAMGGLMAIAIDQAGIQFRTLNSSKGPAVRATRAQADRVLYRQ
MNMG_HAEDU       CNPAIGGIGKGHLVKEIDAMGGLMAIATDHAGIQFRTLNSSKGPAVRATRAQADRVLYRQ
MNMG_HAEIN       CNPAIGGIGKGHLVKEVDAMGGLMAHAADKAGIQFRTLNSSKGPAVRATRAQSDRVLYRQ
MNMG_HAEIG       CNPAIGGIGKGHLVKEVDAMGGLMAHAADKAGIQFRTLNSSKGPAVRATRAQADRVLYRQ
MNMG_HAEIE       CNPAIGGIGKGHLVKEVDAMGGLMAHAADKAGIQFRTLNSSKGPAVRATRAQADRVLYRQ
MNMG_HAEI8       CNPAIGGIGKGHLVKEVDAMGGLMAHAADKAGIQFRTLNSSKGPAVRATRAQADRVLYRQ
MNMG_HAES1       CNPAIGGIGKGHLVKEIDAMGGLMATAADKAGIQFRTLNSSKGPAVRATRAQADRVLYRQ
MNMG_HISS2       CNPAIGGIGKGHLVKEIDAMGGLMATAADKAGIQFRTLNSSKGPAVRATRAQADRVLYRQ
MNMG_MANSM       CNPAIGGIGKGHLVKEIDAMGGLMATAADQAGIQFRTLNSSKGPAVRATRAQADRVLYRQ
MNMG_PASMU       CNPAIGGIGKGHLVREIDAMGGLMATAADQAGIQFRTLNSSKGPAVRATRAQADRVLYRQ
MNMG_ACTSZ       CNPAIGGIGKGHLVKEIDAMGGLMATAADRAGIQFRTLNASKGPAVRATRAQADRVLYRQ
MNMG_HYDCU       CNPAIGGIGKGHLVKEIDALGGAMAMAIDESGIQFRTLNASKGPAVRATRAQADRVLYRQ
MNMG_ACIAC       CNPSIGGIGKGHLVKEVDALGGAMALATDEGGIQFRILNSSKGPAVRATRAQADRILYKA
MNMG_ACISJ       CNPSIGGIGKGHLVKEVDALGGAMALATDEAGIQFRILNSSKGPAVRATRAQADRILYKA
MNMG_VEREI       CNPSIGGIGKGHLVKEVDALGGAMALATDESGIQFRILNRSKGPAVRATRAQADRLLYKA
MNMG_POLNA       CNPSIGGIGKGHLVKEVDAMGGAMALATDEGGIQFRILNGSKGPAVRATRAQADRILYKA
MNMG_POLSJ       CNPSIGGIGKGHLVKEVDAMGGAMALATDEGGIQFRILNSSKGPAVRATRAQADRILYKA
MNMG_RHOFT       CNPSIGGIGKGHLVKEVDALGGAMAAATDEGGIQFRILNSSKGPAVRATRAQADRLLYKA
MNMG_LEPCP       CNPSIGGIGKGHLVKEVDALGGAMAAATDESGIQFRILNSSKGPAVRATRAQADRILYKA
MNMG_METPP       CNPSIGGIGKGHLVKEIDALGGAMALATDEAGIQFRILNGSKGPAVRATRAQADRVLYKA
MNMG_BURCA       CNPSIGGIGKGHLVKEVDALGGAMAAATDESGIQFRILNSSKGPAVRATRAQADRILYKA
MNMG_BURCH       CNPSIGGIGKGHLVKEVDALGGAMAAATDESGIQFRILNSSKGPAVRATRAQADRILYKA
MNMG_BURCC       CNPSIGGIGKGHLVKEVDALGGAMAAATDESGIQFRILNSSKGPAVRATRAQADRILYKA
MNMG_BURCM       CNPSIGGIGKGHLVKEVDALGGAMAAATDESGIQFRILNSSKGPAVRATRAQADRILYKA
MNMG_BURA4       CNPSIGGIGKGHLVKEVDALGGAMAAATDESGIQFRILNSSKGPAVRATRAQADRILYKA
MNMG_BURL3       CNPSIGGIGKGHLVKEVDALGGAMAAATDESGIQFRILNSSKGPAVRATRAQADRILYKA
MNMG_BURVG       CNPSIGGIGKGHLVKEVDALGGAMAAATDESGIQFRILNSSKGPAVRATRAQADRILYKA
MNMG_BURMA       CNPSIGGIGKGHLVKEVDALGGAMAAATDEGGIQFRILNSSKGPAVRATRAQADRVLYKQ
MNMG_BURM9       CNPSIGGIGKGHLVKEVDALGGAMAAATDEGGIQFRILNSSKGPAVRATRAQADRVLYKQ
MNMG_BURP0       CNPSIGGIGKGHLVKEVDALGGAMAAATDEGGIQFRILNSSKGPAVRATRAQADRVLYKQ
MNMG_BURM7       CNPSIGGIGKGHLVKEVDALGGAMAAATDEGGIQFRILNSSKGPAVRATRAQADRVLYKQ
MNMG_BURMS       CNPSIGGIGKGHLVKEVDALGGAMAAATDEGGIQFRILNSSKGPAVRATRAQADRVLYKQ
MNMG_BURP1       CNPSIGGIGKGHLVKEVDALGGAMAAATDEGGIQFRILNSSKGPAVRATRAQADRVLYKQ
MNMG_BURPS       CNPSIGGIGKGHLVKEVDALGGAMAAATDEGGIQFRILNSSKGPAVRATRAQADRVLYKQ
MNMG_BURP6       CNPSIGGIGKGHLVKEVDALGGAMAAATDEGGIQFRILNSSKGPAVRATRAQADRVLYKQ
MNMG_BURTA       CNPSIGGIGKGHLVKEVDALGGAMAAATDEGGIQFRILNSSKGPAVRATRAQADRVLYKQ
MNMG_PARXL       CNPSIGGIGKGHLVKEVDALGGAMAAATDEGGIQFRILNSSKGPAVRATRAQADRLLYKQ
MNMG_CUPNH       CNPSIGGIGKGHLVKEVDAMGGAMAAATDESGIQFRILNSSKGPAVRATRAQADRVLYRK
MNMG_CUPPJ       CNPSIGGIGKGHLVKEVDAMGGAMAAATDEAGIQFRILNSSKGPAVRATRAQADRVLYRK
MNMG_CUPMC       CNPSIGGIGKGHLVKEVDAMGGAMAAATDEAGIQFRILNSSKGPAVRATRAQADRVLYRK
MNMG_RALSO       CNPSIGGIGKGHLVKEVDALGGAMALATDEGGIQFRILNSSKGPAVRATRAQADRVLYKA
MNMG_JANMA       CNPSIGGIGKGHLVKEVDAMGGAMAIATDEAGIQFRILNSSKGPAVRATRAQADRILYKQ
MNMG_HERAR       CNPSIGGIGKGHLVREVDAMGGAMAIATDEAGIQFRILNSSKGPAVRATRAQADRILYKQ
MNMG_BORBR       CNPSIGGIGKGHLVKEVDALGGAMAIATDEAGIQFRILNSSKGPAVRATRAQADRVLYRN
MNMG_BORPA       CNPSIGGIGKGHLVKEVDALGGAMAIATDEAGIQFRILNSSKGPAVRATRVQADRVLYRN
MNMG_BORPE       CNPSIGGIGKGHLVKEVDALGGAMAIATDEAGIQFRILNSSKGPAVRATRAQADRVLYRN
MNMG_BORPD       CNPSIGGIGKGHLVKEVDALGGAMALATDEAGIQFRILNGSKGPAVRATRAQADRVLYRK
MNMG_BORA1       CNPSIGGIGKGHLVKEVDALGGAMAIATDEAGIQFRILNSSKGPAVRATRAQADRVLYRK
MNMG_AZOSB       CNPSIGGIGKGHLVKEVDALGGAMAAATDEGGIQFRILNASKGPAVRATRAQADRVLYKA
MNMG_AROAE       CNPSIGGIGKGHLVKEVDALGGAMAAATDEGGIQFRILNASKGPAVRATRAQADRVLYKA
MNMG_DECAR       CNPSIGGIGKGHLVREVDALGGAMAAATDEAGIQFRILNASKGPAVRATRAQADRVLYKQ
MNMG_METFK       CNPSIGGIGKGHLVKEVDALGGAMAAATDEGGIQFRILNSSKGPAVRATRAQADRVLYKA
MNMG_THIDA       CNPSIGGIGKGHLVREVDALGGAMALATDEAGIQFRTLNSSKGPAVRATRAQADRVLYKA
MNMG_NITMU       CNPSIGGIGKGHLVKEIDALGGVMAEAADEAGIQFRILNSRKGPAVRATRAQADRVLYRQ
MNMG_NEIG1       CNPSIGGIGKGHLVRELDALGGAMALATDKSGIQFRRLNASKGAAVRATRAQADRILYKA
MNMG_NEIMA       CNPSIGGIGKGHLVRELDALGGAMALATDKSGIQFRRLNASKGAAVRATRAQADRILYKA
MNMG_NEIMB       CNPSIGGIGKGHLVRELDALGGAMALATDKSGIQFRRLNASKGAAVRATRAQADRILYKA
MNMG_NEIM0       CNPSIGGIGKGHLVRELDALGGAMALATDKSGIQFRRLNASKGAAVRATRAQADRILYKA
MNMG_NEIMF       CNPSIGGIGKGHLVRELDALGGAMALATDKSGIQFRRLNASKGAAVRATRAQADRILYKA
MNMG_CHRVO       CNPSIGGIGKGHLVKEVDALGGAMALATDIGGIQFRTLNASKGPAVRATRAQADRILYKA
MNMG_POLAQ       CNPSIGGIGKGHLVKEIDAMGGAMAAATDEAGIQFRILNSSKGPAVRATRAQGDRVLYKA
MNMG_ACIBT       CNPAIGGIGKSHLVREIDALGGAMALAADKGGIQFRILNSRKGAAVRATRAQADRVRYKA
MNMG_ACIBY       CNPAIGGIGKSHLVREIDALGGAMALAADKGGIQFRILNSRKGAAVRATRAQADRVRYKA
MNMG_ACIAD       CNPAIGGIGKSHLVREIDALGGAMALAADKGGIQFRILNSRKGAAVRATRAQADRVRYKA
MNMG_PSYA2       CNPAIGGIGKSHLVREIDALGGAMALATDKSGIQFRVLNSRKGAAVRATRAQADRILYKA
MNMG_PSYCK       CNPAIGGIGKSHLVREIDALGGAMALATDKSGIQFRVLNSRKGAAVRATRAQADRILYKA
MNMG_PSYWF       CNPAIGGIGKSHLVREIDALGGAMALATDKAGIQFRVLNSRKGAAVRATRAQADRILYKA
MNMG_PSEAE       CNPAIGGIGKSHLVKEIDALGGAMAEATDKGGIQFRILNSRKGPAVRATRAQADRVLYKA
MNMG_PSEAB       CNPAIGGIGKSHLVKEIDALGGAMAEATDKGGIQFRILNSRKGPAVRATRAQADRVLYKA
MNMG_PSEA7       CNPAIGGIGKSHLVKEIDALGGAMAEATDKGGIQFRILNSRKGPAVRATRAQADRVLYKA
MNMG_PSEPU       CNPAIGGIGKSHLVKEIDALGGAMALATDKSGIQFRVLNNRKGPAVRATRAQADRAIYKA
MNMG_PSEPK       CNPAIGGIGKSHLVKEIDALGGAMALATDKSGIQFRVLNNRKGPAVRATRAQADRAIYKA
MNMG_PSEP1       CNPAIGGIGKSHLVKEIDALGGAMALATDKSGIQFRVLNNRKGPAVRATRAQADRAIYKA
MNMG_PSEPG       CNPAIGGIGKSHLVKEIDALGGAMALATDKSGIQFRVLNNRKGPAVRATRAQADRAIYKA
MNMG_PSEPW       CNPAIGGIGKSHLVKEIDALGGAMALATDKSGIQFRVLNNRKGPAVRATRAQADRAIYKA
MNMG_PSEE4       CNPAIGGIGKSHLVKEIDALGGAMALATDMSGIQFRVLNNRKGPAVRATRAQADRAIYKA
MNMG_PSEF5       CNPAIGGIGKSHLVKEIDALGGAMAMATDKGGIQFRVLNSRKGPAVRATRAQADRILYKA
MNMG_PSEPF       CNPAIGGIGKSHLVKEIDALGGAMAMATDLGGIQFRVLNSRKGPAVRATRAQADRILYKA
MNMG_PSE14       CNPAIGGIGKSHLVKEIDALGGAMAMATDKGGIQFRVLNSRKGPAVRATRAQADRVLYKA
MNMG_PSEU2       CNPAIGGIGKSHLVKEIDALGGAMAMATDKGGIQFRVLNSRKGPAVRATRAQADRVLYKA
MNMG_PSESM       CNPAIGGIGKSHLVKEIDALGGAMAMATDKGGIQFRVLNSRKGPAVRATRAQADRVLYKA
MNMG_PSEMY       CNPAIGGIGKSHLVKEIDALGGAMATATDKGGIQFRILNSRKGPAVRATRAQADRVLYKA
MNMG_PSEU5       CNPAIGGIGKSHLVKEIDALGGAMAVATDKGGIQFRVLNSRKGPAVRATRAQADRVLYKA
MNMG_ALCBS       CNPAIGGIGKSHLVREIDALGGAMGRATDKGGIQFRVLNARKGPAVRATRAQADRELYKA
MNMG_HAHCH       CNPAIGGIGKSHLVKEVDALGGAMALATDRAGIQFRVLNSRKGPAVRATRAQADRALYKA
MNMG_MARMS       CNPAIGGIGKSHLVKEIDALDGAMALATDQAGIQFRTLNSRKGPAVRATRAQADRILYKA
MNMG_SACD2       CNPAIGGIGKSHLVKEIDALGGAMALATDKGGIQFRILNSRKGPAVRATRAQADRALYKA
MNMG_CHRSD       CNPAIGGIGKSHLVKEIDALGGAMAHATDLGGIQFRVLNARKGPAVRATRAQADRVRYKA
MNMG_MARHV       CNPAIGGIGKSHLVKEIDALGGAMARATDQAGIQFRVLNSRKGPAVRATRAQADRILYKA
MNMG_ALKEH       CNPAIGGIGKGHLVREIDALGGIMARAADRGGIQFRTLNSRKGPAVRATRAQADRQLYRQ
MNMG_NITOC       CNPAIGGIGKGHLVKEIDALGGLMAQAADQAGIHFRMLNARKGPAVRATRAQADRALYKA
MNMG_METCA       CNPAIGGIGKGHLVKEIDAMGGLMARAADRAGIQFRILNASKGPAVRATRAQADRSLYRK
MNMG_XANAC       CNPAIGGIGKGHLVKEIDALGGAMARAADLAGIQWRTLNASKGPAVRATRCQADRNLYRT
MNMG_XANC5       CNPAIGGIGKGHLVKEIDGLGGAMARAADLAGIQWRTLNASKGPAVRATRCQADRNLYRT
MNMG_XANOR       CNPAIGGIGKGHLVKEIDALGGAMAHAADLAGIQWRTLNASKGPAVRATRCQADRNLYRT
MNMG_XANOM       CNPAIGGIGKGHLVKEIDALGGAMAHAADLAGIQWRTLNASKGPAVRATRCQADRNLYRT
MNMG_XANCP       CNPAIGGIGKGHLVKEIDALGGAMAKAADLAGIQWRTLNASKGPAVRATRCQADRNLYRS
MNMG_XANC8       CNPAIGGIGKGHLVKEIDALGGAMAKAADLAGIQWRTLNASKGPAVRATRCQADRNLYRS
MNMG_XANCB       CNPAIGGIGKGHLVKEIDALGGAMAKAADLAGIQWRTLNASKGPAVRATRCQADRNLYRS
MNMG_XYLFA       CNPAIGGIGKGHLVKEIDALGGAMAHAADAAGIQWRTLNASKGPAVRATRCQADRALYRA
MNMG_XYLFT       CNPAIGGIGKGHLVKEIDALGGAMAHAADAAGIQWRTLNASKGPAVRATRCQADRSLYRA
MNMG_COXBU       CNPAIGGIGKSHLVKEIDALGGIMALAADQAGIHFRTLNARKGPAVRATRAQADRVLYKA
MNMG_COXBN       CNPAIGGIGKSHLVKEIDALGGIMALAADQAGIHFRTLNARKGPAVRATRAQADRVLYKA
MNMG_COXBR       CNPAIGGIGKSHLVKEIDALGGIMALAADQAGIHFRTLNARKGPAVRATRAQADRVLYKA
MNMG_LEGPC       CNPAIGGIGKGHLVKEIDALDGAMAKAADQAGIQFRILNASKGPAVRATRAQADRVLYRK
MNMG_LEGPA       CNPAIGGIGKGHLVKEIDALDGAMAKAADQAGIQFRILNASKGPAVRATRAQADRVLYRK
MNMG_LEGPL       CNPAIGGIGKGHLVKEIDALDGAMAKAADQAGIQFRILNASKGPAVRATRAQADRVLYRK
MNMG_LEGPH       CNPAIGGIGKGHLVKEIDALDGAMAKAADQAGIQFRILNASKGPAVRATRAQADRVLYRK
MNMG_NITEU       CNPSIGGIGKGHLVKEIDALGGAMAAATDEAGIQFRILNSSKGPAVRATRAQADRVLYRQ
MNMG_NITEC       CNPSIGGIGKGHLVKEIDALGGAMAAAIDEAGIQFRTLNSSKGPAVRATRAQADRVLYRQ
MNMG_FRATF       CNPAIGGIGKGHLVKEIDAMGGVMAKAIDMAGIQFRILNSRKGPAVRATRAQADRVLYKK
MNMG_FRATH       CNPAIGGIGKGHLVKEIDAMGGVMAKAIDMAGIQFRILNSRKGPAVRATRAQADRVLYKK
MNMG_FRATO       CNPAIGGIGKGHLVKEIDAMGGVMAKAIDMAGIQFRILNSRKGPAVRATRAQADRVLYKK
MNMG_FRATW       CNPAIGGIGKGHLVKEIDAMGGVMAKAIDMAGIQFRILNSRKGPAVRATRAQADRLLYKK
MNMG_FRATT       CNPAIGGIGKGHLVKEIDAMGGVMAKAIDMAGIQFRILNSRKGPAVRATRAQADRLLYKK
MNMG_FRAT1       CNPAIGGIGKGHLVKEIDAMGGVMAKAIDMAGIQFRILNSRKGPAVRATRAQADRLLYKK
MNMG_FRATN       CNPAIGGIGKGHLVKEIDAMGGVMAKAIDMAGIQFRILNSRKGPAVRATRAQADRVLYKK
MNMG_FRAP2       CNPAIGGIGKGHLVKEIDAMGGIMAKAIDMAGIQFRILNSRKGPAVRATRAQADRVLYKK
MNMG_VESOH       CNPAIGGIGKGHLVKEIDAMGGIMAHTIDKSGIQFRTLNASKGSAVRATRAQADRILYKS
MNMG_RUTMC       CNPAIGGIGKGHLVKEIDAMGGIMARAIDKSGIQFRTLNASKGPAVRATRAQADRILYKA
MNMG_DICNV       CNPSIGGIGKGHLVKEIDALDGVMARATDRAGIHWRILNRRKGAAVQATRAQADRVLYKA
MNMG_BLOFL       CNPSIGGIGKGHLVKEVDAMGGIMAKAIDQSGIQFRILNTRKGAAVKSTRAQADKILYRQ
MNMG_BLOPB       CNPAVGGIGKGHLVKEIDAMGGSMAYAIDQSGIQFRVLNSSKGAAVRATRAQADKILYRQ
MNMG_BAUCH       CNPAIGGIGKGHLAKEVDAMGGIMAKAIDAAGIQFRILNASKGPAVRATRAQADRYLYRK
MNMG_BUCAI       CNPAIGGIGKSHLVKEIDALGGMMAKAIDYSGIQFRILNSSKGPAVRSTRAQADKILYHE
MNMG_BUCAP       CNPAIGGIGKSHLVKEIDALGGLMARAIDYSGIQFRVLNSKKGPAVRSTRAQADRILYCQ
MNMG_BUCBP       CNPAIGGIGKSHLVKEVDALGGIMAKAIDKSGIQFRILNSKKGFAVRSTRAQADRKLYSQ
MNMG_WIGBR       CNPSIGGIGKGHLVKEIDAMGGIMGIAADNSGIQFRTLNSSKGPAVRATRAQIDRKLYSS
MNMG_BUCCC       CNPAIGGLGKSQLVKEIDALGGLMAKVIDYSGIQFRILNSKKGYAVRSTRAQADRFLYQK
MNMG_HALHL       CNPAIGGIGKGHLVREIDALGGVMGRLADASAIHARVLNQRKGPAVRATRIQADRPTYAR
MNMG_RHIME       CNPAIGGLGKGHLVREIDALDGLMGRVADAAGIQFRLLNRRKGPAVRGPRTQADRKLYRE
MNMG_SINMW       CNPAIGGLGKGHLVREIDALDGLMGRVADAAGIQFRLLNRRKGPAVRGPRTQADRKLYRE
MNMG_RHIEC       CNPAIGGLGKGHLVREIDAMDGLMGRVADVAGIQFRMLNRKKGAAVRGPRTQADRKLYRL
MNMG_RHIL3       CNPAIGGLGKGHLVREIDAMDGLMGRVADVAGIQFRMLNKKKGAAVRGPRTQADRKLYRL
MNMG_AGRFC       CNPAIGGLGKGHLVREIDALDGLMGRVADAAGIQFRMLNRKKGPAVRGPRTQADRRLYRE
MNMG_BARHE       CNPAIGGLGKGHLVREIDAFDGLMGRAADAAGIQFRLLNRRKGPAVRGPRAQADRQLYKE
MNMG_BARQU       CNPAIGGLGKGHLVREIDALDGLMGRAADIAGIQFRLLNRRKGPAVRGPRTQADRKLYKK
MNMG_BART1       CNPAIGGLGKGHLVREIDALDGLMGRAADAAGIQFRLLNRRKGPAVRGPRTQADRQLYKE
MNMG_BARBK       CNPAIGGLGKGHLVREIDALDGLMGRAADFAGIQFRLLNRRKGPAVRGPRTQADRQLYKK
MNMG_BRUAB       CNPAIGGLGKGHLVREIDALDGLMGRVADRAGIQFRLLNRRKGPAVRGPRTQADRKLYRL
MNMG_BRUA2       CNPAIGGLGKGHLVREIDALDGLMGRVADRAGIQFRLLNRRKGPAVRGPRTQADRKLYRL
MNMG_BRUC2       CNPAIGGLGKGHLVREIDALDGLMGRVADRAGIQFRLLNRRKGPAVRGPRTQADRKLYRL
MNMG_BRUSU       CNPAIGGLGKGHLVREIDALDGLMGRVADRAGIQFRLLNRRKGPAVRGPRTQADRKLYRL
MNMG_BRUSI       CNPAIGGLGKGHLVREIDALDGLMGRVADRAGIQFRLLNRRKGPAVRGPRTQADRKLYRL
MNMG_BRUME       CNPAIGGLGKGHLVREIDALDGLMGRVADRAGIQFRLLNRRKGPAVRGPRTQADRKLYRL
MNMG_BRUO2       CNPAIGGLGKGHLVREIDALDGLMGRVADRAGIQFRLLNRRKGPAVRGPRTQADRKLYRL
MNMG_BRUA4       CNPAIGGLGKGHLVREIDALDGLMGRVADEAGIQFRLLNRRKGPAVRGPRTQADRKLYRL
MNMG_RHILO       CNPAIGGLGKGHLVREIDAMDGLMGRVADAAGIQFRLLNRRKGPAVRGPRTQADRKLYRL
MNMG_CHESB       CNPAIGGIGKGQLVREVDALDGLMGRVADAAGIQFRLLNRRKGPAVRGPRTQADRKLYRQ
MNMG_BRASB       CNPAIGGLGKGHLVREVDALDGLMGRVADAGGIQFRVLNRRKGPAVRGPRAQADRKLYAA
MNMG_BRASO       CNPAIGGLGKGHLVREVDALDGLMGRVADAGGIQFRVLNRRKGPAVRGPRAQADRKLYAA
MNMG_BRADU       CNPAIGGLGKGHLVREVDALDGLMGRVGDAGGIQFRVLNRRKGPAVRGPRAQADRKLYAA
MNMG_NITHX       CNPAIGGLGKGHLVREIDALDGLMGRVADAAGIQFRMLNRRKGPAVRGPRAQEDRKLYAA
MNMG_NITWN       CNPAIGGLGKGHLVREVDALDGLMARIADAGGIQFRMLNRRKGPAVRGPRAQEDRKLYAA
MNMG_RHOPS       CNPAIGGLGKGHLVREVDALDGLMGRVADAGGIQFRMLNRRKGPAVRGPRAQADRKLYAA
MNMG_RHOP2       CNPAIGGLGKGHLVREVDALDGLMGRVADAGGIQFRMLNRRKGPAVRGPRAQADRKLYAA
MNMG_RHOPA       CNPAIGGLGKGHLVREVDALDGLMGRVADAGGIQFRMLNRRKGPAVRGPRAQADRKLYAA
MNMG_RHOP5       CNPAIGGLGKGHLVREVDALDGLMGQVADAGGIQFRMLNRRKGPAVRGPRAQADRKLYAA
MNMG_RHOPB       CNPAIGGLGKGHLVREVDALDGLMGRVADQGGIQFRMLNRRKGPAVRGPRAQADRKLYAA
MNMG_AZOC5       CNPAIGGLGKGHLVREIDALDGLMGRVADQGGIQFRLLNRRKGPAVRGPRAQADRKLYAR
MNMG_METPB       CNPAIGGLGKGHLVREVDALDGLMARVADAAGIQFRLLNRRKGPAVRGPRTQADRALYAR
MNMG_METRJ       CNPAIGGLGKGHLVREVDALDGLMGRVADAAGIQFRLLNRRKGPAVRGPRTQADRKLYAA
MNMG_METS4       CNPAIGGLGKGHLVREVDALDGLMGRVADRAGIQFRLLNRRKGPAVRGPRSQADRKLYAR
MNMG_BEII9       CNPAIGGLGKGHLVREIDALDGLMGRVADAAGIQFRVLNRAKGPAVRGPRAQADRKLYRA
MNMG_PARL1       CNPAIGGLGKGHLVREVDALDGLMGRVADQAGIQFRLLNRRKGPAVRGPRAQADRKLYRA
MNMG_RHORT       CNPAIGGLAKGHLVREIDALDGVMGRAIDRGGIQFRILNRSKGPAVRGPRAQADRALYAQ
MNMG_MAGSA       CNPAIGGLAKGQLVREIDAMDGLMGRVIDRAGIQFRILNRSKGAAVQGPRAQADRKLYRL
MNMG_CAUVC       CNPAIGGLGKGHLVREIDALDGVMGRMADKAGIQFRMLNRSKGPAVRGPRSQIDRRLYRE
MNMG_CAUSK       CNPAIGGLGKGHLVREIDALDGLMGRIGDKAGIQYRLLNRSKGPAVRGPRSQIDRKLYRE
MNMG_MARMM       CNPAIGGLGKGHLVREIDALDGVMGRVADASGIQFRLLNRSKGPAVRGPRTQSDRALYRT
MNMG_HYPNA       CNPAIGGLGKGHLVREIDALDGVMGRLADKAGIQFRMLNRSKGPAVWGPRSQIDRKLYRE
MNMG_GLUOX       CNPAIGGIGKGHLVREIDALDGLMGKAADRAGIHFKLLNRSKGPAVHGPRAQADRSLYRA
MNMG_GLUDA       CNPAIGGIGKGHLVREIDALDGLMARAADRAGIHFKLLNRSKGPAVHGPRAQADRSLYRR
MNMG_GRABC       CNPAIGGIGKGHLVREIDALDGLMGRAIDQACIHFKMLNRSKGPAVRGPRAQADRKLYKK
MNMG_ACICJ       CNPAIGGIGKGHLVREIDALDGVMGRAADAACIHFKMLNRSKGPAVWGPRAQADRGLYRA
MNMG_RUEPO       CNPAIGGLGKGHLVREIDALDGVMGRVADKAGIQFRLLNRRKGPAVQGPRAQADRKLYRL
MNMG_RUEST       CNPAIGGLGKGHLVREIDALDGVMGRVADLAGIQFRLLNRRKGPAVQGPRAQADRSIYRK
MNMG_ROSDO       CNPAIGGLGKGHLVREIDALDGVMGRVADQAGIQFRLLNRRKGPAVQGPRAQSDRAIYHN
MNMG_DINSH       CNPAIGGLGKGHLVREIDAMDGVMGRVADKAGIQFRLLNRRKGPAVQGPRSQSDRDVYRS
MNMG_RHOS1       CNPAIGGLGKGHLVREIDALDGIMGRAADEAGIQFRLLNRKKGPAVQGPRAQADRRLYRE
MNMG_CERS4       CNPAIGGLGKGHLVREIDALDGIMGRAADEAGIQFRLLNRKKGPAVQGPRAQADRRLYRE
MNMG_CERS5       CNPAIGGLGKGHLVREIDALDGLMGRAADAAGIQFRLLNRKKGPAVQGPRAQADRRLYRA
MNMG_PARDP       CNPAIGGLGKGHLVREIDALDGVMGKLADTAGIQFRLLNRRKGPAVQGPRAQADRKLYRS
MNMG_JANSC       CNPAIGGLGKGHLVREIDAMGGVMGCAADASGIQYRLLNRKKGAAVQGPRTQSDRALYKS
MNMG_NOVAD       CNPAIGGLGKGHLVREVDALDGLIARAADASAIHYRMLNRSKGSAVQGPRVQADRKRFKA
MNMG_ERYLH       CNPAIGGLGKGHLVREVDAFDGVIARAADAAAIHYRMLNRSKGSAVWGPRVQADRKLFHA
MNMG_SPHAL       CNPAIGGLGKGHLMREVDALDGWMARAADAAAIHYRMLNASKGAAVQGPRIQADRKLYRA
MNMG_SPHWW       CNPAIGGLGKGHLVREVDACDGLIARAADRAAIHYRMLNSSKGAAVQGPRVQADRKLYKA
MNMG_ZYMMO       CNPAIGGLGKGHLVREIDAWDGLMPHAADYAAIHYRMLNRSKGSAVQGPRIQADRNRYKK
MNMG_ANAMM       CNPAIGGVAKGVVVREVDALDGLMGQAIDKASIHSTILNQSKGPAVWGPRAQADRDAYRT
MNMG_ANAPZ       CNPAIGGIAKGVVVREVDALDGLMGKVIDKSSIHSIILNRSKGPAVWGPRAQADREVYKP
MNMG_EHRCJ       CNPAIGGIAKGTVVREVDALDGLMGKVIDKASIHSSILNRSKGPAVWGPRAQADRLIYKQ
MNMG_EHRCR       CNPAIGGIAKGTVVREVDALDGLMGKVIDKASINSSILNRSKGPAVWGPRAQADRKIYKN
MNMG_EHRRG       CNPAIGGIAKGIVVREVDALDGLMGKVIDNASINSTILNRSKGPAVWGPRAQADRDLYRH
MNMG_EHRRW       CNPAIGGIAKGIVVREVDALDGLMGKVIDNASINSTILNRSKGPAVWGPRAQADRDLYRH
MNMG_WOLPM       CNPAIGGVAKGVVVREVDALDGIMGRAIDQASIHSVILNSSRGAAVWGPRAQADRKLYKQ
MNMG_WOLTR       CNPAIGGVAKGIVVREVDALDGIMGRAIDQASIHSVILNSSRGAAVWGPRAQADRKLYKK
MNMG_NEOSM       CNPAIGGIGKGNVVKEVDAMGGVMALAIDRASIHSRMLNRSKGAAVWGPRAQADRKLYKC
MNMG_RICRO       CNPAIGGIAKGTLVKEIDALDGLMGYVIDQAGIHYKMLNETRGPAVWGPRAQADRKLYKK
MNMG_RICRS       CNPAIGGIAKGTLVKEIDALDGLMGYVIDQAGIHYKMLNETRGPAVWGPRAQADRKLYKK
MNMG_RICCN       CNPAIGGIAKGTLVKEIDALDGLMGYVIDQAGIHYKMLNETRGPAVWGPRAQADRKLYKK
MNMG_RICM5       CNPAIGGIAKGTLVKEIDALDGLMGYVIDQAGIHYKMLNETRGPAVWGPRAQADRKLYKK
MNMG_RICFE       CNPAIGGIAKGTLVKEIDALDGLMGYVIDQGGIHYKMLNETRGPAVWGPRAQADRKLYKK
MNMG_RICAH       CNPAIGGIAKGTLVKEIDALDGLMGYVIDQAGIHYKMLNETRGPAVWGPRAQADRKLYKK
MNMG_RICCK       CNPAIGGIAKGILVKEIDALDGLMGYVIDQAGIHYKMLNETRGPAVWGPRAQADRKLYKK
MNMG_RICB8       CNPAIGGIAKGTLVKEIDALDGLMGYVIDQAGIHYKMLNETRGPAVWGPRAQADRKLYKK
MNMG_RICBR       CNPAIGGIAKGTLVKEIDALDGLMGYVIDQAGIHYKMLNETRGPAVWGPRAQADRKLYKK
MNMG_RICPR       CNPAIGGIAKGTLVKEIDALDGLMGFVIDKSGIHYKMLNETRGPAVWGPRAQADRKLYKK
MNMG_RICTY       CNPAIGGIAKGTLVKEIDALDGLMGFVIDKAGIHYKMLNETRGPAVWGPRAQADRKLYKK
MNMG_ORITB       CNPAIGGRGKGHIVKEVDALDGLIGYIADQAGIHYKMLNHTKGPAVWGPRAQIDRALYKS
MNMG_PELUB       CNPAIGGLGKGHLVRELDALDGVMGDVADKSGIQFRLLNRSRGPAVQGPRTQSDRSLYRK
MNMG_KORVE       CNPAVGGIAKGHLVREVDALGGIMGEVTDAVGIQFRLLNTSRGPAVWSPRAQCDKQQYRL
MNMG_SOLUE       CNPAIGGIAKGHLVREIDALGGVMGEVADSVGIQFRLLNTSRGPAVWSPRAQMDKKLYRF
MNMG_MAGMM       CNPAIGGIGKGHLVKELDALGGVMGIVADQSGIQFKKLNQRKGPAVHGSRAQIDKMAYRK
MNMG_CAMJE       CNPAIGGLAKGHLVKELDAMGGLMGEITDEAGIQFRILNESKGVAVQGSRAQIDMDKYRI
MNMG_CAMJJ       CNPAIGGLAKGHLVKELDAMGGLMGEITDEAGIQFRILNESKGVAVQGSRAQIDMDKYRI
MNMG_CAMJR       CNPAIGGLAKGHLVKELDAMGGLMGEITDEAGIQFRILNESKGVAVQGSRAQIDMDKYRI
MNMG_CAMJ8       CNPAIGGLAKGHLVKELDAMGGLMGEITDEAGIQFRILNESKGVAVQGSRAQIDMDKYRI
MNMG_CAMJD       CNPAIGGLAKGHLVKELDAMGGFMGEITDEAGIQFRILNESKGVAVQGSRVQIDMDKYRI
MNMG_CAMC1       CNPAIGGLAKGHLVKEIDALGGQMGLTTDAVGIQFRVLNESKGPAVRGSRAQIDMDRYRV
MNMG_CAMC5       CNPAIGGLAKGHLVKEIDALGGQMGLTTDAVGIQFRVLNESKGPAVRGSRAQIDMDRYRV
MNMG_CAMFF       CNPAIGGLAKGHLVKEIDALGGQMGLTTDACGIQFRLLNESKGPAVRGSRAQIDMDRYRV
MNMG_CAMHC       CNPAIGGLAKGHLVKEIDALGGQMGVCTDFAGIQFRTLNESKGPAVRGSRAQIDMDRYRI
MNMG_NITSB       CNPAIGGLAKGHLVKEIDALGGQMGLTTDKTGIQFRILNASKGPAVRGSRAQIDMDRYRI
MNMG_SULDN       CNPAIGGLAKGHLVREIDALGGEMALITDEAGIQFRILNQTKGPAVRGSRAQIDMDRYRV
MNMG_ARCB4       CNPAIGGLAKGHLVRELDAIGGEMGLCTDNTGIQFRILNASKGAAVQGSRAQIDMDKYRE
MNMG_SULNB       CNPAIGGLAKGHLVREVDALGGEMGLCTDATGIQFRTLNASKGPAVRGSRAQIDMDEYRI
MNMG_HELPY       CNPAIGGLGKGHLTKEVDVLGGAMGIITDHSGLQYRVLNASKGPAVRGTRAQIDMDTYRI
MNMG_HELPH       CNPAIGGLGKGHLTKEVDVLGGAMGIITDNSGLQYRVLNASKGPAVRGTRAQIDMDTYRI
MNMG_HELPJ       CNPAIGGLGKGHLTKEVDVLGGAMGIITDHSGLQYRVLNASKGPAVRGTRAQIDMDTYRI
MNMG_HELAH       CNPAIGGLGKGHLTKEVDVLGGAMGIITDNSGLQYRVLNASKGPAVRGTRAQIDMDTYRI
MNMG_HELHP       CNPAVGGLGKGHLVKEIDALGGVMGVITDKCGIQFRILNASKGPAVRGTRAQIDMDRYSI
MNMG_WOLSU       CNPAIGGLAKGHLVKEIDALGGVMGKVTDLCGLQFRTLNASKGPAVRGTRAQIDMDRYRI
MNMG_LEPIN       CNPAIGGIAKGHMVREVDALGGIMGKMIDNTGIQFKMLNTSKGPSVWAPRAQAEKKEYQL
MNMG_LEPIC       CNPAIGGIAKGHMVREVDALGGIMGKMIDNTGIQFKMLNTSKGPSVWAPRAQAEKKEYQL
MNMG_LEPBJ       CNPAIGGIAKGHMVREVDALGGIMGKVIDNTGIQFKMLNTSKGPSVWAPRAQAEKKEYQL
MNMG_LEPBL       CNPAIGGIAKGHMVREVDALGGIMGKVIDNTGIQFKMLNTSKGPSVWAPRAQAEKKEYQL
MNMG_LEPBA       CNPAIGGIAKGHMVREVDALGGLMGRVIDQTGIQFKMLNTSKGPSVWAPRAQAEKKQYQL
MNMG_LEPBP       CNPAIGGIAKGHMVREVDALGGLMGRVIDQTGIQFKMLNTSKGPSVWAPRAQAEKKQYQL
MNMG_GEOMG       CNPAIGGSAKGHLVKEIDALGGEMGKNIDATGIQFRILNTRKGPAVRASRAQADKQLYRL
MNMG_GEOSL       CNPAIGGLAKGHLVKEIDALGGEMGKNIDATGIQYRILNTRKGPAVRASRAQADKQLYRL
MNMG_GEOUR       CNPAIGGLAKGHLVKEIDALGGEMAKNIDATGIQFRILNTKKGPAVRASRAQADKQQYRL
MNMG_PELPD       CNPSIGGLAKGHLVKEIDALGGEMARNIDATGIQFRILNTRKGPAVRASRAQADKQLYRL
MNMG_PELCD       CNPAIGGLAKGHLVREIDALGGEMARVIDATGIQFRTLNTKKGPAVRATRAQADRRAYQF
MNMG_DESPS       CNPAIGGLAKGHLVREIDALGGEMARVIDATSIQFRRLNTSKGPAVQSSRAQADRLLYRL
MNMG_DESVH       CNPAIGGLAKGHMVKEIDALGGMMGLWADEAGIQFRTLNSSKGPAVRATRAQIDRDAYLR
MNMG_DESVV       CNPAIGGLAKGHMVKEIDALGGMMGLWADEAGIQFRTLNSSKGPAVRATRAQIDRDAYLR
MNMG_DESAG       CNPAIGGLAKGHMVKEIDALGGMMGLWADEAGIQFRLLNTSKGPAVHSTRAQIDRDAYMK
MNMG_LAWIP       CNPAVGGIAKGHIVREIDALGGMMGLWADKAGIQFRTLNRSKGPAVRATRAQVDRDLYMQ
MNMG_SYNFM       CSPSVGGVGKGHLVREIDALGGRMALITDRTAIQFRLLNTKKGPAVWGTRTQNDKARYRI
MNMG_SYNAS       CNPAIGGLAKGQLVKEIDALGGEMGRMADKTAVHFRILNASKGPAVQSSRVQCDKQLYRL
MNMG_CHLTE       CNPAIGGVAKGQITREIDALGGEMGKAIDATGIQFRMLNRSKGPAMHSPRAQADKTQYSL
MNMG_CHLCH       CNPAIGGMAKGQITREIDALGGEMAKAIDATGIQFRLLNRSKGPAMHSPRAQADRTLYSL
MNMG_CHLPM       CNPAIGGVAKGQITREIDALGGEMAKAIDATGIQFRMLNLSKGPAMHSPRAQADRTAYTE
MNMG_CHLL3       CNPAIGGVAKGQITREIDALGGEMAKAIDSTGIQFRMLNLSKGPAMHSPRAQADRVAYTA
MNMG_CHLPD       CNPAIGGVAKGQITREIDALGGEMAKAIDETGIQFRMLNKSKGAAMHSPRAQADRALYSV
MNMG_BACFR       CNPAVGGIAKGQIVREIDALGGYMGLVTDQTAIQFRILNRSKGPAMWSPRAQCDRNKFIW
MNMG_BACFN       CNPAVGGIAKGQIVREIDALGGYMGLVTDQTAIQFRILNRSKGPAMWSPRAQCDRNKFIW
MNMG_BACTN       CNPAVGGIAKGQIVREIDALGGQMGLVTDETAIQFRILNRSKGPAMWSPRAQCDRAKFIW
MNMG_PHOV8       CNPAVGGIAKGQIVREIDALGGYMGLVTDRTAIQFRMLNRSKGPAMWSPRAQCDRGKFIW
MNMG_PARD8       CNPAVGGIAKGQIVREIDALGGYMGIVTDQTAIQFRMLNRSKGPAMWSPRAQSDRARFID
MNMG_PORGI       CNPAVGGIAKGQIVREIDALGGRMGIVTDATAIQFRMLNRSKGPAMWSPRAQSDRMRFME
MNMG_FLAJ1       CNPAMGGIAKGQIVREIDALGGYSGIVSDRTAIQFKMLNKSKGPAMWSPRVQSDRMRFAE
MNMG_FLAPJ       CNPAMGGIAKGQIVREIDALGGYSGIVSDNTAIQFKMLNKSKGPAMWSPRVQSDRMRFAE
MNMG_GRAFK       CNPAMGGIAKGQIVREIDAMGGYSGIVSDTSAIQFKMLNKSKGPAMWSPRVQSDRMRFAE
MNMG_CYTH3       CNPAMGGVAKGQIVREIDALGGLSGIVSDKSMIQFRMLNRSKGPAMWSPRSQNDRHMFAW
MNMG_SULMW       CNPAMGGIAKGQMIKEIDALGGYSGIITDKSMIQFRMLNKSKGPAMWSPRAQCDRLKFSK
MNMG_SALRD       CNPAIGGIGKGHIAREIDALGGIMGKATDRAGIQFRMLNKSKGPAVWGPRAQCGRRAYAR
MNMG_BORAP       CNPAIGGLAKGNMVREIDALGGEMGRIIDFSMIQFRVLNKSRGPAVQAPRAQADKLMYQT
MNMG_BORBP       CNPAIGGLAKGNMVREIDALGGEMGRIIDFSMIQFRVLNKSRGPAVQAPRAQADKLMYQT
MNMG_BORBU       CNPAIGGLAKGNMVREIDALGGEMGRIIDFSMIQFRVLNKSRGPAVQAPRAQADKLMYQT
MNMG_TREDE       CNPSIGGISKGNIVREIDALGGEMGKLADASMIQYRLLNKSRGPAVQAPRVQADKFLYSQ
MNMG_TREPA       CNPSIGGISKGNIVREIDALGGEMGKFADACMIQYRLLNKSRGPAVQAPRIQADKFLYAQ
MNMG1_FUSNN      CNPSIGGPGKSNLVTEIDVLGGEMGRHIDEFNLQLKDLNTSKGPAARITRGQADKYKYRR
MNMG2_FUSNN      CNPSLGGPAKSHLAREIDALGGEMGRNIDKTFIQIRVLNTRKGPAVRSLRAQADKMAYAN
MNMG_ENDTX       CNPAVGGIAKGQMVREIDAMGGEIGRITDRAVLQFKMLNSSRGPAVWSPRAQCDKELYSV
MNMG_ONYPE       CNPSIGGPAKGVVVREIDALGGVMAKAADLAQIQIKMLNSSKGPAVRALRAQIDKLEYPQ
MNMG_AYWBP       CNPSIGGPAKGVVVREIDALGGIMAKATDLAQIQIKMLNSSKGPAVRALRAQIDKLEYPQ
MNMG_ACHLI       CNPSIGGPAKGIVVREIDALGGQMAKSADLSQIQMKMLNPSKGPAVRALRAQIDKLKYPK
MNMG_MYCCT       CNPSVGGPAKGIVVREIDALGGEMAKAADATALQTKLLNSSRGPGVWALRVQSDKEEYSK
MNMG_MYCMS       CNPSVGGPAKGIVVREIDALGGEMAKAADATALQTKLLNSSRGPGVWALRVQSDKEEYSK
MNMG_MESFL       CNPSVGGPAKGIVVREIDALGGEMAKAADKTALQTKLLNSSRGPGVWALRVQSDKEEYSK
MNMG_MYCGE       CNPSIGGPAKGIVTREIDVLGGMQAIAADNNALQYKLLNSSKGPAVQAIRAQIDKIGYKN
MNMG_MYCPN       CNPAIGGPAKGIVTREIDVLGGMQGKAADATALQYKLLNSSKGPAVQAIRAQIDKIAYQK
MNMG_MYCGA       CNPSVGGPAKGIVTREIDALGGIQALAADSTALQRKILNSSKGPGVQCLRFQIDKVYYKK
MNMG_UREPA       CNPSIGGPAKGIVTREIDALGGIQGKAADATTMQMKILNSSKGPGVWAIRAQIDKIAYQR
MNMG_UREP2       CNPSIGGPAKGIVTREIDALGGIQGKAADATTMQMKILNSSKGPGVWAIRAQIDKIAYQR
MNMG_MYCPE       CNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSK
MNMG_MYCH7       CNPAIGGPAKGIITREIDALGGVQGKFSDLAMIQIKYLNESKGPAVLAIRAQIDKEKYSK
MNMG_MYCHJ       CNPAIGGPAKGIITREIDALGGVQGKFSDLAMIQIKYLNESKGPAVLAIRAQIDKEKYSK
MNMG_MYCH2       CNPAIGGPAKGIITREIDALGGVQGKLSDLAMIQIKYLNESKGPAVLAIRAQIDKEKYSK
MNMG_MYCPU       CNPSIGGPAKGIITKEIDALGGVQGYYADKAMIQVKMLNESKGPSVRAIRAQIDKEKYSE
MNMG_MYCS5       CNPSIGGPAKGIITREIDALGGIQGYYSDLAMIQIKMLNDSKGPAVRAIRAQIDKEKYSK
MNMG_MYCMO       CNPSIGGPAKGIITREIDALGGKQAYFADQAMIQIKMLNTSKGPAVRAIRAQIDKEKYSQ
MNMG_MYCAP       CNPSIGGPAKGIITREIDALGGMQGLWADLATIQLKMLNLSKGPAVRALRAQIDKEKYSQ
MNMG_THEM4       CNPAIGGPAKGIVVREIDVLGGEMAKTTDETMINVRMLNTGKGPAVRALRAQIDKYAYSQ
MNMG_FERNB       CNPAIGGSAKGIVVREIDALGGEMAKTTDETMINVRMLNTSKGPAVQALRAQIDKYSYSR
MNMG_THEMA       CNPAIGGPAKGVVVREIDALGGEMAKTTDETMINVRMLNVSKGPAVRALRAQIDKISYSR
MNMG_THESQ       CNPAIGGPAKGVVVREIDALGGEMAKTTDETMINVRMLNVSKGPAVRALRAQIDKISYSR
MNMG_THEP1       CNPAIGGPAKGVVVREIDALGGEMAKTTDETMINIRMLNVSKGPAVRALRAQIDKILYSR
MNMG_PETMO       CNPAIGGPAKGVVAREIDALGGVQAKVTDETMINIRMLNTSKGIAVRALRAQIDKYDYSQ
MNMG_BDEBA       CNPSIGGLAKGHMVREIDVLGGQMGVAADETCIQYKRLNASKGPAVRGTRVQNDKHLYSQ
MNMG_ALKMQ       CNPSIGGTGKGHLVREIDAIGGEMGINTDKTFIQSRMLNTGKGPAVHSLRAQADKNKYHT
MNMG_ALKOO       CNPSIGGTGKGHLVREIDALGGEMGLNIDKTFIQSRMLNTAKGPAVHSLRAQADKTRYHI
MNMG_CLOD6       CNPSIGGTGKGQLVKEIDALGGQMGLNIDKTYIQSRMLNTAKGPAVHSLRAQADKFKYHE
MNMG_FINM2       CNPNIGGTGKGHLVKEVDALGGEMGLVIDKTYIQSRMLNTSKGPAVHSLRVQADKRKYHD
MNMG_CALS8       CNPSIGGTGKGHLVREIDALGGEMGKAADATAIQVRILNRAKGPAVYSLRAQCDRARYKL
MNMG_ACET2       CNPNIGGTAKGHLVREIDALGGEMGKNADKTFIQSKILNSAKGPAVYSLRAQVDRRSYQI
MNMG1_CALS4      CNPSIGGPAKAQLVREIDALGGQMAINTDKSLLQMRTLNTSKGPAVRSLRAQVDKKLYQM
MNMG2_CALS4      CNPSIGGPAKAQLVREIDALGGEMAVNTDKSLLQMRTLNTSKGPAVRSLRAQVDKKLYQA
MNMG_THEP3       CNPSIGGPAKAQLVREIDALGGEMAINTDKSLLQIRTLNTSKGPAVRSLRAQVDKKLYQM
MNMG_THEPX       CNPSIGGPAKAQLVREIDALGGEMAINTDKSLLQIRTLNTSKGPAVRSLRAQVDKKLYQM
MNMG_CLOB1       CNPNIGGTAKGHLVREIDALGGEMGINIDHTFIQSRMLNTSKGPAVHSLRAQADKKRYSE
MNMG_CLOBH       CNPNIGGTAKGHLVREIDALGGEMGINIDHTFIQSRMLNTSKGPAVHSLRAQADKKRYSE
MNMG_CLOBL       CNPNIGGTAKGHLVREIDALGGEMGINIDHTFIQSRMLNTSKGPAVHSLRAQADKKRYSE
MNMG_CLOBK       CNPNIGGTAKGHLVREIDALGGEMGINIDHTFIQSRMLNTSKGPAVHSLRAQADKKRYSE
MNMG_CLOBM       CNPNIGGTAKGHLVREIDALGGEMGINIDHTFIQSRMLNTSKGPAVHSLRAQADKKRYSE
MNMG_CLONN       CNPNIGGTAKGHLVREIDALGGEMGINIDHTYIQSRMLNTSKGPAVHSLRAQADKRKYAE
MNMG_CLOAB       CNPNIGGTAKGHLVKEIDALGGEMGVNIDKTFIQSRMLNISKGPAVHSLRAQADKVRYSE
MNMG_CLOTE       CNPNIGGTAKGHLVREIDALGGEMGVNIDNTFIQSRMLNTSKGPAVHSLRAQADKSRYSN
MNMG_CLOK5       CNPNIGGTAKGHLVREIDALGGEMGVNIDATFIQSRMLNTSKGPAVHSLRAQADKRNYSG
MNMG_CLOP1       CNPNIGGTAKGHLVREIDALGGEMGVNIDHTFIQSKMLNTSKGPAVHSLRAQADKKKYQE
MNMG_CLOPS       CNPNIGGTAKGHLVREIDALGGEMGVNIDHTFIQSKMLNTSKGPAVHSLRAQADKKKYQE
MNMG_CLOPE       CNPNIGGTAKGHLVREIDALGGEMGVNIDHTFIQSKMLNTSKGPAVHSLRAQADKKKYQE
MNMG_CLOB8       CNPNIGGTAKGHLVREIDALGGEMGINIDNTFIQSRMLNTSKGPAVHSLRAQADKKSYQF
MNMG_LACP7       CNPNIGGTSKGHLVREIDALGGEMGKNIDKTYIQSKMLNQSKGPAVHSLRAQADKMDYCR
MNMG_NATTJ       CNPAIGGPAKSHIVREVDALGGEMGKNIDDTAIQFRMLNTRKGPAVQALRAQADKIKYQE
MNMG_BACVZ       CNPSVGGPAKGIVVREIDALGGEMARNIDKTHIQMRMLNTGKGPAVRALRAQADKFQYQH
MNMG_BACSU       CNPSVGGPAKGIVVREIDALGGEMGRNIDKTHIQMRMLNTGKGPAVRALRAQADKFQYQH
MNMG_BACLD       CNPSVGGPAKGIVVREIDALGGEMAKNIDKTHIQMRLLNTGKGPAVRALRAQADKFQYQH
MNMG_BACP2       CNPSVGGPAKGIVVREIDALGGEMARNIDKTHIQMRMLNTGKGPAVRALRAQADKFQYQH
MNMG_BACAH       CNPSVGGPAKGIVVREIDALGGEMGRNIDKTHIQMRMLNTGKGPAVRALRAQADKFSYQH
MNMG_BACHK       CNPSVGGPAKGIVVREIDALGGEMGRNIDKTHIQMRMLNTGKGPAVRALRAQADKFSYQH
MNMG_BACAN       CNPSVGGPAKGIVVREIDALGGEMGRNIDKTHIQMRMLNTGKGPAVRALRAQADKFSYQH
MNMG_BACCZ       CNPSVGGPAKGIVVREIDALGGEMGRNIDKTHIQMRMLNTGKGPAVRALRAQADKFSYQH
MNMG_BACC1       CNPSVGGPAKGIVVREIDALGGEMGRNIDKTHIQMRMLNTGKGPAVRALRAQADKFSYQH
MNMG_BACCR       CNPSVGGPAKGIVVREIDALGGEMGRNIDKTHIQMRMLNTGKGPAVRALRAQADKFAYQH
MNMG_BACMK       CNPSVGGPAKGIVVREIDALGGEMGRNIDKTHIQMRMLNTGKGPAVRALRAQADKFSYQH
MNMG_BACCN       CNPSVGGPAKGIVVREIDALGGEMGRNIDKTHIQMRMLNTGKGPAVRALRAQADKFLYQH
MNMG_GEOKA       CNPSIGGPAKGIVVREIDALGGEMAKNIDKTYIQMRMLNTGKGPAVRALRAQADKVLYQR
MNMG_GEOTN       CNPSIGGPAKGIVVREIDALGGEMGKNIDKTYIQIRMLNTGKGPAVRALRAQADKVLYQR
MNMG_LYSSC       CNPSIGGPAKGIVVREIDALGGVMGKVIDKTHIQMRMLNTGKGPAVRALRAQADKVLYQQ
MNMG_STAA2       CNPSVGGPAKGIVVREIDALGGQMAKTIDKTHIQMRMLNTGKGPAVRALRAQADKVLYQQ
MNMG_STAA9       CNPSVGGPAKGIVVREIDALGGQMAKTIDKTHIQMRMLNTGKGPAVRALRAQADKVLYQQ
MNMG_STAAR       CNPSVGGPAKGIVVREIDALGGQMAKTIDKTHIQMRMLNTGKGPAVRALRAQADKVLYQQ
MNMG_STAAS       CNPSVGGPAKGIVVREIDALGGQMAKTIDKTHIQMRMLNTGKGPAVRALRAQADKVLYQQ
MNMG_STAA1       CNPSVGGPAKGIVVREIDALGGQMAKTIDKTHIQMRMLNTGKGPAVRALRAQADKVLYQQ
MNMG_STAAM       CNPSVGGPAKGIVVREIDALGGQMAKTIDKTHIQMRMLNTGKGPAVRALRAQADKVLYQQ
MNMG_STAAW       CNPSVGGPAKGIVVREIDALGGQMAKTIDKTHIQMRMLNTGKGPAVRALRAQADKVLYQQ
MNMG_STAAN       CNPSVGGPAKGIVVREIDALGGQMAKTIDKTHIQMRMLNTGKGPAVRALRAQADKVLYQQ
MNMG_STAAB       CNPSVGGPAKGIVVREIDALGGQMAKTIDKTHIQMRMLNTGKGPAVRALRAQADKVLYQQ
MNMG_STAA8       CNPSVGGPAKGIVVREIDALGGQMAKTIDKTHIQMRMLNTGKGPAVRALRAQADKVLYQQ
MNMG_STAA3       CNPSVGGPAKGIVVREIDALGGQMAKTIDKTHIQMRMLNTGKGPAVRALRAQADKVLYQQ
MNMG_STAAC       CNPSVGGPAKGIVVREIDALGGQMAKTIDKTHIQMRMLNTGKGPAVRALRAQADKVLYQQ
MNMG_STAAE       CNPSVGGPAKGIVVREIDALGGQMAKTIDKTHIQMRMLNTGKGPAVRALRAQADKVLYQQ
MNMG_STAAT       CNPSVGGPAKGIVVREIDALGGQMAKTIDKTHIQMRMLNTGKGPAVRALRAQADKVLYQQ
MNMG_STAES       CNPSVGGPAKGIVVREIDALGGQMAKTIDKTHIQMRMLNTGKGPAVRALRAQADKVLYQQ
MNMG_STAEQ       CNPSVGGPAKGIVVREIDALGGQMAKTIDKTHIQMRMLNTGKGPAVRALRAQADKVLYQQ
MNMG_STAHJ       CNPSVGGPAKGIVVREIDALGGQMAKAIDKTHIQMRMLNTGKGPAVRALRAQADKVLYQQ
MNMG_STAS1       CNPSVGGPAKGIVVREIDALGGQMAKTIDKTHIQMRMLNTGKGPAVRALRAQADKVLYQQ
MNMG_LISMO       CNPSVGGPAKGVVVREIDALGGEMGRNTDKTYIQMRMLNTGKGPAVRALRAQADKWDYQH
MNMG_LISMF       CNPSVGGPAKGVVVREIDALGGEMGRNTDKTYIQMRMLNTGKGPAVRALRAQADKWDYQH
MNMG_LISIN       CNPSVGGPAKGVVVREIDALGGEMGRNTDKTYIQMRMLNTGKGPAVRALRAQADKWDYQH
MNMG_LISW6       CNPSVGGPAKGVVVREIDALGGEMGRNTDKTYIQMRMLNTGKGPAVRALRAQADKWDYQH
MNMG_OCEIH       CNPSIGGPAKGIVVREIDALGGIMGKVIDKSYIQMRMLNTGKGPAVQALRAQADKPIYMK
MNMG_BACSK       CNPSVGGPAKGIVVREIDALGGEMGRNIDKTHIQMRMLNTGKGPAVRALRAQADKFRYQQ
MNMG_ALKHC       CNPSVGGPAKGIVVREIDALGGEMARNIDKTHIQMRMLNTGKGPAVRALRAQADKFLYQH
MNMG_EXIS2       CNPSIGGPAKGIVVREIDALGGEMARAIDATYIQMKMLNTSKGPAVRALRAQADKFEYQN
MNMG_LEVBA       CNPSVGGPAKGIVVREIDALGGEMGRNIDKTYVQMRMLNTGKGPAVRALRAQADKHAYHA
MNMG_LACPL       CNPSVGGPAKGIVVREIDALGGEMGRNIDKTYVQMRMLNTGKGPAVRALRAQADKHAYHA
MNMG_PEDPA       CNPSIGGPAKGIVVREIDALGGEMGRNIDKTYVQMRMLNTGKGPAVRALRAQADKHAYHA
MNMG_LACS1       CNPSIGGPAKGIVVREIDAMGGEMGRNIDKTYVQMRMLNTGKGPAVRALRAQADKRQYSI
MNMG_ENTFA       CNPSVGGPAKGVVVREIDALGGEMGKNIDKTYIQMRMLNTGKGPAVRALRAQADKHAYAT
MNMG_LACSS       CNPSLGGPAKGIVVREIDALGGQMGRNIDKTYIQMRMLNTGKGPAVRALRAQADKHAYHR
MNMG_LACP3       CNPSLGGPAKGIVVREIDALGGEMGKNIDRTYIQMRMLNTGKGPAVRALRAQADKAAYHR
MNMG_LACAC       CNPSVGGPAKGTVVREIDALGGQMGKNIDATYIQMRMLNTGKGPAVRALRAQADKWQYHE
MNMG_LACH4       CNPSVGGPAKGTVVREIDALGGQMGKNIDATYIQMRMLNTGKGPAVRALRAQADKWQYHE
MNMG_LACJO       CNPSVGGPAKGTVVREIDALGGEMGKNIDATYIQMRMLNTGKGPAVRALRAQADKWQYHE
MNMG_LACGA       CNPSVGGPAKGTVVREIDALGGEMGKNIDATYIQMRMLNTGKGPAVRALRAQADKWQYHE
MNMG_LACDA       CNPSVGGPAKGTVVREIDALGGEMGKNIDKTYIQMRMLNTGKGPAVRALRAQADKWDYHE
MNMG_LACDB       CNPSVGGPAKGTVVREIDALGGEMGKNIDKTYIQMRMLNTGKGPAVRALRAQADKWDYHE
MNMG_LACLM       CNPSIGGSAKGIVVREIDALGGEMGRNIDKTYIQMKMLNTGKGPAVRALRAQADKDEYAA
MNMG_LACLS       CNPSIGGSAKGIVVREIDALGGEMGRNIDKTYIQMKMLNTGKGPAVRALRAQADKDEYAA
MNMG_LACLA       CNPSIGGSAKGIVVREIDALGGEMGRNIDKTYIQMKMLNTGKGPAVRALRAQADKDEYAD
MNMG_STRA3       CNPSIGGSAKGIVVREIDALGGEMGKNIDKTYIQMKMLNTGKGPAVRALRAQADKALYAQ
MNMG_STRA5       CNPSIGGSAKGIVVREIDALGGEMGKNIDKTYIQMKMLNTGKGPAVRALRAQADKALYAQ
MNMG_STRA1       CNPSIGGSAKGIVVREIDALGGEMGKNIDKTYIQMKMLNTGKGPAVRALRAQADKALYAQ
MNMG_STRP1       CNPSIGGSAKGIVVREIDALGGEMGKNIDKTYIQMKMLNTGKGPAVRALRAQADKSLYAR
MNMG_STRPD       CNPSIGGSAKGIVVREIDALGGEMGKNIDKTYIQMKMLNTGKGPAVRALRAQADKSLYAR
MNMG_STRPB       CNPSIGGSAKGIVVREIDALGGEMGKNIDKTYIQMKMLNTGKGPAVRALRAQADKSLYAR
MNMG_STRPC       CNPSIGGSAKGIVVREIDALGGEMGKNIDKTYIQMKMLNTGKGPAVRALRAQADKSLYAR
MNMG_STRPG       CNPSIGGSAKGIVVREIDALGGEMGKNIDKTYIQMKMLNTGKGPAVRALRAQADKSLYAR
MNMG_STRP8       CNPSIGGSAKGIVVREIDALGGEMSKNIDKTYIQMKMLNTGKGPAVRALRAQADKSLYAR
MNMG_STRPF       CNPSIGGSAKGIVVREIDALGGEMGKNIDKTYIQMKMLNTGKGPAVRALRAQADKSLYAR
MNMG_STRPM       CNPSIGGSAKGIVVREIDALGGEMGKNIDKTYIQMKMLNTGKGPAVRALRAQADKSLYAR
MNMG_STRP3       CNPSIGGSAKGIVVREIDALGGEMGKNIDKTYIQMKMLNTGKGPAVRALRAQADKSLYAR
MNMG_STRP6       CNPSIGGSAKGIVVREIDALGGEMGKNIDKTYIQMKMLNTGKGPAVRALRAQADKSLYAR
MNMG_STRT2       CNPSIGGSAKGIVVREIDALGGEMGKNIDKTYIQMKMLNTGKGPAVRALRAQADKALYAM
MNMG_STRT1       CNPSIGGSAKGIVVREIDALGGEMGKNIDKTYIQMKMLNTGKGPAVRALRAQADKALYAM
MNMG_STRTD       CNPSIGGSAKGIVVREIDALGGEMGKNIDKTYIQMKMLNTGKGPAVRALRAQADKALYAM
MNMG_STRMU       CNPSIGGSAKGIVVREIDALGGEMGKNIDKSYIQMRMLNTGKGPAVRALRAQADKALYAR
MNMG_STRGC       CNPSIGGSAKGIVVREVDALGGEMAKNIDKSYIQMKMLNTGKGPAVRALRAQADKEVYSK
MNMG_STRSV       CNPSIGGSAKGIVVREVDALGGEMAKNIDKSYIQMKMLNTGKGPAVRALRAQADKELYSK
MNMG_STRR6       CNPSIGGSAKGIVVREVDALGGEMAKTIDKTYIQMKMLNTGKGPAVRALRAQADKELYSK
MNMG_STRP2       CNPSIGGSAKGIVVREVDALGGEMAKTIDKTYIQMKMLNTGKGPAVRALRAQADKELYSK
MNMG_STRPN       CNPSIGGSAKGIVVREVDALGGEMAKTIDKTYIQMKMLNTGKGPAVRALRAQADKELYSK
MNMG_STRPI       CNPSIGGSAKGIVVREVDALGGEMAKTIDKTYIQMKMLNTGKGPAVRALRAQADKELYSK
MNMG_STRSY       CNPSIGGSAKGIVVREIDALGGEMGRNIDKTYIQMKMLNMGKGPAVRALRAQADKAEYAS
MNMG_STRS2       CNPSIGGSAKGIVVREIDALGGEMGRNIDKTYIQMKMLNMGKGPAVRALRAQADKAEYAS
MNMG_DESRM       CNPAVGGPAKSHLVKEIDALGGQMGLTTDLAAIQMRMLNTGKGPAVYALRAQADKVKYQQ
MNMG_PELTS       CNPAVGGPAKGHLVREVDALGGEIGLNTDRASIQMRLLNTGKGPAVHALRAQADKRYYQL
MNMG_CARHZ       CNPAVGGPAKGVVVREVDALGGEMGINTDKTYIQIRMLNTGKGPAVRTLRAQADKRRYQE
MNMG_MOOTA       CNPSIGGPAKGHLVREIDALGGIMGLNIDRSRIQIRRLNSGKGPAVRALRAQADKKLYQR
MNMG_HELMI       CNPAIGGPAKGHLVREIDALGGQMGLTIDKTCIQIRLLNTGKGPAVHALRAQADKKRYQR
MNMG_SYNWW       CNPSIGGPAKAQVVREIDALGGEMALNIDKANVQIRTINTGKGPAVQALRAQADKRQYHL
MNMG_DESAP       CNPAIGGPGKSHLVREIDALGGEMGRNTDRAAIQVRMLNTGKGPAVRALRAQTDKRLYQE
MNMG_SYMTH       CNPSIGGPAKGHLVREIDALGGQMALTADATFLQMRLLNSGKGPAVQALRAQIDKRAYAW
MNMG_DESHY       CNPSLGGPAKGHLVREIDALGGQMGITADETSLQVRMLNTGKGPAVHALRIQSDKQAYHL
MNMG_ROSCS       CNPSIGGPAKGHLVREIDALGGLMGRVTDRTFIQIRLLNESKGPAVQAPRAQADKRLYAK
MNMG_ROSS1       CNPSIGGPAKGHLVREIDALGGLMGRVTDRTFIQIRLLNESKGPAVQAPRAQADKRLYAK
MNMG_CHLAA       CNPSIGGPAKGHLVREIDALGGLMGRITDRSAIQIRLLNESKGPAVQSLRAQCDKRLYAR
MNMG_DEIRA       CNPAVGGPGKSQLVFEVQALGGLMGRLADDTAIHTRMLNASKGPAVQSLRVQNERDAYAE
MNMG_DEIGD       CNPAVGGPGKSQLVFEVQALGGLMGRLADDTAIHTRVLNASKGPAVQSLRVQNERDAYAE
MNMG_THET2       CNPAVGGPGKSQLVAEVVALGGLMGRAADAAAIHTRVLNRSKGPAVQSLRVQVDRDLYAL
MNMG_THET8       CNPAVGGPGKSQLVAEVVALGGLMGRAADAAAIHTRVLNRSKGPAVQSLRVQVDRDLYAL
MNMG_MYXXD       CNPAVGGTAKGHLVRELDALGGEMGRAADQVGTHFKTLNASKGPAVQASRLLCDRDAYAV
                 *.* :*. .*. :  *:   .*      *    :   :*  :* .    *       :  

MNMG_NOSS1       IMKNIVENQENLSIRESMVTDLVLGANDE-----------------VIGVE-TYFGVAFQ
MNMG_TRIV2       IMKNIVENQENLSIRESMVTDLVLGANDE-----------------VIGVE-TYFGVAFQ
MNMG_TRIEI       IMRNIVENQENLRVRESMVTDLVLGDNEE-----------------IIGVE-TYFGVAFK
MNMG_SYNY3       VMKNIVENQPNLSIREGMVTDLVLGDNDE-----------------IQGVQ-TYFGACFG
MNMG_SYNP2       VMKNIVENQDNLVIREGMATDLVLGNNDE-----------------ICGIQ-TYFGTCFG
MNMG_MICAN       VMKGIVETQANLVIREAMATDLILGANEQ-----------------VLGVE-TYFGTCFA
MNMG_ACAM1       VMKTIVENQGNLTVREGMVTDLVLGDNDE-----------------VVGVQ-TYFGVAFR
MNMG_SYNP6       VIKQVLEQQPNLRLREGMVTDLLIGPNDE-----------------VQGVT-TYFGSSFR
MNMG_SYNE7       VIKQVLEQQPNLRLREGMVTDLLIGPNDE-----------------VQGVT-TYFGSSFR
MNMG_THEEB       VMKQVVENQPNLLVREGMVTDLVLDANDT-----------------VIGVE-TYFGVAFR
MNMG_SYNJB       VMRSVVENQPNLTIREGTVTDLVLGRNDE-----------------VVGVV-THFGTIFG
MNMG_SYNJA       VMRSVVENQPNLSIREGTVTDLVLGRNDE-----------------VVGVV-THFGSVFG
MNMG_PROM1       EMLKILQNTPNLKIREAMVTGLEIEHYPNQID--QKTPEIQERIGFIKGIK-TYFGSVFH
MNMG_PROMT       EMLKILQNTPNLKIREAMVTGLEVEHYPNQID--QKTPEIQERIGFIKGIK-TYFGSVFH
MNMG_PROMA       EMLQMLQETPNLSLREAMVTDLEIKSSPNRKK--IKEQSEEKTIGQVQGIK-TYFGSIYL
MNMG_PROM3       QMLQLLQQTANLSLREAMVTGLEVKGDPSGGG--EHWEPAQGHAAQITGVR-TYFGSIYR
MNMG_PROMM       QMLQLLQQTANLSLREAMVTGLEVKGDPSGGG--EHWEPAQGHAAQITGVR-TYFGSIYR
MNMG_SYNSC       QMLQLLQHTPNLALREAMVTGLETTVA--------------GDQQRISGIR-TYFGSVYG
MNMG_SYNPX       QMLQLLQHTPNLALREAMVTGLETTAE--------------ADQQRISGIR-TYFGSVYG
MNMG_SYNS9       QMLQLLQHTPNLALREAMVTGLEVEGE--------------EEQQRIQGVR-TYFGSVYA
MNMG_SYNPW       QMLQLLQHTPNLALREAMVTGLEIDGDPAGGG--EHWDPSQGPAARITGVR-TYFGSLYG
MNMG_SYNS3       EMLQLLHHTPNLALREAMVTGLEVDGDPE-----------PAGQARITGVR-TYFGSVYG
MNMG_SYNR3       QMLQLLQHTPNLALREAMVTGLETSGSAE------------SGDLRITGVR-TYFGSIYN
MNMG_PROMS       KMIEILQNTDNLSLKEAMITELDIAKTEQ-----IGLNSKKILKKRIKGVK-TFFGSYYS
MNMG_PROM0       KMIEILQNTDNLSLKEAMITELDIAKTEE-----IGLNSKRTVKKRIKGVR-TFFGSYYS
MNMG_PROM9       KMIEILQNTDNLSLKEAMITELDIAKTEE-----IGLNSKKIVKKRIKGVR-TFFGSYYS
MNMG_PROM2       RMIEILQNTDNLSLKEAMITELDIAKSEQ-----VGLNSKKVVKKRIKGVK-TFFGSYYS
MNMG_PROM5       RMIEILQNTDNLSLKEAMITELLIKEVET-----FTKNSK-NTTKQIKGVK-TFFGTCYS
MNMG_PROMP       RMIEILQNTDNLSLKEAMITELVIKEAET-----FSNNLK-NKTKKIKGVK-TFFGTYYY
MNMG_CHLTR       HMKRLLEQVPGLHIMQGTAEALLD------------------NGEKVLGVS-TKEGWAYL
MNMG_CHLTA       HMKRLLEQVPGLHIMQGTAEALLD------------------NGEKVLGVS-TKEGWAYL
MNMG_CHLT2       HMKRLLEQVPGLHIMQGTAEALLD------------------NGEKVLGVS-TKEGWAYL
MNMG_CHLTB       HMKRLLEQVPGLHIMQGTAEALLD------------------NGEKVLGVS-TKEGWAYL
MNMG_CHLMU       HMKQLLEQVPGLHIMQGTAEALLD------------------DGEKVLGVS-TKEGWAYS
MNMG_CHLAB       HMKRLLESSPGLHIMQGTVESLLD------------------NENVIQGVT-TKEGITYL
MNMG_CHLCV       HMKRLLESTPGLHIMQGTVESLLD------------------NENVIQGVT-TKEGITYL
MNMG_CHLFF       HMKRLLESTPGLHIMQGTVESLLD------------------KENVIQGVT-TKEGIAYL
MNMG_CHLPN       HMKRLLENTPGLHIMQATVESLLD------------------KEGVISGVT-TKEGWMFS
MNMG_PARUW       EMKHRMERVSNLDIKQGTIEDLLI------------------ENDHICGVI-TKEGISYD
MNMG_RHOBA       FIKYRIETQDNLDLRQETVEDLITEPIADGQDR--------LANQRVIGVR-VRGDAVYH
MNMG_OPITP       RLKHTLELQPHLQLFQATVTGLI------------------FDGAKVIGCR-TNLDIEFY
MNMG_AQUAE       YMKKVCENQENLYIKQEEVVDIIV------------------KNNQVVGVR-TNLGVEYK
MNMG_ECOLI       AVRTALENQPNLMIFQQAVEDLIV------------------ENDRVVGAV-TQMGLKFR
MNMG_ECOL6       AVRTALENQPNLMIFQQAVEDLIV------------------ENDRVVGAV-TQMGLKFR
MNMG_ECO24       AVRTALENQPNLMIFQQAVEDLIV------------------ENDRVVGAV-TQMGLKFR
MNMG_ECODH       AVRTALENQPNLMIFQQAVEDLIV------------------ENDRVVGAV-TQMGLKFR
MNMG_ECOL5       AVRTALENQPNLMIFQQAVEDLIV------------------ENDRVVGAV-TQMGLKFR
MNMG_ECOHS       AVRTALENQPNLMIFQQAVEDLIV------------------ENDRVVGAV-TQMGLKFR
MNMG_ECOLC       AVRTALENQPNLMIFQQAVEDLIV------------------ENDRVVGAV-TQMGLKFR
MNMG_SHIBS       AVRTALENQPNLMIFQQAVEDLIV------------------ENDRVVGAV-TQMGLKFR
MNMG_SHISS       AVRTALENQPNLMIFQQAVEDLIV------------------ENDRVVGAV-TQMGLKFR
MNMG_ECOUT       AVRTALENQPNLMIFQQAVEDLIV------------------ENDRVVGAV-TQMGLKFR
MNMG_ECOK1       AVRTALENQPNLMIFQQAVEDLIV------------------ENDRVVGAV-TQMGLKFR
MNMG_ECOSM       AVRTALENQPNLMIFQQAVEDLIV------------------ENDRVVGAV-TQMGLKFR
MNMG_ECO57       AVRTALENQPNLMIFQQAVEDLIV------------------ENDRVVGAV-TQMGLKFR
MNMG_SHIDS       AVRTALENQPNLMIFQQAVEDLIV------------------ENDRVVGAV-TQMGLKFR
MNMG_SHIFL       AVRTALENQPNLMIFQQAVEDLIV------------------ENDRVVGAV-TQMGLKFR
MNMG_SHIF8       AVRTALENQPNLMIFQQAVEDLIV------------------ENDRVVGAV-TQMGLKFR
MNMG_SALCH       AVRTALENQPNLMIFQQAVEDLIV------------------ENDRVVGAV-TQMGLKFR
MNMG_SALTY       AVRTALENQPNLMIFQQAVEDLIV------------------ENDRVVGAV-TQMGLKFR
MNMG_SALPB       AVRTALENQPNLMIFQQAVEDLIV------------------ENDSVVGAV-TQMGLKFR
MNMG_SALPA       AVRTALENQPNLMIFQQAVEDLIV------------------ENDRVVGAV-TQMGLKFR
MNMG_SALTI       AVRIALENQPNLMIFQQAVEDLIV------------------ENDRVVGAV-TQMGLKFR
MNMG_CITK8       AVRTALENQPNLMIFQQAVEDLIV------------------ENDRVVGAV-TQMGLKFR
MNMG_SALAR       AVRTALENQPNLMLFQQAVEDLIV------------------ENDRVVGAV-TQMGLKFR
MNMG_ENT38       AVRTALENQPNLMIFQQAVEDLIV------------------ENDRVVGAV-TQMGLKFR
MNMG_KLEP7       AVRTALENQPNLMIFQQAVEDLIV------------------ENDRVVGAV-TQMGLKFR
MNMG_CROS8       AVRTALENQPNLMIFQQAVDDLIV------------------ENDRVVGAV-TQMGLKFR
MNMG_PECAS       AIRTALENQPNLTIFQQAVDDLIV------------------ENDRVVGAV-TQMGLKFR
MNMG_YERPE       AVRTALENQPNLMIFQQPVEDLIV------------------ENDRVVGAV-TQMGLKFR
MNMG_YERPY       AVRTALENQPNLMIFQQPVEDLIV------------------ENDRVVGAV-TQMGLKFR
MNMG_YERPA       AVRTALENQPNLMIFQQPVEDLIV------------------ENDRVVGAV-TQMGLKFR
MNMG_YERPN       AVRTALENQPNLMIFQQPVEDLIV------------------ENDRVVGAV-TQMGLKFR
MNMG_YERPP       AVRTALENQPNLMIFQQPVEDLIV------------------ENDRVVGAV-TQMGLKFR
MNMG_YERPS       AVRTALENQPNLMIFQQPVEDLIV------------------ENDRVVGAV-TQMGLKFR
MNMG_YERP3       AVRTALENQPNLMIFQQQVEDLIV------------------ENDRVVGAV-TQMGLKFR
MNMG_YERE8       AVRTALENQPNLMIFQQPVEDLIV------------------ENDRVVGAV-TKMGLKFR
MNMG_SERP5       AVRTALENQPNLMIFQQPVEDLIV------------------ENDRVVGAV-TQMGLKFR
MNMG_PHOLL       AVRMALENQPNLMIFQQPVEDLIV------------------ENDTVTGAV-TRMGLKFR
MNMG_SODGM       AVRGALENQPNLMIFQQAVEDLIM------------------EGDRVVGAV-TQIGLKFR
MNMG_VIBCH       YVRNVLENTPNLTLFQQAVDDVIV------------------EHDHIRGVV-TQMGLKFH
MNMG_VIBC3       YVRNVLENTPNLTLFQQAVDDVIV------------------EHDHIRGVV-TQMGLKFH
MNMG_VIBCB       YVRNALENAPNLTLFQQSVDDLIV------------------DQDRVVGVV-TQMGLKFQ
MNMG_VIBPA       YVRNALENAPNLTLFQQSVDDLIV------------------EQDRVVGVV-TQMGLKFH
MNMG_VIBVU       YVRDFLENAPNLTLFQQAVDDLIV------------------EQDQVRGVI-TQMGLKFH
MNMG_VIBVY       YVRDFLENAPNLTLFQQAVDDLIV------------------EQDQVRGVI-TQMGLKFH
MNMG_ALIF1       YVRSVLENQPNLTLFQQAVDDLII------------------ENDKVMGAV-TQMGLKFR
MNMG_PHOPR       AVREVLENQPNLMLFQQAVDDLIV------------------ENDRVIGVV-TEMGLKFR
MNMG_AERHH       VVRQMLENYPNLKIFQQACDDLIM------------------DGDRVAGVV-TQSGIRIS
MNMG_AERS4       VVRQMLENYPNLKIFQQACDDLIM------------------DGDRVAGVV-TQSGIRIS
MNMG_COLP3       YVRNTLENQENLTIFQQPCDDLIL------------------ENDRVVGVS-TQMGLKFK
MNMG_PSEA6       AIRDIVEHQDNLTLFQQSCDDLIV------------------ENDQVTGVV-TQMGLKFR
MNMG_IDILO       AIRYALETQPNLSIFQQGCDDLIV------------------ENDRVTGVV-TQMGLKFT
MNMG_PSET1       AIQTTLQNQDNLKIFQQSCDDLIV------------------ENDRVTGVV-TQMGLRFS
MNMG_SHEB5       KIQNILQNQPNLRIFQQAVDDLIV------------------ENHQVVGVV-TQMGLAFE
MNMG_SHEB8       KIQNILQNQPNLRIFQQAVDDLIV------------------ENHQVVGVV-TQMGLAFE
MNMG_SHEB9       KIQNILQNQPNLRIFQQAVDDLIV------------------ENHQVVGVV-TQMGLAFE
MNMG_SHEPC       KIQNILQNQANLRIFQQAVDDLIV------------------ENDRVVGVV-TQMGLAFE
MNMG_SHESW       KIQNILQNQANLRIFQQAVDDLIV------------------ENDRVVGVV-TQMGLAFE
MNMG_SHESM       KIQNILQNQPNLRIFQQAVDDLVV------------------ENDRVVGVI-TQMGLAFE
MNMG_SHESR       KIQNILQNQPNLRIFQQAVDDLVV------------------ENDRVVGVI-TQMGLAFE
MNMG_SHESA       KIQNILQNQANLRIFQQAVDDLVV------------------DNDRVVGVV-TQMGLAFE
MNMG_SHEON       KIQNILQNQANLRIFQQAVDDIVV------------------ENDHVVGVV-TQMGLAFE
MNMG_SHEDO       KIQQILQSQPNLRIFQQAVDDLVV------------------ENNQVVGVV-TQMGLAFE
MNMG_SHEFN       KIQHILQNQPNLRIFQQAVDDLVV------------------ENDKVIGVV-TQMGLAFE
MNMG_SHEHH       KIQEILQHQTNLRIFQQAVDDLVV------------------ENNKVIGVV-TQMGLAFE
MNMG_SHEPA       KIQEILQHQANLRIFQQAVDDLVV------------------ENGKVVGVV-TQMGLAFE
MNMG_SHESH       KIQEILQNQPNLRLFQQAVDDLIV------------------ENGKVTGVV-TQMGLAFE
MNMG_SHEWM       KIQEILQNQPNLRLFQQAVDDLIV------------------ENGRVTGVV-TQMGLAFE
MNMG_SHELP       KIQQILQNQPNLRLFQQAVDDLIV------------------GNDRVIGVV-TQMGLAFE
MNMG_SHEAM       KILNILQHQPNLRIFQQAVDDLVV------------------ENGRVIGAV-TQMGLAFE
MNMG_PSYIN       AIREKLENQENLKIFQQEVEDLVV------------------ENDRVSGVV-TKMGIKFS
MNMG_ACTP2       AVRTALENQPNLDIFQQEVVDILV------------------ENNRAVGAV-TKMGLTFK
MNMG_ACTPJ       AVRTALENQPNLDIFQQEVVDILV------------------ENNRAVGAV-TKMGLTFK
MNMG_HAEDU       SVRTALENQQNLAIFQQEVVDILV------------------ENHRASGVV-TKMGLTFK
MNMG_HAEIN       AVRTALENQPNLDIFQQEATDILI------------------EQDRVTGVS-TKMGLTFR
MNMG_HAEIG       AVRTALENQPNLDIFQQEATDILI------------------EQDRVTGVS-TKMGLIFR
MNMG_HAEIE       AVRTALENQPNLDIFQQEATDILI------------------EQDRVTGVS-TKMGLIFR
MNMG_HAEI8       AVRTALENQPNLDIFQQEATDILI------------------EQDRVTGVS-TKMGLIFR
MNMG_HAES1       VVRIALENQPNLDIFQQEVTDIIL------------------EKDSVTGIE-TKMGLKFR
MNMG_HISS2       VVRIALENQPNLDIFQQEVTDIIL------------------EKDSIAGVE-TKMGLKFR
MNMG_MANSM       AVKVALENQPNLDIFQQEATDILI------------------EQDRVTGVA-TRMGLKFK
MNMG_PASMU       AVRIALENQENLDIFQQEVTDIIL------------------DQDRVCGVV-TKMGLKFH
MNMG_ACTSZ       AVRQALENQPNLDIFQQEATDILL------------------ERERAAGVS-TKMGLTFR
MNMG_HYDCU       AIRMRLENQVNLTIFQQSVEDLIL------------------EGDKVVGAE-TKMGLKFY
MNMG_ACIAC       AIRRMLENQPNLWLFQQAVDDLMV------------------EGDRVVGAI-TQVGIRFR
MNMG_ACISJ       AIRRMLENQPNLWLFQQAVDDLMV------------------EGDRVVGAV-TQVGIRFR
MNMG_VEREI       AIRRRLENQPGLWLFQQAVDDLML------------------EGDRVVGAV-TQVGVVFC
MNMG_POLNA       AIRRMIENQPNLWLFQQAVDDLMV------------------EGDRVVGAV-TQVGIKFR
MNMG_POLSJ       AIRRRLENQPNLWLFQQAVDDLMV------------------EGDRVVGAV-TQVGIRFR
MNMG_RHOFT       AIRRRLENQPNLWLFQQAVDDLMV------------------EGDRVVGAV-TQAGIKFR
MNMG_LEPCP       AIRQRLENQPHLWLFQQAVDDLMV------------------EGDRVVGAV-TQVGIRFR
MNMG_METPP       AIRRRLENQPRLWLFQQAVDDLIV------------------EGDRVIGAV-TQVGVRFR
MNMG_BURCA       AIRHRLENQPNLWLFQQAVDDLMV------------------EGDRVVGAV-TQIGIRFR
MNMG_BURCH       AIRHRLENQPNLWLFQQAVDDLMV------------------EGDRVVGAV-TQIGIRFR
MNMG_BURCC       AIRHRLENQPNLWLFQQAVDDLMV------------------EGDRVVGAV-TQIGIRFR
MNMG_BURCM       AIRHRLENQPNLWLFQQAVDDLMV------------------EGDRVVGAV-TQIGIRFR
MNMG_BURA4       AIRHRLENQPNLWLFQQAVDDLMV------------------EGDRVVGAV-TQIGIRFR
MNMG_BURL3       AIRHRLENQPNLWLFQQAVDDLMV------------------EGDRVVGAV-TQIGIRFR
MNMG_BURVG       AIRHRLENQPNLWLFQQAVDDLMV------------------EGDRVVGAV-TQIGIRFR
MNMG_BURMA       AIRRRLENQPNLWLFQQAVDDLMV------------------EGDRVVGAV-TQVGVRFR
MNMG_BURM9       AIRRRLENQPNLWLFQQAVDDLMV------------------EGDRVVGAV-TQVGVRFR
MNMG_BURP0       AIRRRLENQPNLWLFQQAVDDLMV------------------EGDRVVGAV-TQVGVRFR
MNMG_BURM7       AIRRRLENQPNLWLFQQAVDDLMV------------------EGDRVVGAV-TQVGVRFR
MNMG_BURMS       AIRRRLENQPNLWLFQQAVDDLMV------------------EGDRVVGAV-TQVGVRFR
MNMG_BURP1       AIRRRLENQPNLWLFQQAVDDLMV------------------EGDRVVGAV-TQVGVRFR
MNMG_BURPS       AIRRRLENQPNLWLFQQAVDDLMV------------------EGDRVVGAV-TQVGVRFR
MNMG_BURP6       AIRRRLENQPNLWLFQQAVDDLMV------------------EGDRVVGAV-TQVGVRFR
MNMG_BURTA       AIRRYLENQPNLWLFQQAVDDLMV------------------EGDRVVGAV-TQVGVRFR
MNMG_PARXL       AIRHRLENQPNLWLFQQAVDDLMV------------------EGDRVVGAV-TQVGIRFR
MNMG_CUPNH       AIRTRLENQPNLMLFQQAVDDLMV------------------EGDRVVGAM-TQVGIAFR
MNMG_CUPPJ       AIRTRLENQPNLMLFQQAVDDLLV------------------EGDRVVGAV-TQVGIAFR
MNMG_CUPMC       AIRTRLENQPNLMLFQQAVDDLMV------------------EGDRVVGAR-TQVGIDFR
MNMG_RALSO       AIRHRLENQPNLMLFQQAVEDLLV------------------EGDRVVGAV-TQVGVRFR
MNMG_JANMA       AIRSRLENQPNLWLFQQAVDDLLV------------------EGDRVIGAV-TQVGIKFY
MNMG_HERAR       AIRSRLENQPNLWLFQQGVDDLLV------------------EGDRVVGAV-TQAGIQFR
MNMG_BORBR       AIRARLENQPNLWLFQQAVDDLMV------------------QGDQVVGAV-TQIGLRFR
MNMG_BORPA       AMRARLENQPNLWLFQQAVDDLMV------------------QGDQVVGAV-TQIGLRFR
MNMG_BORPE       AIRAQLENQPNLWLFQQAVDDLMV------------------QGDQVVGAV-TQIGLRFR
MNMG_BORPD       AIRSRLENQPGLWIFQQAVDDLMV------------------EGDRVVGAV-TQIGLKFR
MNMG_BORA1       AIRHRLENQENLWLFQQSVEDLIV------------------EGDKVVGAV-TQIGLKFR
MNMG_AZOSB       AIRKRLENQPNLWLFQQAVDDLTV------------------AGDRVTGVV-TQIGLRFE
MNMG_AROAE       AIRHRLENQPNLWLFQQAVDDLTV------------------SGDRVTGVV-TQIGLAFE
MNMG_DECAR       AIRTRLENQPNLTIFAEACDDLIV------------------EGDKVCGAV-TQLGIRFM
MNMG_METFK       AIRRRLENQPNLWLFQQAVDDIIL------------------EGERVAGVV-TQLGLRFE
MNMG_THIDA       AIRQRLENQPGLTLFQQAVDDLVL------------------DGARVVGVK-TQLGILFE
MNMG_NITMU       AIRQRLESQPNLWLFQQGVDDLVL------------------EGERVAGVV-TQLGIRFN
MNMG_NEIG1       SIREMLENQENLDLFQQAVEDVTL------------------EGERISGVI-TAMGVEFK
MNMG_NEIMA       AIREMLENQENLDLFQQAVEDVTL------------------DGERISGVI-TAMGVEFK
MNMG_NEIMB       AIREMLENQENLDLFQQAVEDVTL------------------DGERISGVI-TAMGVEFK
MNMG_NEIM0       AIREMLENQENLDLFQQAVEDVTL------------------DGDRISGVI-TAMGVEFK
MNMG_NEIMF       TIREMLENQENLDLFQQAVEDVTL------------------DGERISGVV-TAMGVEFK
MNMG_CHRVO       AIREMLENQPNLTLFQQPVDDLLI------------------EGDRVVGAI-TAIGITFR
MNMG_POLAQ       AIRRRLENQPNLSLFQAAVDDLLV------------------KGDEVQGVV-TQMGLEFM
MNMG_ACIBT       AIRETLENQANLDIFQQAADDLIV------------------EGDTVKGVV-TQMGIRFD
MNMG_ACIBY       AIRETLENQANLDIFQQAADDLIV------------------EGDTVKGVV-TQMGIRFD
MNMG_ACIAD       AIRHTLENQANLDIFQQAADDLIV------------------EGDTVKGVV-TQMGIRFD
MNMG_PSYA2       AIRHTLENQPNLDIFQQAADDILV------------------ENGRATAVV-TATGIIFN
MNMG_PSYCK       AIRHTLENQPNLDIFQQAADDILV------------------ENGRATAVV-TATGIIFN
MNMG_PSYWF       AIRHTLENQPNLDLFQQGADDILV------------------ENGKACAVV-TATGIIFR
MNMG_PSEAE       AIRHTLENQPNLWIFQQACDDLIV------------------EQDQVRGVV-TQMGLRFH
MNMG_PSEAB       AIRHTLENQPNLWIFQQACDDLIV------------------EQDQVRGVV-TQMGLRFH
MNMG_PSEA7       AIRHTLENQPNLWIFQQACDDLIV------------------EQDQVRGVV-TQMGLRFH
MNMG_PSEPU       VVREILENQPNLWIFQQNCDDLIV------------------EQDQVKGVV-TQMGLRFF
MNMG_PSEPK       VVREILENQPNLWIFQQSCDDLIV------------------EQDQVKGVV-TQMGLRFF
MNMG_PSEP1       VVREILENQPNLWIFQQSCDDLIV------------------EQDQVKGVV-TQMGLRFF
MNMG_PSEPG       VVREILENQPNLWIFQQSCDDLIV------------------EQDQVKGVV-TQMGLRFF
MNMG_PSEPW       VVREILENQPNLWIFQQSCDDLIV------------------EQDQVKGVV-TQMGLRFF
MNMG_PSEE4       VVREILENQPNLWIFQQSCDDLIV------------------EQDQVKGVV-TQMGLRFF
MNMG_PSEF5       AVREILENQPNLWIFQQAADDLIV------------------EQDQVRGVV-TQMGLRFF
MNMG_PSEPF       AVREILENQPNLWIFQQAADDLIV------------------EQEQVRGVV-TQMGLRFF
MNMG_PSE14       AIRETLENQPNLWIFQQACDDLIV------------------EQDQVRGVV-TQMGMRIF
MNMG_PSEU2       AIRETLENQPNLWIFQQACDDLIV------------------DQDQVRGVV-TQMGMRIF
MNMG_PSESM       AIREILENQPNLWIFQQACDDLIV------------------EQDQVRGVV-TQMGLRIL
MNMG_PSEMY       AVREILENQANLWIFQQAADDLIV------------------ENAQVKGVV-TQMGLRFH
MNMG_PSEU5       AIRELLENQPNLWIFQQAADDLIV------------------EQNEVRGVV-TQMGLRFL
MNMG_ALCBS       AIRGTLENQPNLTLFQQAVDDLVV------------------ENGRCVGVV-TNMGLRFM
MNMG_HAHCH       AIREILENQPNLTIFQQAADDLIM------------------QGDHVAGVV-TQMGLRFH
MNMG_MARMS       AIRHKLENQENLWLFQQSAEDLIV------------------ENGAARGVI-TQTGIRFN
MNMG_SACD2       AVREILENQPNLDIFQQAADDLVV------------------EGERVTGVT-TQMGVTFK
MNMG_CHRSD       AIRGMLENQPNLTLFQQAADDLIV------------------ENDTVRGVV-TQTGIRVF
MNMG_MARHV       AIRHMLENQPNLTLFQQAADDLIV------------------ENDQVVGVV-TQTGIRFN
MNMG_ALKEH       AIRRAVENQPRLALFQQSVDDLIV------------------EGGRVTGVV-TGMGLRFR
MNMG_NITOC       VVRKALEQQSCLSLFQQAVTDLVV------------------KGERVVGVR-TQLGLTFY
MNMG_METCA       AVREGLSAQENLSLFQQTVVDLIV------------------EGRRAAGVV-TQMGLKFR
MNMG_XANAC       AIRCIVEAQPNLTVFQAAVDDLIIHHGA-------------SEADSVRGVI-TQTGLRFQ
MNMG_XANC5       AIRCIVEAQPNLTVFQAAVDDLIIHNGT-------------SEADSVRGVI-TQTGLRFQ
MNMG_XANOR       AIRCIVQAQPKLTVFQAAVDDLIIHNGT-------------CEADSVRGVI-TQTGLRFE
MNMG_XANOM       AIRCIVQAQPKLTVFQAAVDDLIIHNGT-------------CEADSVRGVI-TQTGLRFE
MNMG_XANCP       AIRRIVEAQPNLTVFQAAVDDLIIHNGA-------------AEGDSVRGVI-TQTGLRFE
MNMG_XANC8       AIRRIVEAQPNLTVFQAAVDDLIIHNGA-------------AEGDSVRGVI-TQTGLRFE
MNMG_XANCB       AIRRIVEAQPNLTVFQAAVDDLIIHNGA-------------AEGDSVRGVI-TQTGLRFE
MNMG_XYLFA       AIRQMIEGQARLNIFQAEVDDLLF------------------EGDTVCGAI-THTGLHFK
MNMG_XYLFT       AIRQMIEGQARLNIFQAEVDDLLF------------------EGDTVCGAI-THTGLHFK
MNMG_COXBU       AIHHALENQPHLWLFQQGVDDLII------------------QNNRAAGVV-TQMGLAFY
MNMG_COXBN       AIHHALENQPHLWLFQQGVDDLII------------------QNNRAAGVV-TQMGLAFY
MNMG_COXBR       AIHHALENQPHLWLFQQGVDDLII------------------QNNRAAGVV-TQMGLAFY
MNMG_LEGPC       AIRTQLQSQANLTIFQQAVDDLKI------------------EGGLVTGVV-TQMGLTLK
MNMG_LEGPA       AIRTQLQSQANLTIFQQAVDDLKI------------------EGGLVTGVV-TQMGLTLK
MNMG_LEGPL       AIRTQLQSQANLTIFQQAVDDLKI------------------EGGLVTGVV-TQMGLTLK
MNMG_LEGPH       AIRTQLQSQANLTIFQQAVDDLKI------------------EGGLVTGVV-TQMGLTLK
MNMG_NITEU       AIRRRLEAQPDLLLLQSTVDDLLLN------------------GDKITGVV-THLGMTFS
MNMG_NITEC       AIRKRLEAQPNLLILQSTVDDLLLL------------------DDKITGVA-THLGITFS
MNMG_FRATF       AINSLINNQENLDIFQDSVDDLVV------------------ENNTVCGAI-TKTGITFR
MNMG_FRATH       AINSLINNQENLDIFQDSVDDLVV------------------ENNTVCGAI-TKTGITFR
MNMG_FRATO       AINSLINNQENLDIFQDSVDDLVV------------------ENNTVCGAI-TKTGITFR
MNMG_FRATW       AINSLINNQENLDIFQDSVDDLVV------------------ENNTVCGAI-TKTGITFR
MNMG_FRATT       AINSLINNQENLDIFQDSVDDLVV------------------ENNTVCGAI-TKTGITFR
MNMG_FRAT1       AINSLINNQENLDIFQDSVDDLVV------------------ENNTVCGAI-TKTGITFR
MNMG_FRATN       AINSLINNQENLDIFQDSVDDLVV------------------ENNTVCGAI-TKTGITFR
MNMG_FRAP2       AINSLLNDQENLDIFQDSVDDLVV------------------ENDTVCGVI-TKTGIIFK
MNMG_VESOH       EIRYALENQDNLSLFQQSVDDLII------------------KGDQIKGVV-TQMGLALM
MNMG_RUTMC       QIRYTLENQDNLSLFQQAVDDLII------------------EHDQIKGVV-TQMGLAFM
MNMG_DICNV       AVRALVEKQEHLRVFQTEVSGILL------------------NGETVIGVS-SQHKIDFH
MNMG_BLOFL       AIRHALEIQDSLFILQASVEDLII------------------KQNKVIGVVIPKIAIEIY
MNMG_BLOPB       AIRSILEYQKFLLVIQASVEDLIV------------------SGNKIVGVITPKLGMKFS
MNMG_BAUCH       AVYNMLKNTNNLLVLQQFVENLII------------------KNNNVIGVI-SKAKDKFY
MNMG_BUCAI       TVKKILKKQNNLLILEAEVKDLIF------------------KNYSVVGVL-TQNEINFY
MNMG_BUCAP       NIKKLLKKELNLLILETEVKDLIV------------------KNYQVIGVL-TQSNMSFY
MNMG_BUCBP       TIKKTLLFQENLLVLQAEVDDVIV------------------SNYKIMGVI-TQTKIKFF
MNMG_WIGBR       LIQKILSNQKNLYLLQQEVIDILV------------------EKNKIKGVV-TNAGLIIK
MNMG_BUCCC       NMNYFLNNQKNLTIFEQEVSDIII------------------KNYQVQGII-TSDGKIFK
MNMG_HALHL       AARRALDALPGLALLQDAAEELLV------------------ADQRCYGVR-TESGATLH
MNMG_RHIME       AMQREISGIENLSVIEGDAFDLLTED------------------GVVCGTA-MKDGRIFR
MNMG_SINMW       AMQREIASIENLDVAEGDAFDLQTED------------------GVVCGAV-MKDGRSFR
MNMG_RHIEC       AMLAAIEATPGLDIIEGDAFDLDVLD------------------GRVAGVI-MKDGRRLQ
MNMG_RHIL3       AMLAAIEATPDLDIIEGDAFDLDVVD------------------GCVAGVI-MKDDRTLK
MNMG_AGRFC       AMQREIDAMDNLTIIEGDAFDIEMDN------------------DRVAAVI-MKNGSRIP
MNMG_BARHE       AIQKLLQKQDNLILIEDEVIDLIVKD------------------KSISGVI-LKKQGILP
MNMG_BARQU       AIQKFLQEQDNLILIEDEAVDLIVKD------------------NCVSGVV-LKKQGELF
MNMG_BART1       AIQKFLKEQENLTLVEDEVIDLIVKD------------------HCVSGVI-LKKQGTIF
MNMG_BARBK       AIQKLLREQDNLFIIEDEVVDIIVKN------------------NRVSGVF-LKNQGNIF
MNMG_BRUAB       AMQQMITEQENLTVVEGGAADLVCDG------------------ERISGVT-LADGRVLK
MNMG_BRUA2       AMQQMITEQENLTVVEGGAADLVCDG------------------ERISGVT-LADGRVLK
MNMG_BRUC2       AMQQMITEQENLTVVEGGAADLVCDG------------------ERISGVT-LADGRVLK
MNMG_BRUSU       AMQQMITEQENLTVVEGGAADLVCDG------------------ERISGVT-LADGRVLK
MNMG_BRUSI       AIQQMITEQENLTVVEGGAADLVCDG------------------ERISGVT-LADGRVLK
MNMG_BRUME       SMQQMITEQENLTVVEGGAADLVCDG------------------ERISGVT-LADGRVLK
MNMG_BRUO2       AMQQIITEQENLTVVEGGAADLVCDG------------------ERISGVT-LADGRVLK
MNMG_BRUA4       AMQKMIAAQDNLFVVEGGAHDLREEH------------------GRITGVV-LSDGRTLS
MNMG_RHILO       AMQEAIRQQNDLDVVEGEVLDFEINE------------------GRITAVL-LAGGRRLA
MNMG_CHESB       AMQAVISEQENLQVIEAEVHTLGMEH------------------GRITHVG-LSGDSQIN
MNMG_BRASB       AMQAAIRETANLTVVEGEADQLIVAD------------------GQITGLR-LADGRPLA
MNMG_BRASO       AMQSAIRETTNLAVVEGEADDLIVVD------------------GRVTGIK-LADGRSLA
MNMG_BRADU       AMQAAIRETEGLSVIEGEADELIVVE------------------GRVTGLR-LADGREFG
MNMG_NITHX       AMQAEIREAANLVVIEGEADDLIVAD------------------GRIAGIR-LIDSRAFK
MNMG_NITWN       AMQAAIRETANLEVIDGEADDLIVSG------------------GRIAGVR-LTDGRRIK
MNMG_RHOPS       AMQAAIRATVHLSVIEGEADALLSAD------------------GRVTGIR-LADGREFA
MNMG_RHOP2       AMQAAIRATANLRVIEGEADTLLNEA------------------GRVTGIR-LADGRELV
MNMG_RHOPA       AMQTAIQGFPNLSVIEGEADALLWQD------------------GRVSGIR-LGDGREFA
MNMG_RHOP5       AMQAAIRAIANLTVIEAEADDLLTAD------------------GRITGIR-LADGREFS
MNMG_RHOPB       AMQALILATPHLSVVEAEADDLLTSD------------------GRITGIR-LADGRELG
MNMG_AZOC5       AMQVALAAQPNLEIVEGEADDLLVTE------------------GRITGLA-LTDGRTFG
MNMG_METPB       AMQAAVAETPGLTVIEGEADDLIVEA------------------GRVAGAM-LADGRRLA
MNMG_METRJ       AMQTAVAETAGLTVVAGACEDLAFDAE-----------------GRLCGLV-LADGRTLA
MNMG_METS4       AMQEALAATPNLSLIEGEAHDLAVVE------------------GRVTGIV-LADGRALP
MNMG_BEII9       AMQAEIQAVNGLDVIEGEAEGLCFDG------------------EKIAGV--LVGVETLA
MNMG_PARL1       AMQEAILNHRNLEVIEGGVSDLIVED------------------GHVAGVI-AEDGRQFR
MNMG_RHORT       AVRAILADQPGLTLAALAIEDLLIGND-----------------GRCAGVI-DAEGGVHR
MNMG_MAGSA       AMRAALDETENLSLLEGSAEDLVITD------------------GRVAGVV-LADGSTIA
MNMG_CAUVC       AMQAELFSTGNLDIIAAAAEDLIVED------------------GKVAGAV-DAAGQAYR
MNMG_CAUSK       AMQAELFSHVNLDVVAIAVEDLIVED------------------GVVAGAI-DGEGAIYR
MNMG_MARMM       AMQSELSGQANLEIRAAAIEDLMFEG------------------ERCVGAM-DADGHAYH
MNMG_HYPNA       AMQSELADYPNLTIIEDGAEDLIVED------------------GLIRGVV-GLTGQRYG
MNMG_GLUOX       AIQDLLAATPNLTILEGAAGDLIEEN------------------GRITGVI-CEDGREFR
MNMG_GLUDA       AIQDLLAETANLDIAEGAAGDLIVDDA-----------------GQAAGVV-CEDGRQFR
MNMG_GRABC       AVQDILHTTPHLSIIEGSVEDLITSSG---------------TQQTVQGVI-LQDGRHLS
MNMG_ACICJ       AVQALLAAQDGLTILEGEAADLELTAD-----------------GALAAVI-TGAGGRIA
MNMG_RUEPO       AMQEEMRNRPGLTIVEGEVTDFRMQG------------------DRVAGVV-LADGSEIA
MNMG_RUEST       EMLRATEAQSNLDIIEGEVVDFLMESP-----------------TRVRGII-LDDQSEIR
MNMG_ROSDO       RMLEATDQQQNLDIIVGEAVDFVMDG------------------ERVIGVV-LQDDAEIL
MNMG_DINSH       EMLAEMESLPNLRILEGEVADLITSG------------------TRIEGVC-LADGSEVT
MNMG_RHOS1       AVQRLLAEQPGLTIIEGEVVDLQVNG------------------GRVQGVS-LADGTSVG
MNMG_CERS4       AVQRLLAAQPGLTVIEGEVVDLQVNG------------------GRVQGVS-LADGTSVW
MNMG_CERS5       AMQRFLLEQPGLDVVEGEVVDLLLDQ------------------GTATGVL-LADGTRLD
MNMG_PARDP       AAAKIVAGQDGLSLILGEAAELLHER------------------GQVTGLR-LADDSELQ
MNMG_JANSC       AIQDHMRNVTELTVIEGEVADVIVES------------------ETVCGVS-FTDGQSIS
MNMG_NOVAD       AIQKMIAAQPDLHVVGGEVAALRLE------------------QGRVTGVD-LADGTALA
MNMG_ERYLH       AVQAIVATQENLTVVPGEVAALRFE------------------GARVTGIE-LADGTALS
MNMG_SPHAL       AIQTLLAAEEGITVVAGEAAALRLSN-----------------GGRIAGLD-LADGTALT
MNMG_SPHWW       AIHDLLAELPSLEIVEGSAERLLLDDV----------------SRGTSGLV-LADGRELK
MNMG_ZYMMO       AIQTALKEQAHLTIIEGMAESFQMD------------------KGKVKAVL-LADGRPLK
MNMG_ANAMM       AMQDIVLGYKNLEVLEASVIDFSTDNE--------------AGSPCVASVT-LSCGKVLH
MNMG_ANAPZ       TMRDMVLHYENLTVISEEVVDFTVDGV--------------EERPQISSVL-LSNGELIK
MNMG_EHRCJ       TMQEIILNYPNLTVLEASVEDFTITQD--------------NQKDSVKAVI-TSEQHTIY
MNMG_EHRCR       TMQDIILNYPNLTVLEASVEDFTITEK--------------DEKFTVETVI-TSDQQVIY
MNMG_EHRRG       AMQNSILNYPNLTVLEASVENFTTTDN--------------QELPTINSVI-TADQEVIY
MNMG_EHRRW       AMQNSILNYPNLTVLEASVENFTTTDN--------------QELPTINSVI-TADQEVIY
MNMG_WOLPM       AIQEIILNYNNLTVKEESVDDFLIESNN-------------NGELCIKAVI-TSSGEHIL
MNMG_WOLTR       AIQEIILNHDNLTVKEESVDDFLIESNS-------------NGEPYIKAII-TSSGKQIL
MNMG_NEOSM       AVLELLTKYEKLSILEDHITDLIIEND------------------RLMGVV-GEKTGTIK
MNMG_RICRO       AMYQILTNYPNLDILYGKVEDIEIKSS------------------KIEAVI-LNNGSKIL
MNMG_RICRS       AMYQILTNYPNLDILYGKVEDIEIKSS------------------KIEAVI-LNNGSKIL
MNMG_RICCN       AMYQILTNYPNLDILYGKVEDIEIKSS------------------KIEAVI-LNNGSKIL
MNMG_RICM5       AMYQILTNYPNLDILYGKVEDIEIKSS------------------KIEAVI-LNNGSKIL
MNMG_RICFE       AMCQILTNYPNLDILYGKVEDIEIKSS------------------KVEAVI-LNNDSKIL
MNMG_RICAH       AMYQILTNYPNLDILYGKVEDIEIKSS------------------KVAAIV-LNNDSKIP
MNMG_RICCK       AMYQILTNYPNLNILYGKVEDIEIKSS------------------KVKAVV-LNDGSKIP
MNMG_RICB8       AMYQILTNYPNLEILYAKVEDIEIKSS------------------EIKAVI-LNNGSKIP
MNMG_RICBR       AMYQILTNYPNLEILYAKVEDIEIKSS------------------EIKAVI-LNNGSKIP
MNMG_RICPR       VMYQILTNYRNLDILYAKVEDIQIKSS------------------KVEAVI-LSNGSKIF
MNMG_RICTY       VMYQILTNYRNLDILYGKVEDIQIKSS------------------KVEAVI-LNNGIKIF
MNMG_ORITB       AMYSTIMNYPNLTTIFASVEDIKVIAN------------------KVTAVI-VN-GKEIY
MNMG_PELUB       YMQEKLLNYCNLSVFSDPVIKFIFNKN------------------TISGFE-TNSGKKIL
MNMG_KORVE       KMREVLESEPNLKIKQAEVADLIVEDVSDPTHP--------ERMKIARGIK-LRDGRTVG
MNMG_SOLUE       RMREVLEAEPNLRIKQAEVAALTFDAV-----------------RRVNGVL-LRDGRTIP
MNMG_MAGMM       NMKKILDACANLEIKQAEVVELIIKNS------------------CVVGVK-TDWNEVYS
MNMG_CAMJE       IARNKLLKLPNLEISQEQASVLIVE-NDE-----------------VKGVK-TNLENIYF
MNMG_CAMJJ       IARNKLLKLPNLEISQEQASVLIVE-NDE-----------------VKGVK-TNLENIYF
MNMG_CAMJR       IARNKLLKLPNLEISQEQASVLIVE-NDE-----------------VKGVK-TNLENIYF
MNMG_CAMJ8       IARNKLLKLPNLEISQEQASVLIVE-NDE-----------------VKGVK-TNLENTYF
MNMG_CAMJD       IARNKLLKLPNLEISQEQVSALIVE-NDK-----------------VKGVK-TNLENIYF
MNMG_CAMC1       YMRNLLLNTPNLEISQEIATEILSE-NGE-----------------ITGVK-THLNNTYN
MNMG_CAMC5       YMRNLLLNTPNLEISQEIATEILSA-NEQ-----------------ITGVK-THLGNVYE
MNMG_CAMFF       YMRNLLLNTPNLEVTQEIATEILTK-DNN-----------------IIGVK-THLDNNYG
MNMG_CAMHC       FMRNVLLNTSNLNISQEIATEILTE-NDQ-----------------ITGVK-THLGNVYE
MNMG_NITSB       MMRTIVLNTPNLEVRQEMVDRLLIK-GDA-----------------VVGVE-TNLKNVYH
MNMG_SULDN       IARNKILNTPNLELVQEMAESLIIE-DGE-----------------VKGVK-TNLLNEYS
MNMG_ARCB4       YMRKVCHNTPNLEVYQDEVTALLVKNDNE-----------------VCGVK-TKLTEEFI
MNMG_SULNB       YMRNVVLNTENLDVKQEIADGLIVE-EGE-----------------VKGVT-TQLGNRYT
MNMG_HELPY       LARNLVLNTPNLSVSQEMTESLILENDE------------------VVGVT-TNINNTYR
MNMG_HELPH       FARNLVLNTPNLSVSQEMTESLILENDE------------------VVGVT-TNINNTYR
MNMG_HELPJ       FARNLVLNTPNLSVSQEMTESLILENDE------------------VVGVT-TNINNTYR
MNMG_HELAH       FARNLVLNTPNLSVSQEMTESLIIENDE------------------VVGVT-TNINNTYR
MNMG_HELHP       FAKEIALNTPNLTISQESVESLIYEQDSKG-------------RYIVKGVT-TNIGKTYF
MNMG_WOLSU       MMRNLCLTTPNLTVAQEMVEELIVEEGA------------------VLGVR-TQIGREYR
MNMG_LEPIN       KVKHTLEAEKNLSIRQDTVEELIIE-NDQ-----------------VIGVR-TGRGFEIF
MNMG_LEPIC       KVKHTLEAEKNLSIRQDTVEELIIE-NDQ-----------------VIGVR-TGRGFEIF
MNMG_LEPBJ       KVKHTLEAEKNLSMRQDTVEELLIE-NDQ-----------------VIGVK-TGRGFEIY
MNMG_LEPBL       KVKHTLEAEKNLSMRQDTVEELLIE-NDQ-----------------VIGVK-TGRGFEIY
MNMG_LEPBA       MIKHQLEKLQQLSIRQDTVEDLIVE-GNQ-----------------VTGVI-TGRGFTFY
MNMG_LEPBP       MIKHQLEKLQQLSIRQDTVEDLIVE-GNQ-----------------VTGVI-TGRGFTFY
MNMG_GEOMG       RMKHVMEQQERLSLKQAEVTGIVVE------------------DGEVRGVD-TKVGVRYL
MNMG_GEOSL       RMKHVMEEQEHLSLKQGEVTGLVVE------------------DGRVRGVV-TKVGVRFL
MNMG_GEOUR       RMKRILEHQDKLDLKQAEVTSLLVE------------------DGNVVGVD-TKAGVRYL
MNMG_PELPD       RMKRVLENQDNLHLKQGEVTALYCD------------------GSVVRGVD-TRSGIRFL
MNMG_PELCD       HMKQVVENQPALDLKQGSVSRLILQ------------------GDKVSGVE-TTDGLRFF
MNMG_DESPS       QMKSVIEHQENLTVSQTEVNGFIVE------------------DGKITGVT-TTIDEKIS
MNMG_DESVH       VVRRDIFAQPNLRVWQDMAESIIVE------------------EGRAAGVR-TAYGQEFR
MNMG_DESVV       VVRRDIFAQPNLRVWQDMAESIIVE------------------GGRAAGVR-TAYGQEFR
MNMG_DESAG       AVQRDVFRQDNLWVWQDTAENVLVE------------------NGRAAGVS-TLLGQEFR
MNMG_LAWIP       AVKQDIFSQPNLSVWQDTVEAIIVK------------------DGHTGGVK-TALGQLFN
MNMG_SYNFM       SMKHCLESEPNLDLKQAHVESLAVE------------------GNRIVGVI-DQLGVFFG
MNMG_SYNAS       AMKSVVERQPKLHLFQSLVDCLLVK------------------DGQITGVA-DQTGVCFG
MNMG_CHLTE       YMRRIVEHEPNIDLLQDTVIGVSANSG------------------KFSSVT-VRSGRAIQ
MNMG_CHLCH       YMRTIIEREPNIDLLQDTVIAIETKGE------------------CFAGVR-ITSSRVIE
MNMG_CHLPM       YMKRVLEAETNLDLLQDTVTGIEVRGG------------------QFFGVE-LQSGRILR
MNMG_CHLL3       YMKRALEEEVNLDLLQDTVTGIEQREG------------------ILRGVR-LLSGRLVT
MNMG_CHLPD       YMRKIIEEQDNIDLVQDTVTGLDVESG------------------AVRGAI-LPSGRIIK
MNMG_BACFR       AWREILENIPNLHIWQDTVKEIIVENG------------------EVVGLK-TFWDVTFH
MNMG_BACFN       AWREILENIPNLHIWQDTVKEIIVENG------------------EVVGLK-TFWDVTFH
MNMG_BACTN       SWREKLENTPNLHIWQDTVCELLVENG------------------EVVGLV-TLWGVTFK
MNMG_PHOV8       AWREILENTPNLHIWQDTVEELIVENG------------------EATGVM-TCWGVTFH
MNMG_PARD8       CWRGILENMPNLSIWQDMVQELIIEHG------------------QVCGVR-TGMNVVFR
MNMG_PORGI       AWRDIVEHEPNLYMWQDSVRCLSIRQG------------------AVAGVV-TALGVEFQ
MNMG_FLAJ1       EWRMMLEGTPNLDFYQEMVKGLIIENG------------------KIKGIR-TSLGVEIR
MNMG_FLAPJ       EWRLMLEGTPNLDFYQEMVSGMVIENN------------------KVLGIK-TSLGLTIR
MNMG_GRAFK       DWRLKLEGTPNLDFYQEMVAGLIIEND------------------KVIGVR-TSLGLEVF
MNMG_CYTH3       EWRMQLEALPNVDFWQEMISGLIVKNG------------------KVCGVR-TGLGIEIP
MNMG_SULMW       EWRLTLEKKKNLSFFQSTVVDLIIKNY------------------KVIGVK-TILGIYIK
MNMG_SALRD       AIRQELEAIDNLKMRSDMVKEILTDDAG----------------ETVTGVR-TNLGKEFR
MNMG_BORAP       KAKETLERQDNLDLFQDTVVDFLLNSMRNE----------------IEGVV-TERGNKFR
MNMG_BORBP       KAKETLERQDNLDLFQDTVVDFLLNSMRNE----------------IKGVV-TERGNKFR
MNMG_BORBU       KAKETLERQDNLDLFQDTVVDFLLNSMRNE----------------IEGVV-TERGNKFR
MNMG_TREDE       LAKHAIELEKNLHVFQDTVIDIVSSNTNESGYV--------EK-GSVQYVK-TERGREFS
MNMG_TREPA       KVKYTLECTQHLHLYQDTVVDVVCSNTTDAGYV--------AY-GAAHAVV-TARGRRIS
MNMG1_FUSNN      KMREKLEKTENISLIQDCVEEILVEDIKDTQNS--------NYIKKITGIK-TRLGIIYN
MNMG2_FUSNN      EMKKTLEHTDNLSVIQGMVSELVVEEENGK--------------KIIKGIK-IREGLEYK
MNMG_ENDTX       LMSKSVQNQQNLEILQSEATSLTVKN------------------GKVCGVK-ILTGETIE
MNMG_ONYPE       IIFEILQKTLNLTLLEGLVNNLVIQNN------------------QVQGVC-LIDGTKIN
MNMG_AYWBP       IILEILQNTPNLTLLEGLVNNLIIQKN------------------QVQGVC-LIDGRKIN
MNMG_ACHLI       VMLDVLQNTPNLTLLQGFVDTLIVEDN------------------TVKGVN-LEDGSQVF
MNMG_MYCCT       YMRNVIKKQKNLDLITKACTGLVYDDNK-----------------SVTGIY-LDDEIILN
MNMG_MYCMS       YMRNVIKNQKNLDLITRACTGLVYDENK-----------------TVTGIY-LDDQTILN
MNMG_MESFL       YMQKIVEEQINLQLIESIATDLII-ENN-----------------TVTGVL-LKDGEILK
MNMG_MYCGE       WFQSQVKLNKNINLIQSEAINLIV-RNE-----------------KIKGVI-LKDGSELL
MNMG_MYCPN       WFRQQIDQTPNIELIAGEAVDILE-SNG-----------------KVKGVV-LADGSELA
MNMG_MYCGA       WFLEQIDNNENIELVEGEVTEVIK-NGD-----------------TATGVM-IDGVKKLE
MNMG_UREPA       WFKQQIKQQKNLDLIIAEVSDLLV-ENN-----------------IVKGVV-LSDQKIIQ
MNMG_UREP2       WFKQQIKQQKNLDLIIAEVSDLLV-ENN-----------------IVKGVV-LSDQKIIQ
MNMG_MYCPE       WFLNRIEENEYIDLIDKEVNSIKF-VNQ-----------------KVCGVY-TVDNQFFE
MNMG_MYCH7       LILKDLKKQENLLIIEDLVSELLVEKN------------------RVFGLK-TAKKQVFF
MNMG_MYCHJ       LILKDLKKQENLLIIEDLVSELLVEKN------------------RVFGLK-TAKKQVFF
MNMG_MYCH2       LILKDLKKQENLLIIEDLVSELLVEKN------------------RVFGLK-TAKKQVFF
MNMG_MYCPU       IIVKDLLQNENVTIFEDFATDLIVEND------------------QIVGVE-LEKNKTIS
MNMG_MYCS5       LIREDLQKNSNITLIEAGVYEIKADKK------------------VFKSVV-LSTGEEIF
MNMG_MYCMO       IILKAVQETKNIDLIEDMVFEIQTKDN------------------KISGVI-TEKNGLLE
MNMG_MYCAP       LAYEYVLKQPNLELLEGVAEEVIVDENG-----------------YFKGVL-VENIGLIE
MNMG_THEM4       MMKNKLQSQENLVLRFGLVEKILVKDG------------------KVYGVV-DSFGIDYR
MNMG_FERNB       TMKRKLEEQENLLIRYGIVEEILVENG------------------KVKGVV-DSFGIDYM
MNMG_THEMA       TMKRKLETNPNIVLRHGIVERILTEKG------------------RVKGVV-DNYGIDYL
MNMG_THESQ       TMKRKLETNPNIVLRHGIVERILTEKG------------------RVKGVV-DNYGIDYL
MNMG_THEP1       TMKRKLETNPNIVLRHGIVEKILTEKG------------------KVKGVV-DNYGIDYL
MNMG_PETMO       RMKEILETTDNLILRHGIAKNILVENG------------------KIIGLE-TELGMKYF
MNMG_BDEBA       FQKEALYNQPNLEVLQGEVKRLILEKD------------------LCVGVV-LQDGSEIF
MNMG_ALKMQ       EMKKTIENEPNLLLKQAEVVDLIIEDNT------------------VKGVV-TRSGASFY
MNMG_ALKOO       EMKKMLENEPNLHLLQGEVVDIIVEDNT------------------VKGVV-TKTGAIYY
MNMG_CLOD6       EMKKTLEDEPNLDIAMDEVVEILHEGNV------------------VIGVG-TKLGCSFK
MNMG_FINM2       EMKSVLENTENLDLIEAEVVDIEVEDNK------------------IKSIT-TAQGAIFP
MNMG_CALS8       YMKRVLESQPNLDIRQGEVCDILVEDGK------------------VTGVK-LTTGAIFR
MNMG_ACET2       EMKNTLEKQENLDVKQAEIVEILYDEVEGKKT--------------VRGVK-THTGAIYK
MNMG1_CALS4      NMKHTLERQENLDIKQAEIVDILVEDNK------------------VTGVV-TKLGAIYK
MNMG2_CALS4      NMKHTLERQKNLDIKQAEIVDILVENNK------------------VVGVV-TKLGAIYK
MNMG_THEP3       NMKYTLERQENLDIKQAEIVDILVEDNK------------------VTGVV-TKLGAIYK
MNMG_THEPX       NMKYTLERQENLDIKQAEIVDILVEDNK------------------VTGVV-TKLGAIYK
MNMG_CLOB1       RMKHLLEKEDNVVLRQLEVIEIDVED-NE-----------------VKGVL-TKNGAYFT
MNMG_CLOBH       RMKHLLEKEDNVVLRQLEVIEIDVED-NE-----------------VKGVL-TKNGAYFT
MNMG_CLOBL       RMKHLLEKEDNVVLRQLEVIEIDVED-NE-----------------VKGVL-TKNGAYFT
MNMG_CLOBK       RMKHLLEKEENVVLRQLEVIEIDVED-NE-----------------VKGVL-TKNGAYFT
MNMG_CLOBM       RMKHLLEKEENVVLRQLEVIEIDVED-NE-----------------VKGVL-TKNGAYFT
MNMG_CLONN       RMKHVLETTDNLHLKQAEIIKVDIED-SK-----------------VKGVL-TKNGAYYK
MNMG_CLOAB       VMRNVLENQEDLYLRQIEVISLDIED-GK-----------------VKGIV-TKNGACFT
MNMG_CLOTE       RMKYILENEENVTLKQIEVISIDIEN-GK-----------------VKGIL-TKNGAYYN
MNMG_CLOK5       RMKSVLERQHNLDLKQLEVVGIRIDNEGK-----------------VCGVI-TKNGAYFE
MNMG_CLOP1       RMKKVLETQENLHLRQLEVVSVEVED-GK-----------------VKGVL-TKNGAFFE
MNMG_CLOPS       RMKKVLETQENLHLRQLEVVSVEVED-GK-----------------VKGVL-TKNGAFFE
MNMG_CLOPE       RMKKVLETQENLHLRQLEVVSVEVED-GK-----------------VKGVL-TKNGAFFE
MNMG_CLOB8       RMKRILEEQENLKIRQIEVTELNVEN-GK-----------------VTGVV-TKNGAIFK
MNMG_LACP7       EMRKVVENTDNLTLRQDEVIDILTEN-NE-----------------VTGVK-VYSGGVYP
MNMG_NATTJ       RMKYILENEENLLLKQETVNQLMIEDNQ------------------IKGVV-TKDGTYYY
MNMG_BACVZ       EMKHTLEKTPNLTLLQGIAERLIIEDGE------------------CRGVI-TQTGAEYK
MNMG_BACSU       EMKNTLEKEPNLTLLQGIVERLIVEDGE------------------CRGVI-TQTGAHYR
MNMG_BACLD       EMKKTLENEPNLTMLQGMVERLLIEDGE------------------CRGVI-TQTGAEYR
MNMG_BACP2       EMKKTMENEPNLTMLQGMVDHLIVKDDE------------------CKGVV-TQTGANYR
MNMG_BACAH       ELKKTIEETPNLTLFQGMVERLIVEDGE------------------CKGVI-TQAGAEYT
MNMG_BACHK       ELKKTIEETPNLTLFQGMVERLIVEDGE------------------CKGVI-TQAGAEYT
MNMG_BACAN       ELKKTIEETPNLTLFQGMVERLIVEDGE------------------CKGVI-TQAGAEYT
MNMG_BACCZ       ELKKTIEETPNLTLFQGMVERLIVEDGE------------------CKGVI-TQAGAEYT
MNMG_BACC1       ELKKTIEETPNLTLFQGMVERLIVEDGE------------------CKGVI-TQAGAEYT
MNMG_BACCR       ELKKTIEETPNLTLFQGMVERLIVEEGV------------------CKGVV-TQAGAEYT
MNMG_BACMK       ELKKTIEETPNLTLFQGLVERLIIEDGV------------------CKGVI-TQAGAEYT
MNMG_BACCN       ELKKTIEETPNLTLRQGMVERLIVEDGV------------------CKGVI-TQSGAEYT
MNMG_GEOKA       EMKKTLENQENLTLLQGKVERLIVEDGV------------------CKGVI-THTGAHYY
MNMG_GEOTN       EMKKTLENQKNLTLLQGKVERLIVEDGV------------------CKGVI-TQTGAHYY
MNMG_LYSSC       EMKRILEETENLTIHQGMVEELIIEDGE------------------VTGVI-TQIGAIYR
MNMG_STAA2       EMKRVIEDEENLHIMQGMVDELIIEDNE------------------VKGVR-TNIGTEYL
MNMG_STAA9       EMKRVIEDEENLHIMQGMVDELIIEDNE------------------VKGVR-TNIGTEYL
MNMG_STAAR       EMKRVIEDEENLHIMQGMVDELIIEDNE------------------VKGVR-TNIGTEYL
MNMG_STAAS       EMKRVIEDEENLHIMQGMVDELIIEDNE------------------VKGVR-TNIGTEYL
MNMG_STAA1       EMKRVIEDEENLHIMQGMVDELIIEDNE------------------VKGVR-TNIGTEYL
MNMG_STAAM       EMKRVIEDEENLHIMQGMVDELIIEDNE------------------VKGVR-TNIGTEYL
MNMG_STAAW       EMKRVIEDEENLHIMQGMVDELIIEDNE------------------VKGVR-TNIGTEYL
MNMG_STAAN       EMKRVIEDEENLHIMQGMVDELIIEDNE------------------VKGVR-TNIGTEYL
MNMG_STAAB       EMKRVIEDEENLHIMQGMVDELIIEDNE------------------VKGVR-TNIGTEYL
MNMG_STAA8       EMKRVIEDEENLHIMQGMVDELIIEDNE------------------VKGVR-TNIGTEYL
MNMG_STAA3       EMKRVIEDEENLHIMQGMVDELIIEDNE------------------VKGVR-TNIGTEYL
MNMG_STAAC       EMKRVIEDEENLHIMQGMVDELIIEDNE------------------VKGVR-TNIGTEYL
MNMG_STAAE       EMKRVIEDEENLHIMQGMVDELIIEDNE------------------VKGVR-TNIGTEYL
MNMG_STAAT       EMKRVIEDEENLHIMQGMVDELIIEDNE------------------VKGVR-TNIGTEYL
MNMG_STAES       EMKRVLENEDNLDIMQGMVDELIIEDNE------------------VKGVR-TNIGTEYR
MNMG_STAEQ       EMKRVLENEDNLDIMQGMVDELIIEDNE------------------VKGVR-TNIGTEYR
MNMG_STAHJ       EMKRVIEDEDNLDIMQGMVDELIIEDNE------------------VKGVR-TNIGTEYR
MNMG_STAS1       EMKKVIEDEANLDIMQGMVDDLIIEDDV------------------IKGVR-TNIGTEYW
MNMG_LISMO       EMKHTIEKEENITLRQGLVDRLVIEDGV------------------CKGVI-TNSGAIYY
MNMG_LISMF       EMKHTIEKEENITLRQGLVDRLVIEDGV------------------CKGVI-TNSGAIYY
MNMG_LISIN       EMKHTIEKEENITLRQGLVDRLVIEDGV------------------CKGVI-TNSGAIYY
MNMG_LISW6       EMKHTIEKEENITLRQGLVDHLVIEDGV------------------CKGVI-TNSGAIYY
MNMG_OCEIH       EMKHLMENEENLTIRQGMVNELIVEDGI------------------CKGVI-TETHAAYY
MNMG_BACSK       EMKRTIEEQENLLLRQGMVDRLIIEDGE------------------CRGVI-TNTGAQYR
MNMG_ALKHC       EMKKTIEEEENLLLRQGMVERLIIEDGE------------------CRGVI-TNTGAEYR
MNMG_EXIS2       RMKKALEDEPNLLLRQALVERLIIEDDT------------------CVGVV-TNTGAEYR
MNMG_LEVBA       EMKHTIEREPNLTLRQGIVDDLIVEDGE------------------CQGVI-TNTGARYR
MNMG_LACPL       EMKHTIEREPNLTLRQGIVDGLIVEDGV------------------CKGVI-TNTGARYS
MNMG_PEDPA       EMKKTIEAEPNLTLRQGIVDDLIVEDGV------------------CKGVI-TNTGARYQ
MNMG_LACS1       EMKHTIEQTPHLTLRQGIVDDLIIEDGE------------------VKGVV-TNTGACYG
MNMG_ENTFA       EMKHTIEKEENLTLRQGIVEELIVEDGV------------------CRGVV-TSTGAAYR
MNMG_LACSS       TMKRTIETTEHLTLRQGIAESLIVEDGV------------------CKGIV-TNTGARYS
MNMG_LACP3       SMKHVIENTPNLDLRQGLATEVLVENGQ------------------AVGIV-AATGAMYR
MNMG_LACAC       YMKDTIENTPNLTLRQAIVDELVVEDGV------------------CKGVI-TNTGAKYH
MNMG_LACH4       HMKDTIENTPNLTLRQAIVDQLVVEDGV------------------CKGVI-TNTGAKYH
MNMG_LACJO       RMKDTIENEPNLTLRQAVADELIVEDGV------------------CKGLI-TNTGAKYY
MNMG_LACGA       HMKDTIENEPNLTLRQAVADELIVEDGA------------------CKGLI-TNTGAKYH
MNMG_LACDA       EMKRTIENTPNLTLRQAVVDDLIVEDGE------------------CRGVV-TNTGARYR
MNMG_LACDB       EMKRTIENTPNLTLRQAVVDDLIVEDGE------------------CRGVV-TNTGARYR
MNMG_LACLM       SMKNTVSDQENLTLRQGMVEELILDDEKQK----------------VIGVR-TSTGTQYG
MNMG_LACLS       SMKNTVSDQENLTLRQGMVEELILDDEKQK----------------VIGVR-TSTGTQYG
MNMG_LACLA       SMKNTVSDQENLTLRQGMVEELILDEEKKK----------------VIGIK-TSTGTKYG
MNMG_STRA3       TMKQTVEKQENLTLRQAMIDEILVEDGK------------------VVGVR-TATNQKFS
MNMG_STRA5       TMKQTVEKQENLTLRQAMIDEILVEDGK------------------VVGVR-TATNQKFS
MNMG_STRA1       TMKQTVEKQENLTLRQAMIDEILVEDGK------------------VVGVR-TATNQKFS
MNMG_STRP1       EMKHTVEKQANLTLRQTMIDDILVEDGR------------------VVGVL-TATGQKFA
MNMG_STRPD       EMKHTVEKQANLTLRQTMIDDILVEDGR------------------VVGVL-TATGQKFA
MNMG_STRPB       EMKHTVEKQANLTLRQTMIDDILVEDGR------------------VVGVL-TATGQKFA
MNMG_STRPC       EMKHTVEKQANLTLRQTMIDDILVEDGR------------------VVGVL-TATGQKFA
MNMG_STRPG       EMKHTVEKQANLTLRQTMIDDILVEDGR------------------VVGVL-TATGQKFA
MNMG_STRP8       EMKHTVEKQANLTLRQTMIDDILVEDGR------------------VVGVL-TATGQKFA
MNMG_STRPF       EMKHTVEKQANLTLRQTMIDDILVEDGR------------------VVGVL-TATGQKFA
MNMG_STRPM       EMKHTVEKQANLTLRQTMIDDILVEDGR------------------VVGVL-TATGQKFA
MNMG_STRP3       EMKHTVEKQANLTLRQTMIDDILVEDGR------------------VVGVL-TATGQKFA
MNMG_STRP6       EMKHTVEKQANLTLRQTMIDDILVEDGR------------------VVGVL-TATGQKFA
MNMG_STRT2       TMKHTVERQENLTLRQSMVDEILVEDSK------------------VVGVR-TATNQKYG
MNMG_STRT1       TMKHTVERQENLTLRQSMVDEILVEDSK------------------VVGVR-TATNQKYG
MNMG_STRTD       TMKHTVECQENLTLRQSMVDEILVEDSK------------------VVGVR-TATNQKYG
MNMG_STRMU       NMKHTVEQQENLTLRQSMIDEILVEDGK------------------VIGVR-TATNQKYS
MNMG_STRGC       EMRKTVENQENLTLRQTMINEILVEDGK------------------VIGVK-TATHQEYA
MNMG_STRSV       EMRKTVENQENLTLRQTMINEILVEDGK------------------VIGVK-TATHQEYA
MNMG_STRR6       EMRKTVENQENLTLRQTMIDEILVEDGK------------------AVGVR-TATHQEYA
MNMG_STRP2       EMRKTVENQENLTLRQTMIDEILVEDGK------------------AVGVR-TATHQEYA
MNMG_STRPN       EMRKTVENQENLTLRQTMIDEILVEDGK------------------VVGVR-TATHQEYA
MNMG_STRPI       EMRKTVENQENLTLRQTMIDEILVEDGK------------------VVGVR-TATHQEYA
MNMG_STRSY       EMKRTVERQENLTLRQTMIDEILVEDGK------------------VIGVR-TATNQKFS
MNMG_STRS2       EMKRTVERQENLTLRQTMIDEILVEDGK------------------VIGVR-TATNQKFS
MNMG_DESRM       LMKKNLETQENLDVKQLLVEEILVKNGR------------------VTGVA-TQIGAEFS
MNMG_PELTS       CMKKVLECQPGLDLKQALVEKIMVEKGK------------------VRGVL-TSTGARFE
MNMG_CARHZ       EMKKTIERQENLYLKQAETIKILVEGEK------------------VRGVL-TRTGAVFT
MNMG_MOOTA       EMTLTLERQEHLDVKQAEVIRILTESGR------------------VKGVL-TRTGAYFA
MNMG_HELMI       EMIRVLEHQENLDVRQAMVESVVVEQGR------------------VRGIR-TNTGAFFA
MNMG_SYNWW       EMLKTLFNQKKLDILMAEVEDIELSAGR------------------VKAIV-TRTGARFE
MNMG_DESAP       GMRRTVEGQPLLDLKQAMVEKIIVDGGS------------------ARGVV-TRTGARFL
MNMG_SYMTH       AMRLVLERTPNLDLKQAMVQEIVVEDGR------------------VRGIV-TATGIFYG
MNMG_DESHY       HMRNAILGQENLVLHQALVERIKTEDGK------------------VSGVV-TRTGAFYA
MNMG_ROSCS       VMKETLETTPNLDLRQAMIERILLPQPPGRNGSAAPADDPAGVQPGHYAVI-THTRRVYQ
MNMG_ROSS1       VMKETLETIPNLDLRQAMIERIILPRPINRNG--SDTDDAEALCPGHYAVV-THTRRIYQ
MNMG_CHLAA       LMKETLERVPNLDLRQAMVERIAPPNA----------------DTQCFTVT-THTGWRYL
MNMG_DEIRA       RAQDVIFGHSEIEIVRGEAADLEQDGQ------------------GGWVVV-TSDGRRLH
MNMG_DEIGD       RAQEILLGHSGIDVVRGEAADLEPDGC------------------GGWFVV-TTDGRRFH
MNMG_THET2       KAQEIL-AERPVEVLRGEVAALWVEGG------------------RLLGVR-TVDGRTLP
MNMG_THET8       KAQEIL-AERPVEVLRGEVAALWVEGG------------------RLLGVR-TVDGRTLP
MNMG_MYXXD       GMQAVLFSQPNLTVREGEVAALVAGGG------------------RVEGVV-LGDGTQVS
                            :         .                                      

MNMG_NOSS1       CKAVILTTGTFLGGKIWVG-NKSMPAGRAGEF-AAEGLTETLNR-LGFETGRLKTGTPAR
MNMG_TRIV2       CKAVILTTGTFLGGKIWVG-NKSMPAGRAGEF-AAEGLTETLNR-LGFETGRLKTGTPAR
MNMG_TRIEI       CKAVILTTGTFLGGVIWVG-NKSMPAGRAGEF-SAIGLSETLNK-LGFETGRLKTGTPAR
MNMG_SYNY3       AQSVVITTGTFLGGKIWIG-NKSMPAGRAGEF-AAVGLTETLNE-LGFETGRLKTGTPAR
MNMG_SYNP2       AKAVVLTTGTFLGGTIWIG-NKSMPAGRAGEF-AAVGMTETLNE-LGFETGRLKTGTPAR
MNMG_MICAN       AKAVILTTGTFLGGKIWIG-GKSMAAGRAGEF-AAVGLTETLNR-LGFETGRLKTGTPAR
MNMG_ACAM1       CQAVILTTGTFLGGRIWVG-DKSMPAGRAGEF-AAEGLTETLNQ-LGFETGRLKTGTPAR
MNMG_SYNP6       AKAVILTTGTFLGGCIWVG-NKSMPAGRAGEF-AAVGLTETLQR-LGFETDRLKTGTPAR
MNMG_SYNE7       AKAVILTTGTFLGGCIWVG-NKSMPAGRAGEF-AAVGLTETLQR-LGFETDRLKTGTPAR
MNMG_THEEB       CQAVILTTGTFLGGRIWVG-NKSMPAGRAGEF-AAEGLSQTLAR-LGFEVDRLKTGTPAR
MNMG_SYNJB       CRAVILTTGTFLGGRIWIG-RHWQAAGRAGEF-AVEGLTDTLRQ-LGFETGRLKTGTPAR
MNMG_SYNJA       CGAVILTTGTFLGGRIWIG-RHWQPAGRAGEF-AVEGLTDTLRQ-LGFETGRLKTGTPAR
MNMG_PROM1       AKAVVLTTGTFLGGRIWIG-NQSMSAGRAGEQ-ASEGLTEELKK-LGFTTDRLKTGTPAR
MNMG_PROMT       AKAVVLTTGTFLGGRIWIG-NQSMSAGRAGEQ-ASEGLTEELKK-LGFTTDRLKTGTPAR
MNMG_PROMA       AKAVILTTGTFLKGKIWIG-NQSMDAGRAGEQ-AATGLTEALQK-LGFETSRLKTGTPPR
MNMG_PROM3       AQAVVLTTGTFLGGQIWVG-NQSMPAGRAGEQ-AAEGLTEALES-LGFQTNRLKTGTPAR
MNMG_PROMM       AQAVVLTTGTFLGGQIWVG-NQSMPAGRAGEQ-AAEGLTEALES-LGFQTNRLKTGTPAR
MNMG_SYNSC       ADAVILTAGTFLGGRIWVG-HQSMAAGRAGEQ-AAEGLTETLQE-LGFQTDRLKTGTPAR
MNMG_SYNPX       AEAVILTAGTFLGGRIWVG-HQSMAAGRAGEQ-AAEGLTEALQQ-LGFQTDRLKTGTPAR
MNMG_SYNS9       AQAVVLTAGTFLGGRIWVG-HQSMAAGRAGEQ-AAEGLTETLQG-LGFHTDRLKTGTPAR
MNMG_SYNPW       AKAVVLTAGTFLGGRIWVG-HQSMAAGRAGEQ-AAEGLTEALQQ-LGFHTDRLKTGTPAR
MNMG_SYNS3       AQAVVLTAGTFLGGRIWVG-HQSMSAGRAGEQ-AAEGLTDALKQ-LGFQTDRLKTGTPAR
MNMG_SYNR3       AQAVVLTTGTFLGGRIWVG-NQSMPAGRAGEQ-PAEGLTEALQA-LGFATDRLKTGTPAR
MNMG_PROMS       ARSVIITAGTFLEGRIWIG-NKSMSAGRSGEQ-AAQGLTQNLHE-IGIKTERLKTGTPAR
MNMG_PROM0       ARSVIITAGTFLEGRIWIG-NKSMSAGRSGEQ-AAKGLTENLHE-IGIKTERLKTGTPAR
MNMG_PROM9       ARSVIITAGTFLEGRIWIG-NKSMSAGRSGEQ-AAKGLTKNLHE-IGIKTERLKTGTPAR
MNMG_PROM2       AKSVIITAGTFLEGKIWIG-NKSMSAGRSGEQ-AAQGLTQNLHE-IGIKTERLKTGTPAR
MNMG_PROM5       AKSIIITAGTFLEGRIWIG-NKSMSAGRSGEQ-AAQGLTESLHS-LGIKTERLKTGTPAR
MNMG_PROMP       AKSIIITAGTFLEGRIWIG-NKSMSAGRSGEQ-AAQGLTQSLHN-LGIKTERLKTGTPAR
MNMG_CHLTR       GKTVVLSSGTFMRGLIHIG-TQNFSGGRLGDA-ASLGLSEDLKR-LGFPLGRLKTGTPAR
MNMG_CHLTA       GKTVVLSSGTFMRGLIHIG-TQNFSGGRLGDA-ASLGLSEDLKR-LGFPLGRLKTGTPAR
MNMG_CHLT2       GKTVVLSSGTFMRGLIHIG-TQNFSGGRLGDA-ASLGLSEDLKR-LGFPLGRLKTGTPAR
MNMG_CHLTB       GKTVVLSSGTFMRGLIHIG-TQNFSGGRLGDA-ASLGLSEDLKR-LGFPLGRLKTGTPAR
MNMG_CHLMU       GETVVLSSGTFMRGLIHIG-TQNFSGGRLGDA-ASLGLSKDLKR-LGFPLGRLKTGTPAR
MNMG_CHLAB       GKTVILSSGTFMRGLIHIG-DLNFPGGRLGDP-AATGLSLALKE-RGFPISRLKTGTPPR
MNMG_CHLCV       GKTVILSSGTFMRGLIHIG-DLNFPGGRLGDP-AATGLSAALKE-RGFPISRLKTGTPPR
MNMG_CHLFF       GKTVILSSGTFMRGLIHIG-DRSFSGGRLGDP-AATGLSAALKE-RGFPISRLKTGTPPR
MNMG_CHLPN       GKTVVLSSGTFMRGLIHIG-DRNFSGGRLGDP-SSQGLSEDLKK-RGFPISRLKTGTPPR
MNMG_PARUW       CQAIVLSSGTFLRGLLHIG-ETNYSGGRAGDQ-PSVGMSASLEK-YGLKLGRLKTGTPPR
MNMG_RHOBA       APTVILTTGTFLQAIMHTG-KSQSAGGRAGEG-TTAGLSGALKG-MGFTLDRFKTGTPPR
MNMG_OPITP       GRTVVVTTGTFLRGLMHIG-SNKNEGGRLGDF-SARTLSGSLQE-AGIELRRFKTGTPPR
MNMG_AQUAE       TKAVVVTTGTFLNGVIYIG-DKMIPGGRLGEP-RSEGLSDFYRR-FDFPLIRFKTGTPAR
MNMG_ECOLI       AKAVVLTVGTFLDGKIHIG-LDNYSGGRAGDP-PSIPLSRRLRE-LPLRVGRLKTGTPPR
MNMG_ECOL6       AKAVVLTVGTFLDGKIHIG-LDNYSGGRAGDP-PSIPLSRRLRE-LPLRVGRLKTGTPPR
MNMG_ECO24       AKAVVLTVGTFLDGKIHIG-LDNYSGGRAGDP-PSIPLSRRLRE-LPLRVGRLKTGTPPR
MNMG_ECODH       AKAVVLTVGTFLDGKIHIG-LDNYSGGRAGDP-PSIPLSRRLRE-LPLRVGRLKTGTPPR
MNMG_ECOL5       AKAVVLTVGTFLDGKIHIG-LDNYSGGRAGDP-PSIPLSRRLRE-LPLRVGRLKTGTPPR
MNMG_ECOHS       AKAVVLTVGTFLDGKIHIG-LDNYSGGRAGDP-PSIPLSRRLRE-LPLRVGRLKTGTPPR
MNMG_ECOLC       AKAVVLTVGTFLDGKIHIG-LDNYSGGRAGDP-PSIPLSRRLRE-LPLRVGRLKTGTPPR
MNMG_SHIBS       AKAVVLTVGTFLDGKIHIG-LDNYSGGRAGDP-PSIPLSRRLRE-LPLRVGRLKTGTPPR
MNMG_SHISS       AKAVVLTVGTFLDGKIHIG-LDNYSGGRAGDP-PSIPLSRRLRE-LPLRVGRLKTGTPPR
MNMG_ECOUT       AKAVVLTVGTFLDGKIHIG-LDNYSGGRAGDP-PSIPLSRRLRE-LPLRVGRLKTGTPPR
MNMG_ECOK1       AKAVVLTVGTFLDGKIHIG-LDNYSGGRAGDP-PSIPLSRRLRE-LPLRVGRLKTGTPPR
MNMG_ECOSM       AKAVVLTVGTFLDGKIHIG-LDNYSGGRAGDP-PSIPLSRRLRE-LPLRVGRLKTGTPPR
MNMG_ECO57       AKAVVLTVGTFLDGKIHIG-LDNYSGGRAGDP-PSIPLSRRLRE-LPLRVGRLKTGTPPR
MNMG_SHIDS       AKAVVLTVGTFLDGKIHIG-LDNYSGGRAGDP-PSIPLSRRLRE-LPLRVGRLKTGTPPR
MNMG_SHIFL       AKAVVLTVGTFLDGKIHIG-LDNYSGGRAGDP-PSIPLSRRLRE-LPLRVGRLKTGTPPR
MNMG_SHIF8       AKAVVLTVGTFLDGKIHIG-LDNYSGGRAGDP-PSIPLSRRLRE-LPLRVGRLKTGTPPR
MNMG_SALCH       AKAVVLTVGTFLDGKIHIG-LDNYSGGRAGDP-PSIPLSRRLRE-LPLRVSRLKTGTPPR
MNMG_SALTY       AKAVVLTVGTFLDGKIHIG-LDNYSGGRAGDP-PSIPLSRRLRE-LPLRVSRLKTGTPPR
MNMG_SALPB       AKAVVLTVGTFLDGKIHIG-LDNYSGGRAGDP-PSIPLSRRLRE-LPLRVSRLKTGTPPR
MNMG_SALPA       AKAVVLTVGTFLDGKIHIG-LDNYSGGRAGDP-PSIPLSRRLRE-LPLRVSRLKTGTPPR
MNMG_SALTI       AKAVVLTVGTFLDGKIHIG-LDNYSGGRAGDP-PSIPLSRRLRE-LPLRVSRLKTGTPPR
MNMG_CITK8       AKAVVLTVGTFLDGKIHIG-LDNYSSGRAGDP-PSIPLSRRLRE-LPLRVSRLKTGTPPR
MNMG_SALAR       AKAVVLTVGTFLDGKIHIG-LDNYSGGRAGDP-PSIPLSRRLRE-LPLRVSRLKTGTPPR
MNMG_ENT38       AKAVVLTVGTFLDGKIHIG-LDNYSGGRAGDP-PSISLSRRLRE-LPLRVNRLKTGTPPR
MNMG_KLEP7       AKAVVLTVGTFLDGKIHIG-LDNYSGGRAGDP-PSIPLSRRLRE-LPLRVSRLKTGTPPR
MNMG_CROS8       AKAVVLTVGTFLDGKIHIG-LDNYSGGRAGDP-PSVPLARRLRE-LPLRVSRLKTGTPPR
MNMG_PECAS       AKAVVLTVGTFLDGKIHIG-LDNYSGGRAGDP-PSIPLARRLRE-LPLRVNRLKTGTPPR
MNMG_YERPE       AKAVVLTVGTFLDGKIHIG-LENYSGGRAGDP-PSISLSQRLRE-LPLRVNRLKTGTPPR
MNMG_YERPY       AKAVVLTVGTFLDGKIHIG-LENYSGGRAGDP-PSISLSQRLRE-LPLRVNRLKTGTPPR
MNMG_YERPA       AKAVVLTVGTFLDGKIHIG-LENYSGGRAGDP-PSISLSQRLRE-LPLRVNRLKTGTPPR
MNMG_YERPN       AKAVVLTVGTFLDGKIHIG-LENYSGGRAGDP-PSISLSQRLRE-LPLRVNRLKTGTPPR
MNMG_YERPP       AKAVVLTVGTFLDGKIHIG-LENYSGGRAGDP-PSISLSQRLRE-LPLRVNRLKTGTPPR
MNMG_YERPS       AKAVVLTVGTFLDGKIHIG-LENYSGGRAGDP-PSISLSQRLRE-LPLRVNRLKTGTPPR
MNMG_YERP3       AKAVVLTVGTFLDGKIHIG-LENYSGGRAGDP-PSISLSQRLRE-LPLRVNRLKTGTPPR
MNMG_YERE8       AKAVVLTVGTFLDGKIHIG-LENYSGGRAGDP-PSISLSQRLRE-LPLRVNRLKTGTPPR
MNMG_SERP5       AKAVVLTVGTFLDGKIHIG-LENYSGGRAGDP-PSISLSQRLRE-LPLRVNRLKTGTPPR
MNMG_PHOLL       AKAVVLTVGTFLDGKIHIG-LENYSGGRAGGP-PAISLAQRLRE-LPLRVNRLKTGTPPR
MNMG_SODGM       ARAVVLTVGTFLDGKIHIG-MDHYSGGRAGDP-PSVSLSRRLRE-LPFRVNRLKTGTPPR
MNMG_VIBCH       AKAVVLTVGTFLGGKIHIG-LENYAGGRAGDP-PSIALAHRLRE-LPFRVDRLKTGTPPR
MNMG_VIBC3       AKAVVLTVGTFLGGKIHIG-LENYAGGRAGDP-PSIALAHRLRE-LPFRVDRLKTGTPPR
MNMG_VIBCB       AKAVVLTVGTFLGGKIHIG-MESSSGGRAGDP-PSIALADRLRE-LPFRVDRLKTGTPPR
MNMG_VIBPA       AKAVVLTVGTFLGGKIHIG-MESSSGGRAGDP-PSIALADRLRE-LPFRVDRLKTGTPPR
MNMG_VIBVU       AKAVVLTVGTFLGGKIHIG-LQSSSGGRAGDP-PSIALADRLRE-LPFRVDRLKTGTPPR
MNMG_VIBVY       AKAVVLTVGTFLGGKIHIG-LQSSSGGRAGDP-PSIALADRLRE-LPFRVDRLKTGTPPR
MNMG_ALIF1       AKSVVLTAGTFLGGQIHIG-MENFSGGRAGDP-SSITLAQRLRE-RPFRIDRLKTGTPPR
MNMG_PHOPR       ATSVVLTVGTFLGGKIHIG-LENYSGGRAGDP-PSIALASRLRE-LPFRVDRLKTGTPPR
MNMG_AERHH       GKTVVLTVGTFLNGLIHIG-MENYKGGRAGDP-PSIALAQRLRE-LPLRIDRLKTGTPPR
MNMG_AERS4       GKTVVLTVGTFLNGLIHIG-MENYKGGRAGDP-PSIALAQRLRE-MPLRIDRLKTGTPPR
MNMG_COLP3       GKSVVLTVGTFLSGLIHIG-LNNYQGGRAGDP-ASVNLAAKMRD-MPFRMDRLKTGTPPR
MNMG_PSEA6       AKSVVITVGTFLGGTIHIG-MENYKGGRAGDP-PSIALADRLRA-LPFRVSRLKTGTPAR
MNMG_IDILO       AKTVVLTVGTFLGGQIHIG-LDNYQGGRAGDP-PSNALAKRLRA-LPLRVERLKTGTPPR
MNMG_PSET1       APSVVLTVGTFLGGQIHIG-LENFKGGRAGDP-PSIALADRLRE-LPFRVDRLKTGTPPR
MNMG_SHEB5       SPAVVLTTGTFLSGKIHIG-LENYSGGRAGDP-PAIALANRLRE-LPIRVGRLKTGTPPR
MNMG_SHEB8       SPAVVLTTGTFLSGKIHIG-LENYSGGRAGDP-PAIALANRLRE-LPIRVGRLKTGTPPR
MNMG_SHEB9       SPAVVLTTGTFLSGKIHIG-LENYSGGRAGDP-PAIALANRLRE-LPIRVGRLKTGTPPR
MNMG_SHEPC       SPAIVLTTGTFLSGKIHIG-LENYSGGRAGDP-PAIALANRLRE-LPIRVGRLKTGTPPR
MNMG_SHESW       SPAIVLTTGTFLSGKIHIG-LENYSGGRAGDP-PAIALANRLRE-LPIRVGRLKTGTPPR
MNMG_SHESM       APAVVLTAGTFLSGKIHIG-LENYSGGRAGDP-PSIALAHRLRE-LPIRVGRLKTGTPPR
MNMG_SHESR       APAVVLTAGTFLSGKIHIG-LENYSGGRAGDP-PSIALAHRLRE-LPIRVGRLKTGTPPR
MNMG_SHESA       APAVVLTAGTFLSGKIHIG-LENYSGGRAGDP-PSIALAHRLRE-LPIRVGRLKTGTPPR
MNMG_SHEON       ASAVVLTAGTFLSGKIHIG-LENYSGGRAGDP-PSIALAHRLRE-LPIRVGRLKTGTPPR
MNMG_SHEDO       SPTVVLTTGTFLSGKIHIG-MQNYSGGRAGDP-PAIALANRLRE-LPIRVGRLKTGTPPR
MNMG_SHEFN       APAIVLTTGTFLSGKIHIG-MQNYSGGRAGDP-PAIALANRLRE-LNIRVGRLKTGTPPR
MNMG_SHEHH       APAVVLTAGTFLGGKIHIG-LENYSGGRAGDP-PSIALAHRLRE-LPIRVGRLKTGTPPR
MNMG_SHEPA       APAVVLTAGTFLGGKIHIG-LENYSGGRAGDP-PAIALAHRLRE-LPIRVGRLKTGTPPR
MNMG_SHESH       APAVVLTAGTFLSGKIHIG-MQNYSGGRAGDP-PSIALADRLRE-LPIRIGRLKTGTPPR
MNMG_SHEWM       APAVVLTAGTFLSGKIHIG-MQNYSGGRAGDP-PSIALADRLRE-LPIRIGRLKTGTPPR
MNMG_SHELP       APAIVLTAGTFLSGKIHIG-LENYSGGRAGDP-PSISLADRLRE-LPIRVGRLKTGTPPR
MNMG_SHEAM       APAVVLTAGTFLGGKIHIG-LENYSGGRAGDQ-PAIALAHRLRD-LPLRVGRLKTGTPPR
MNMG_PSYIN       AKTVVLTVGTFLNGQIHVG-LKNHSGGRAGDS-ASIGLAQRLRE-LPLRTGRLKTGTPAR
MNMG_ACTP2       ARSVVLTAGTFLAGKIHIG-LDNYAGGRAGDP-AATMLADRLRD-LNLRVDRLKTGTPPR
MNMG_ACTPJ       ARSVVLTAGTFLAGKIHIG-LDNYAGGRAGDP-SATMLADRLRD-LNLRVDRLKTGTPPR
MNMG_HAEDU       AKTVILTAGTFLAGKIHIG-LDNYAGGRAGDP-AATRLAERLRD-LNLRVDRLKTGTPPR
MNMG_HAEIN       AKSVILTAGTFLAGKIHIG-LENYEGGRAGDS-ASVNLSHRLRD-LGLRVDRLKTGTPPR
MNMG_HAEIG       AKSVVLTAGTFLAGKIHIG-LENYEGGRAGDP-ASVNLSHRLRD-LGLRVNRLKTGTPPR
MNMG_HAEIE       AKSVVLTAGTFLAGKIHIG-LENYEGGRAGDP-ASVNLSHRLRD-LGLRVDRLKTGTPPR
MNMG_HAEI8       AKSVVLTAGTFLAGKIHIG-LENYEGGRAGDP-ASVNLSYRLRD-LGLRVDRLKTGTPPR
MNMG_HAES1       AKSVVLTAGTFLAGKIHIG-LENYAGGRAGDP-ASVNLAKKLRD-LNLRVNRLKTGTPPR
MNMG_HISS2       AKSVVLTAGTFLAGKIHIG-LENYAGGRAGDP-ASVNLAKKLRD-LNLRVNRLKTGTPPR
MNMG_MANSM       TKSVILTAGTFLGGKIHIG-LDNYTGGRAGDP-ASIALADRLRD-LNLRVARLKTGTPPR
MNMG_PASMU       AKAVILTAGTFLSGKIHIG-LENYTGGRAGDP-ASVMLADRLRE-LNLRVDRLKTGTPPR
MNMG_ACTSZ       AKAVILTAGTFLAGKIHIG-LTNYEGGRAGDP-ASVTLSHRLRD-LGLRVDRLKTGTPPR
MNMG_HYDCU       AHQVVLTAGTFLAGRIHIG-LQNYEGGRAGDA-PSNRLAAKLRE-LALPVGRLKTGTPPR
MNMG_ACIAC       ARTVVLTAGTFLDGKIHVG-LNNYSAGRAGDP-PAVSLSARLKE-LQLPQGRLKTGTPPR
MNMG_ACISJ       SRAVVLTAGTFLDGKIHVG-LNNYAAGRAGDP-PAVSLSARLKE-LQLPQGRLKTGTPPR
MNMG_VEREI       ARAVVLTAGTFLDGKIHVG-LSHYAAGRAGEP-SAIGLSARLKE-LKLPQGRLKTGTPPR
MNMG_POLNA       ARTVVLTAGTFLDGKIHVG-LNNYPAGRAGDP-PAVSLSARLKE-LKLPQGRLKTGTPPR
MNMG_POLSJ       SRTVVLTAGTFLDGKIHVG-LNNYAAGRAGDP-PAVSLSSRLKE-LKLPQGRLKTGTPPR
MNMG_RHOFT       AKTVVLTAGTFLDGKIHVG-LNNYAAGRAGDP-PAVRLSARLKE-LKLPQGRLKTGTPPR
MNMG_LEPCP       ARTVVLTAGTFLDGKIHVG-LNNYPAGRAGDP-PAVSLSARLKE-LKLPQGRLKTGTPPR
MNMG_METPP       SKAVVLTAGTFLDGRIHVG-LQNYAAGRAGDP-PAQSLSARLKE-LQLPQGRLKTGTPPR
MNMG_BURCA       ARAVVLTAGTFLDGKIHVG-LNNYTGGRAGDP-AAVSLSSRLKE-LKLPQGRLKTGTPPR
MNMG_BURCH       ARAVVLTAGTFLDGKIHVG-LNNYTGGRAGDP-AAVSLSSRLKE-LKLPQGRLKTGTPPR
MNMG_BURCC       ARAVVLTAGTFLDGKIHVG-LNNYTGGRAGDP-AAVSLSSRLKE-LKLPQGRLKTGTPPR
MNMG_BURCM       ARAVVLTAGTFLDGKIHVG-LNNYTGGRAGDP-AAVSLSARLKE-LKLPQGRLKTGTPPR
MNMG_BURA4       ARAVVLTAGTFLDGKIHVG-LNNYTGGRAGDP-AAVSLSARLKE-LKLPQGRLKTGTPPR
MNMG_BURL3       ARAVVLTAGTFLDGKIHVG-LNNYTGGRAGDP-AAVSLSSRLKE-LKLPQGRLKTGTPPR
MNMG_BURVG       ARAVVLTAGTFLDGKIHVG-LNNYTGGRAGDP-AAVSLSARLKE-LKLPQGRLKTGTPPR
MNMG_BURMA       ARAVVLTAGTFLDGKIHVG-LNHYTGGRAGDP-AAVSLSSRLKE-LNLPQGRLKTGTPPR
MNMG_BURM9       ARAVVLTAGTFLDGKIHVG-LNHYTGGRAGDP-AAVSLSSRLKE-LNLPQGRLKTGTPPR
MNMG_BURP0       ARAVVLTAGTFLDGKIHVG-LNHYTGGRAGDP-AAVSLSSRLKE-LNLPQGRLKTGTPPR
MNMG_BURM7       ARAVVLTAGTFLDGKIHVG-LNHYTGGRAGDP-AAVSLSSRLKE-LNLPQGRLKTGTPPR
MNMG_BURMS       ARAVVLTAGTFLDGKIHVG-LNHYTGGRAGDP-AAVSLSSRLKE-LNLPQGRLKTGTPPR
MNMG_BURP1       ARAVVLTAGTFLDGKIHVG-LNHYTGGRAGDP-AAVSLSSRLKE-LNLPQGRLKTGTPPR
MNMG_BURPS       ARAVVLTAGTFLDGKIHVG-LNHYTGGRAGDP-AAVSLSSRLKE-LNLPQGRLKTGTPPR
MNMG_BURP6       ARAVVLTAGTFLDGKIHVG-LNHYTGGRAGDP-AAVSLSSRLKE-LNLPQGRLKTGTPPR
MNMG_BURTA       ARAVVLTAGTFLDGKIHVG-LNNYTGGRAGDP-AAVSLSSRLKE-LKLPQGRLKTGTPPR
MNMG_PARXL       GRAVVLTAGTFLDGKIHVG-LNNYTGGRAGDP-AAVSLSARLKE-LKLPQGRLKTGTPPR
MNMG_CUPNH       ARAVVLTAGTFLDGKIHVG-LDNYTGGRAGDP-AAVSLSARLKD-LKLPQGRLKTGTPPR
MNMG_CUPPJ       ARAVVLTAGTFLDGKIHVG-LDNYTGGRAGDP-ASVSLSARLKE-LKLPQGRLKTGTPPR
MNMG_CUPMC       ARAVVLTAGTFLDGKIHVG-LDNYTGGRAGDP-AAVSLSARLKE-LKLPQGRLKTGTPPR
MNMG_RALSO       ARAVVLTAGTFLDGKIHVG-LNNYTGGRAGDP-AAVSLSARLKE-LKLPQGRLKTGTPPR
MNMG_JANMA       ARAVVLTAGTFLDGKIHVG-LNNYSAGRAGDP-PAISLSARLKE-LKLPQGRLKTGTPPR
MNMG_HERAR       ARAVVLTAGTFLDGKIHIG-MNNYSAGRAGDP-PAISLSARLKE-LKLPQGRLKTGTPPR
MNMG_BORBR       ARTVVLTAGTFLNGLIHVG-LQNYSGGRAGDP-PANSLGQRLKE-LQLPQGRLKTGTPPR
MNMG_BORPA       ARTVVLTAGTFLNGLIHVG-LQNYSGGRAGDP-PANSLGQRLKE-LQLPQGRLKTGTPPR
MNMG_BORPE       ARTVVLTAGTFLNGLIHVG-LQNYSGGRAGDP-PANSLGQRLKE-LQLPQGRLKTGTPPR
MNMG_BORPD       GRTVVLTAGTFLNGLIHVG-LQNYSGGRAGDP-PATSLGQRLKE-LQLPQGRLKTGTPPR
MNMG_BORA1       GRAVVLTAGTFLNGLIHVG-LQHYSGGRAGDP-PANSLGQRLKE-LKLPQGRLKTGTPPR
MNMG_AZOSB       APAVVLTAGTFLNGLIHVG-LEHYSAGRAGDP-PAISLGQRLKE-LALPQGRLKTGTPPR
MNMG_AROAE       APAVVLTAGTFLNGLIHVG-LDNYSAGRAGDP-PAISLGARLKE-LALPQGRLKTGTPPR
MNMG_DECAR       AEAVVLTAGTFLNGKIHVG-LENYTGGRMGDP-PSVSLASRLKE-LKLPQGRLKTGTPPR
MNMG_METFK       SKAVVLTAGTFLAGLVHVG-LANYQAGRAGDP-PAVSLAARLRE-IGLPAGRLKTGTPPR
MNMG_THIDA       ARAVVLTAGTFLAGLVHVG-LENFQAGRMGDP-PAVSLAARLRE-LDLPVGRLKTGTPPR
MNMG_NITMU       ARAVILTAGTFLAGLAHVG-SANFQAGRAGDL-PSNSLAGRLRE-LKLPVGRLKTGTPPR
MNMG_NEIG1       ARAVVLTAGTFLSGKIHIG-LENYEGGRAGDP-AAKSLGGRLRE-LKLPQGRLKTGTPPR
MNMG_NEIMA       ARAVVLTAGTFLSGKIHIG-LENYEGGRAGDP-AAKSLGGRLRE-LKLPQGRLKTGTPPR
MNMG_NEIMB       ARAVVLTAGTFLSGKIHIG-LENYEGGRAGDP-AAKSLGGRLRE-LKLPQGRLKTGTPPR
MNMG_NEIM0       ARAVVLTAGTFLSGKIHIG-LENYEGGRAGDP-AAKSLGGRLRE-LKLPQGRLKTGTPPR
MNMG_NEIMF       ARAVVLTAGTFLSGKIHIG-LENYEGGRAGDP-AAKSLGGRLRE-LNLPQGRLKTGTPPR
MNMG_CHRVO       AKTVVLTAGTFLSGKIHVG-LENYTGGRAGDQ-AASTLGERLRE-LNLPVGRLKTGTPPR
MNMG_POLAQ       AKKVVLTAGTFLDGKIHVG-LNNYAGGRAGDP-AAVSLSARLKE-LKLPQGRLKTGTPPR
MNMG_ACIBT       AKTVVLTTGTFLGGVIHVG-LEKSSGGRAGDP-PSIALAQRLRE-LKLPVGRLKTGTPPR
MNMG_ACIBY       AKTVVLTTGTFLGGVIHVG-LEKSSGGRAGDP-PSIALAQRLRE-LKLPVGRLKTGTPPR
MNMG_ACIAD       TKTVVLTTGTFLGGVIHIG-LEKSSGGRAGDP-PSIALSHRLRE-LNLPVGRLKTGTPPR
MNMG_PSYA2       TQTVVLTSGTFLGGVIHIG-LESSKGGRAGDQ-PSIKLADRLRE-LKLPVGRLKTGTPAR
MNMG_PSYCK       TQTVVLTSGTFLGGVIHIG-LESSKGGRAGDQ-PSIKLADRLRE-LKLPVGRLKTGTPAR
MNMG_PSYWF       TKTVVLTSGTFLGGVIHIG-LDNSKGGRAGDQ-PSIKLAERLRE-LKLPVGRLKTGTPAR
MNMG_PSEAE       ADNVVLTTGTFLGGLIHIG-LENYSGGRAGDP-PSIALARRLRE-LPLRVGRLKTGTPPR
MNMG_PSEAB       ADNVVLTTGTFLGGLIHIG-LENYSGGRAGDP-PSIALARRLRE-LPLRVGRLKTGTPPR
MNMG_PSEA7       ADNVVLTTGTFLGGLIHIG-LENYSGGRAGDP-PSIALARRLRE-LPLRVGRLKTGTPPR
MNMG_PSEPU       AESVVLTTGTFLGGLIHIG-LQNHSGGRAGDP-PSIALAHRMRE-LPLRVGRLKTGTPPR
MNMG_PSEPK       AESVVLTTGTFLGGLIHIG-LQNHSGGRAGDP-PSIALAHRMRE-LPLRVGRLKTGTPPR
MNMG_PSEP1       AESVVLTTGTFLGGLIHIG-LQNHSGGRAGDP-PSIALAHRMRE-LPLRVGRLKTGTPPR
MNMG_PSEPG       AESVVLTTGTFLGGLIHIG-LQNHSGGRAGDP-PSIALAHRMRE-LPLRVGRLKTGTPPR
MNMG_PSEPW       ADSVVLTTGTFLGGLIHIG-LQNHSGGRAGDP-PSIALAHRMRE-LPLRVGRLKTGTPPR
MNMG_PSEE4       ADSVVLTSGTFLGGLIHIG-LQNYSGGRAGDP-PANALAQRMRE-LPLRVGRLKTGTPPR
MNMG_PSEF5       AESVVLTTGTFLGGLIHIG-MQNYSGGRAGDP-PSIALAQRLRE-LPLRVGRLKTGTPPR
MNMG_PSEPF       ADSVVLTTGTFLGGLIHIG-LQNFSGGRAGDP-PSIALAHRLRE-LPLRVGRLKTGTPPR
MNMG_PSE14       ADSVVLTTGTFLGGLIHIG-MQNYSGGRAGDP-PSIALAQRLRE-LPLRVGRLKTGTPPR
MNMG_PSEU2       ADSVVLTTGTFLGGLIHIG-MQNYSGGRAGDP-PSIALAQRLRE-LPLRVGRLKTGTPPR
MNMG_PSESM       ADSVVLTTGTFLGGLIHIG-MQNYSGGRAGDP-PSIALAQRLRE-LPLRVGRLKTGTPPR
MNMG_PSEMY       ADSVVLTTGTFLGGLIHIG-LQNYSGGRAGDP-PSMALAHRLRE-LPLRVGRLKTGTPPR
MNMG_PSEU5       ATSVVLTTGTFLGGLIHIG-LQNYSGGRAGDP-PSIALAKRLRE-LPLRVGRLKTGTPPR
MNMG_ALCBS       ADAVVLTAGTFLGGVIHIG-LDNHQGGRAGDQ-PSNALACRLRE-LPFRVDRLKTGTPPR
MNMG_HAHCH       SKTVVLTTGTFLGGVIHIG-LENHSGGRAGDP-PSIALAKRLRE-MPFRVGRLKTGTPPR
MNMG_MARMS       SKTVVLTAGTFLGGVIHIG-LENHSGGRAGDP-PSIGLAQKLRA-LPFRVDRLKTGTPPR
MNMG_SACD2       APTVVLTAGTFLGGKIHIG-MENHSGGRAGDP-PSIALASRLRE-LPLRVDRLKTGTPPR
MNMG_CHRSD       GESVVLCTGTFLGGVIHIG-LDHHAGGRAGDP-PSNALAQRLRA-LPFHVDRLKTGTPPR
MNMG_MARHV       AKTVVLTTGTFLGGVIHIG-MQNHAGGRAGDA-PANALAKRLRE-LPFNVGRLKTGTPPR
MNMG_ALKEH       APAVVLTVGTFLGGRIHIG-ESNYGGGRAGDP-AANALAARLRE-LPFQVDRLKTGTPPR
MNMG_NITOC       APAVVLTVGTFLGGRIHVG-LTNHEGGRAGDP-PANILSSRLRE-LPFRVARLKTGTPPR
MNMG_METCA       SRCVVLTVGTFLAGRIHIG-LENYDGGRAGDP-PATDLARRLRD-LGFKVARLKTGTPPR
MNMG_XANAC       APSVVLTAGTFLAGKIHVG-QTQYAAGRMGDP-PATTLAARLRE-RPFAIDRLKTGTPPR
MNMG_XANC5       APSVVLTAGTFLAGKIHVG-ETQYAAGRMGDP-PATTLAARLRE-RPFAIDRLKTGTPPR
MNMG_XANOR       APSVVLTAGTFLAGKIHVG-DTQYAAGRLGDP-PATTLAARLRE-RPFAIDRLKTGTPPR
MNMG_XANOM       APSVVLTAGTFLAGKIHVG-DTQYAAGRLGDP-PATTLAARLRE-RPFAIDRLKTGTPPR
MNMG_XANCP       ATAVVLTAGTFLAGKIHVG-ETQYAAGRMGDP-PATTLAARLRE-RPFAIDRLKTGTPPR
MNMG_XANC8       ATAVVLTAGTFLAGKIHVG-ETQYAAGRMGDP-PATTLAARLRE-RPFAIDRLKTGTPPR
MNMG_XANCB       ATAVVLTAGTFLAGKIHVG-ETQYAAGRMGDP-PATTLAARLRE-RPFAIDRLKTGTPPR
MNMG_XYLFA       APAVVLTAGTFLAGKIHIG-PTQYAAGRMGDP-PATMLAARLRE-RLFTVARLKTGTPPR
MNMG_XYLFT       APAVVLTAGTFLAGKIHIG-PTQYAAGRMGDP-PATMLAARLRE-RLLTVARLKTGTPPR
MNMG_COXBU       APTVILTVGTFLGGKIHIG-MNHYRGGRAGDP-PALALAERLRE-MPFRVERLKTGTPPR
MNMG_COXBN       APTVILTVGTFLGGKIHIG-MNHYRGGRAGDP-PALALAERLRE-MPFRVERLKTGTPPR
MNMG_COXBR       APTVILTVGTFLGGKIHIG-MNHYRGGRAGDP-PALALAERLRE-MPFRVERLKTGTPPR
MNMG_LEGPC       ARAVVLTVGTFLGGKIHVG-MNQYAGGRAGDP-PSIALSKSLRD-LDLPVGRLKTGTPPR
MNMG_LEGPA       ARAVVLTVGTFLGGKIHVG-MNQYAGGRAGDP-PSIALSKSLRD-LDLPVGRLKTGTPPR
MNMG_LEGPL       ARAVVLTVGTFLGGKIHVG-MNQYAGGRAGDP-PSIALSKSLRD-LDLPVGRLKTGTPPR
MNMG_LEGPH       ARAVVLTVGTFLGGKIHVG-MNQYAGGRAGDP-PSIALSKSLRD-LDLPVGRLKTGTPPR
MNMG_NITEU       ARAVVLTVGTFLGGVAHVG-HQNFQAGRAGDP-ASIRLAHRLRE-MNLSVGRLKTGTPPR
MNMG_NITEC       ARAVVLTVGTFLGGLAHVG-DRNFQAGRAGDP-ASIRLAHRLRE-MNLSVGRLKTGTPPR
MNMG_FRATF       AKKVVLTVGTFLGGKIHIG-KVSNAGGRAGDQ-PSNALAARLRS-LPFRVDRLKTGTPPR
MNMG_FRATH       AKKVVLTVGTFLGGKIHIG-KVSNAGGRAGDQ-PSNALAARLRS-LPFRVDRLKTGTPPR
MNMG_FRATO       AKKVVLTVGTFLGGKIHIG-KVSNAGGRAGDQ-PSNALAARLRS-LPFRVDRLKTGTPPR
MNMG_FRATW       AKKVVLTVGTFLGGKIHIG-KVSNAGGRAGDQ-PSNALAARLRS-LPFRVDRLKTGTPPR
MNMG_FRATT       AKKVVLTVGTFLGGKIHIG-KVSNAGGRAGDQ-PSNALAARLRS-LPFRVDRLKTGTPPR
MNMG_FRAT1       AKKVVLTVGTFLGGKIHIG-KVSNAGGRAGDQ-PSNALAARLRS-LPFRVDRLKTGTPPR
MNMG_FRATN       AKKVVLTVGTFLGGKIHIG-KVSNAGGRAGDQ-PSNALAARLRS-LPFRVDRLKTGTPPR
MNMG_FRAP2       SKKVVLTVGTFLGGKIHIG-QVSKEGGRAGDQ-PSNALAARLRA-LPFRVDRLKTGTPPR
MNMG_VESOH       ADKVILTSGTFLGGIIHIG-QRNFQGGRAGDA-PSNALSRKLRS-YDLGVNRLKTGTPPR
MNMG_RUTMC       ADKVILTSGTFLGGVIHIG-QRNFQGGRAGDA-PSNALSGKLRS-YDLRVSRLKTGTPPR
MNMG_DICNV       AKTVIITAGTFLGGKIYVG-LNYFVGGRAGDP-AALELANKLRD-LPFETHRMKTGTPPR
MNMG_BLOFL       AKSVVLTTGTFLNGKIHIG-MNNFKGGRSGDLESSSSLSQKLRD-LSFRINRLKTGTSPR
MNMG_BLOPB       GTSVVLTTGTFLNGKIHIG-MNNFRGGRSGDSESSSLLSERLKE-LSFQISRLKTGTSPR
MNMG_BAUCH       ANSVILTVGTFLDGKIHIG-LNSYPGGRTGDL-SSISLSSNLRK-LPFRVKRLKTGTPPR
MNMG_BUCAI       SRSVVLAAGTFLGGKIHIG-LKSYSAGRIGDK-SAIDLSVRLRE-LSLRVNRLKTGTPPR
MNMG_BUCAP       SRSVVLSTGTFLGGKIHIG-LESYSAGRKGEK-ASIDLALRLRD-LPFRVDRLKTGTPPR
MNMG_BUCBP       SKAVVLTTGTFLGGKIYIG-SKCFLGGRINDY-SSINLAQRLKD-LPIKIGRLKTGTPPR
MNMG_WIGBR       SKIVIITTGTFLNGKIHIG-NKQYVSGRSGEF-SSIKLSQILKEKFCFRINRLKTGTPPR
MNMG_BUCCC       SSIVILTAGTFLNGKMYIG-SDVFDGGRRNDV-SASILANNLKK-YFSKIGRLKTGTPPR
MNMG_HALHL       ADAVVVTAGTFLAGQIHIG-HVQHSAGRAGDP-AADRLSASLRD-LGLAVHRLKTGTPPR
MNMG_RHIME       AAAVVLTTGTFLKGLIHIG-QRKIPAGRVGEE-PSLGLSGTLRR-FGLQLGRLKTGTPAR
MNMG_SINMW       AASVVLTTGTFLRGLIHIG-DRKMPAGRVGEQ-PSVGLSETLAR-FGLQLGRLKTGTPAR
MNMG_RHIEC       APAVVLTTGTFLRGLIHIG-SEKTPAGRVGEA-PSIGLSATLAR-LGLRLGRLKTGTPAR
MNMG_RHIL3       APAVVLTTGTFLRGLIHIG-SEKTPAGRVGEA-PSIGLSATLAR-LGLRLGRLKTGTPAR
MNMG_AGRFC       CGAVVLTSGTFLRGLIHIG-SEKIPAGRVGEM-PSLGLSDTLSR-LGLAMGRLKTGTPAR
MNMG_BARHE       SGAVVLTTGTFLNGFIHIG-DKTWAAGRMGEQ-SSIKLAERLKS-YGINLGRLKTGTPAR
MNMG_BARQU       SGAVVLTTGTFLNGLIHIG-DKTWAAGRMGEH-SSVQLAERLKK-YDINLGRLKTGTPAR
MNMG_BART1       SGAVVLTTGTFLNGFIHIG-DKTWAAGRMGDP-ASVQLAERLKN-YHIKLGRLKTGTPAR
MNMG_BARBK       SGAVVLTTGTFLNGLIHIG-DKTWPAGRMGEQ-ASVQLAERLKN-YGISFGRLKTGTPAR
MNMG_BRUAB       CGAVVLTTGTFLNGLIHIG-EKRFPAGRMGEK-PALGLSERLLS-FGFTLGRLKTGTPPR
MNMG_BRUA2       CGAVVLTTGTFLNGLIHIG-EKRFPAGRMGEK-PALGLSERLLS-FGFTLGRLKTGTPPR
MNMG_BRUC2       CGAVVLTTGTFLNGLIHIG-EKRFPAGRMGEK-PALGLSERLLS-FGFTLGRLKTGTPPR
MNMG_BRUSU       CGAVVLTTGTFLNGLIHIG-EKRFPAGRMGEK-PALGLSERLLS-FGFTLGRLKTGTPPR
MNMG_BRUSI       CGAVVLTTGTFLNGLIHIG-EKRFPAGRMGEK-PALGLSERLLS-FGFTLGRLKTGTPPR
MNMG_BRUME       CGAVVLTTGTFLNGLIHIG-EKRFPAGRMGEK-PALGLSERLLS-FGFTLGRLKTGTPPR
MNMG_BRUO2       CGAVVLTTGTFLNGLIHIG-EKRFQAGRMGEK-PALGLSKRLLS-FGFTLGRLKTGTPPR
MNMG_BRUA4       CGAVVLTTGTFLNGLIHIG-EKKIPAGRMGEK-PALGLSERLTS-FGFALGRLKTGTPPR
MNMG_RHILO       CGAVVLTTGTFLRGLIHIG-EKKIVAGRMNEQ-ASLGLSATMDR-AGFKLGRLKTGTPPR
MNMG_CHESB       CAAVVLTTGTFLRGLIHIG-QKKIPAGRVNEP-AAKGLSASMEA-AGFKLGRLKTGTPPR
MNMG_BRASB       CGAIVITTGTFLRGLIHLG-EKTWPAGRVGEA-PALGLSQSLEA-IGFRLGRLKTGTPPR
MNMG_BRASO       CGAVVITTGTFLRGLIHLG-EKTWPAGRVGEA-PALGLSRSLEA-IGFNLGRLKTGTPPR
MNMG_BRADU       AGSIVVTTGTFLRGLIHLG-EKNWPAGRVGEA-PAMGLSSSFER-AGFTLGRLKTGTPPR
MNMG_NITHX       TGAVVVTTGTFLRGLIHLG-EKSWPAGRVDEA-PALGLSVSFER-IGFTLGRLKTGTPPR
MNMG_NITWN       SAAVVVTTGTFLRGLIHLG-EKSWPAGRVDEA-PALGLSASFER-IGFALGRLKTGTPPR
MNMG_RHOPS       AGAVVITTGTFLRGLIHLG-EQSWPAGRIDEA-PALGLSRSFEA-LGFALGRLKTGTPPR
MNMG_RHOP2       AGAVVITTGTFLRGLIHLG-EQCWPAGRIDEA-PALGLSASFEA-LGLALGRLKTGTPPR
MNMG_RHOPA       AAAVVITTGTFLRGLIHLG-ERSWPAGRIDEA-PAMGLSSSFEA-LGFKLGRLKTGTPPR
MNMG_RHOP5       TGAVVVTTGTFLRGLIHLG-EQSWPAGRIDEA-PALGLSAAFER-IGFALGRLKTGTPAR
MNMG_RHOPB       AGAVVITTGTFLRGLIHLG-ERSWPAGRIDEA-PALGLSKSFER-LGFALGRLKTGTPPR
MNMG_AZOC5       CGAVVLTTGTFLNGLIHMG-EVQIPAGRIGEA-PARGLSGTLAR-LGLTLGRLKTGTPPR
MNMG_METPB       AGAVVITTGTFLRGLIHIG-ERQIPAGRVGEE-PALGLARTLDR-HGFRLGRLKTGTPPR
MNMG_METRJ       CGAVVLTTGTFLRGLIHIG-ERQIPAGRVGEA-PAVGLAQTLER-LGLRLGRLKTGTPPR
MNMG_METS4       CAAVVLTTGTFLRGLIHIG-ERTMPAGRVGEA-PALGLAATLDR-HGFGLGRLKTGTPAR
MNMG_BEII9       CAAVVLTTGTFLRGLIHIG-EKQVRAGRIGEA-PAEAMGLALEA-LGLSMGRLKTGTPAR
MNMG_PARL1       ARRVVLTTGTFLRGVIHLG-TQRIPAGRVGEA-PALGLSDRLYG-LGFQLGRLKTGTPPR
MNMG_RHORT       AGAVVLTTGTFLRGVIHIG-TQTTPAGRIGEA-PALGLSATLAR-LGFPLGRLKTGTPPR
MNMG_MAGSA       CGAVVITTGTFLRGLIHLG-EKTWPAGRVGDA-PSLGLSLALER-AGLPLGRLKTGTPAR
MNMG_CAUVC       APRVILTTGTFLKGVIHRG-EDRIPAGRVGDQ-PAIGLSDRLYG-LGFQMGRLKTGTPAR
MNMG_CAUSK       APRVVLTTGTFLKGVIHQG-EIRISAGRVGDA-PSIGLADRLYA-LGFDMGRLKTGTPAR
MNMG_MARMM       AVAVVLTTGTFLRGLIHKG-AERIPAGRAGEA-PSIGLSDTLYG-LNLQMGRLKTGTPAR
MNMG_HYPNA       ASKVVITTGTFLKGEIHIG-AKRIPAGRIGEA-PALGLSDRLYS-IGLPMGRLKTGTPAR
MNMG_GLUOX       CGAVVLTTGTFLRGVIHVG-HTQTEAGRIGEA-PAKRLGERLYA-LGLQMGRLKTGTPPR
MNMG_GLUDA       AGAVVLTAGTFLRGVIHIG-HDSHPAGRVGEP-PAHALGERLQA-LGLPMGRLKTGTPAR
MNMG_GRABC       ASAVVLTTGTFLRGVIHCG-EQRSEAGRVGEA-PSIGLAKRLDA-LNLRMGRLKTGTPPR
MNMG_ACICJ       CRAAVLTTGTFLRGVLHFG-ERTEEGGRVGDA-ASNALSARLRG-LGLALGRLKTGTPAR
MNMG_RUEPO       SQAVILTSGTFLRGIIHIG-DVSRPGGRMGDR-PSVPLAERLDG-FALPMGRLKTGTPPR
MNMG_RUEST       AECVVLTSGTFLNGVIHIG-NKSSSGGRMGDR-PSIKLAERLKS-FELPLGRLKTGTPPR
MNMG_ROSDO       AKTVILTTGTFLRGVIHIG-DVSRSGGRMGDK-ASVRLADRIDS-FGLPMGRLKTGTPPR
MNMG_DINSH       ARAVVVTTGTFLRGIIHIG-NRSFQGGRMGAA-PSVRLAERFDS-FGLPLGRLKTGTPPR
MNMG_RHOS1       AGRVILTSGTFLNGVIHIG-DQRRPGGRMGDD-PSQRLAAVLGE-LSLARGRLKTGTPPR
MNMG_CERS4       AGRVILTSGTFLNGIIHIG-DQRRPGGRMGDD-PSQRLAAVLGE-LSLARGRLKTGTPPR
MNMG_CERS5       AKAVVLTSGTFLNGTIHIG-HDRRPGGRMGDL-PSIPLAQRLMD-LNLSRGRLKTGTPPR
MNMG_PARDP       ARQIILTTGTFLNGLIHIG-EISRQAGRWGGS-TSVTLAASLRP-LNLPLGRLKTGTPPR
MNMG_JANSC       ARSVVLTTGTFLRGVIHIG-HETRSGGRFGAN-RAIKLAERLSA-MNLPVGRLKTGTPPR
MNMG_NOVAD       GRAVVLCTGTFLGGRLFRG-EERMDGGRIGED-SAHRLAAQLRD-AELPMARLKTGTPPR
MNMG_ERYLH       GQAVILCTGTFLGGKLYRG-EEIMVGGRIGED-SASRLAEQMYG-LELPMARLKTGTPPR
MNMG_SPHAL       ARAVVLATGTFLGGRLFRG-EERMEGGRIGEA-GSHRLAGQLRA-AHLPMARLKTGTPPR
MNMG_SPHWW       AGAVVLATGTFLNARLHFG-MDCRTGGRVGEA-AAVGLAEQLRA-LDLPIARLKTGTPPR
MNMG_ZYMMO       TESVVLTTGTFLDAWLFCG-EKKWRGGRIGEQ-PSIGLAEQLKA-LDLPLGRLKTGTPAR
MNMG_ANAMM       TRRLVLATGTFLGGMIHVGRDKGIPAGRMGDK-PSTRLAKALCA-HGFMLGRLKTGTPPR
MNMG_ANAPZ       TTRLVFATGTFLGGTIHVG-NESFPAGRIGDK-PSTKLPQALTA-HGFQLGRLKTGTPPR
MNMG_EHRCJ       TSKLILTTGTFLQGTIHIG-SYTTPAGRIGEQ-PSIGLAKTLEK-YNFKLGRLRTGTPPR
MNMG_EHRCR       TKKLILTTGTFLQGTIHIG-SYNTPAGRFGEQ-PSIGLAKTLEK-YNFKLGRLRTGTPPR
MNMG_EHRRG       TKKLILTTGTFLQGTIHIG-SYNTPAGRFNEQ-SSVGLAKTLAS-YNFKLGRLRTGTPPR
MNMG_EHRRW       TKKLILTTGTFLQGTIHIG-SYNTPAGRFNEQ-SSVGLAKTLAS-YNFKLGRLRTGTPPR
MNMG_WOLPM       TSKVVLTTGTFLRGVIHIG-EQVTPSGRMGDK-PAVELANTLKK-YNFKLGRLRTGTPPR
MNMG_WOLTR       TSKVVLTTGTFLQGMVHIG-EQTTPSGRMGDK-SAVELANTLKK-YDFKLGRLRTGTPPR
MNMG_NEOSM       CSAAVLTTGTFLNGIIQTG-SERVEGGRFGEK-ASQCLGNTLRR-H-FKISRLRTGTPAR
MNMG_RICRO       CQKIILTTGTFLSGLIHIG-QKKIPAGRVDEE-PSYGLSNTLKQ-IGFKLARLKTGTPPR
MNMG_RICRS       CQKIILTTGTFLSGLIHIG-QKKIPAGRVDEE-PSYGLSNTLKQ-IGFKLARLKTGTPPR
MNMG_RICCN       CQKIILTTGTFLSGLIHIG-QKKIPAGRVDEE-PSYGLSNTLKQ-IGFKLARLKTGTPPR
MNMG_RICM5       CQKIILTTGTFLSGLIHIG-QKKIPAGRVDEE-PSYGLSNTLKQ-IGFKLARLKTGTPPR
MNMG_RICFE       CQKIILTTGTFLSGLIHIG-QKKIPAGRVDEE-PSYGLSNTLKK-VGFKIARLKTGTPPR
MNMG_RICAH       CQKIILTTGTFLSGLIHIG-KKKIPAGRVDEE-PSYGLSKTLKK-VGFKIARLKTGTPPR
MNMG_RICCK       CQKIILTTGSFLSGLIHIG-STKIPAGRVDEE-ASYGLSNTLKR-VGFKIARLKTGTPPR
MNMG_RICB8       CQKIILTTGTFLSGLIHIG-SKKIPAGRVDEE-PSYGLSNTLRR-IGFKLSRLKTGTPPR
MNMG_RICBR       CQKIILTTGTFLSGLIHIG-SKKIPAGRVDEE-PSYGLSNTLRR-IGFKLSRLKTGTPPR
MNMG_RICPR       CQKVVLTTGTFLSGFIHIG-SIKMPAGRIYEE-PSYGLSNTLKR-LGFKIARLKTGTPPR
MNMG_RICTY       CQKVVLTTGTFLSGFIHIG-SMKIPAGRIYEE-PSYGLSNTLKR-LGFKIARLKTGTPPR
MNMG_ORITB       CQKVILTTGTFLSGVIHRG-KEQIKAGRLGEN-ASYGLSNTLSE-LGLRLGRLKTGTPPR
MNMG_PELUB       CGKLILTTGTFLNGLIHIG-DERTPAGRFNEK-PSTGLSEQLEK-YDFKIGRLKTGTPPR
MNMG_KORVE       ALAVVITTGTFLNGLIHCG-EEQYPAGRSGEP-ASVLLGESLKK-MGLRGCRLKTGTPPR
MNMG_SOLUE       AGAVIVTTGTFLNGLAHVG-EMTYSCGRNGEA-PSQLLGDQLRS-MGLNWTRLKTGTPPR
MNMG_MAGMM       CGAIVIATGTFLDGLIHIG-ERKFPSGRLGDK-ESHPLAVNIKS-LGLKISRFKTGTPPR
MNMG_CAMJE       AKKVILTTGTFLNGLIHVG-ENKLQAGRVGEL-ASVNLGNYLQT-LGLKMGRLKTGTCPR
MNMG_CAMJJ       AKKVILTTGTFLNGLIHVG-ENKLQAGRVGEL-ASVNLGNYLQT-LGLKMGRLKTGTCPR
MNMG_CAMJR       AKKVILTTGTFLNGLIHVG-ENKLQAGRVGEL-ASVNLGNYLQT-LGLKMGRLKTGTCPR
MNMG_CAMJ8       AKKVILTTGTFLNGLIHVG-ENKLQAGRVGEL-ASVNLGNYLQT-LGLKMGRLKTGTCPR
MNMG_CAMJD       AKKVILTTGTFLNGLIHVG-ENKLQAGRVGEL-ASVNLGNYLQT-LGLKMGRLKTGTCPR
MNMG_CAMC1       AKKVIITTGTFLNGLIHVG-FNKLEAGRVGEL-SAKDLSSSLRE-LGLNLGRLKTGTCPR
MNMG_CAMC5       TTKLIITTGTFLNGLIHVG-FNKLKAGRVGEL-SSINLSQSLRN-LGLEMGRLKTGTCPR
MNMG_CAMFF       TKKLIITTGTFLNGLIHVG-FNKLEAGRVGEL-SSKSLSASLKS-LNLEMGRLKTGTCPR
MNMG_CAMHC       TNRLIITTGTFLNGLIHVG-ENKLSAGRVGEF-PSIRLSQSLKN-LGLKMGRLKTGTCPR
MNMG_NITSB       AKKVIVTTGTFLRGLIHIG-EIKQEAGRAGEF-ASNALSDSLKS-LGLRLGRLKTGTCAR
MNMG_SULDN       AKRVIVTSGTFLRGVIHVG-EIKQIGGRYGEQ-SSDALSASLKS-CGLEMGRLKTGTCAR
MNMG_ARCB4       AKKVVLTTGTFMRGLVHIG-ENKYEAGRAWEL-PSTTLSTQLKE-LGLRVGRLKTGTPSR
MNMG_SULNB       ASKVIITAGTFLNGLIHIG-DKKQTAGRQGEF-ASVELAEYLKG-LGLNIGRLKTGTCAR
MNMG_HELPY       AKKVIITTGTFLKGVVHIG-EHQNQNGRFGEN-ASNSLALNLRE-LGFKVDRLKTGTCPR
MNMG_HELPH       AKKVIITTGTFLKGVVHIG-EHQNQNGRFGEN-ASNSLALNLRE-LGFKVDRLKTGTCPR
MNMG_HELPJ       AKKVIITTGTFLKGVVHIG-EHQNQNGRFGEN-ASNSLALNLRE-LGFKVERLKTGTCPR
MNMG_HELAH       AKKVIITTGTFLKGVVHIG-EHQNQNGRFGEN-ASNSLALNLRE-LGFKVERLKTGTCPR
MNMG_HELHP       AKKVILTTGTFLRGLVHIG-ETKLQNGRFGEM-SPQNLSNSLQD-MGLTLGRLKTGTCAR
MNMG_WOLSU       SAKVIMTTGTFLNGLVHIG-NRTSSNGRVGEP-SSIKLSESLRS-LGLEVGRLKTGTCAR
MNMG_LEPIN       TDHVILTTGTFLSSLVHIG-TYQNENGRMCEP-TVKGLSKSLAK-YNLKLGRLKTGTPPR
MNMG_LEPIC       TNHVILTTGTFLSSLVHIG-TYQNENGRMCEP-TVKGLSKSLAK-YNLKLGRLKTGTPPR
MNMG_LEPBJ       TNHVILTTGTFLSSLVHIG-TYQNENGRMCEP-TVKGLSKSLAK-YNLKLGRLKTGTPPR
MNMG_LEPBL       TNHVILTTGTFLSSLVHIG-TYQNENGRMCEP-TVKGLSKSLAK-YNLKLGRLKTGTPPR
MNMG_LEPBA       TNHVILTTGTFLSSVIHIG-TYQKESGRIGEP-TTKGLSHTLAR-FELRLGRLKTGTPAR
MNMG_LEPBP       TNHVILTTGTFLSSVIHIG-TYQKESGRIGEP-TTKGLSHTLAR-FELRLGRLKTGTPAR
MNMG_GEOMG       GATVILTTGTFMRGLIHVG-LTNYPGGRAGDL-PSVGLSDQLRE-LGFAVGRLKTGTPAR
MNMG_GEOSL       GKTVILTTGTFMRGLIHVG-LTNYPGGRAGDL-PSVGLSDQLRD-LGFTVGRLKTGTPAR
MNMG_GEOUR       GKTIILTTGTFMRGLIHIG-LTHYPGGRAGDL-PSVGLSVSLEE-CGFKVGRLKTGTPAR
MNMG_PELPD       GKTVVLTTGTFMRGLIHIG-LTHYEGGRAGDL-PSIGLSDQLKQ-LGLQVGRLKTGTPAR
MNMG_PELCD       GQTVVLTTGTFMRGLIHVG-LQHFPGGRAGEP-PSLGLSDHLAE-LGLRVGRLKTGTPAR
MNMG_DESPS       VKAAIVATGTFLNGLVHIG-LKNFPAGRLGDG-PSTGLADWFYD-NGFAVGRMKTGTVPR
MNMG_DESVH       AHHVLLTTGTFLQGRIHVG-LSNFPGGRLGDA-PATGLSASLRA-IGLELGRLKTGTTPR
MNMG_DESVV       AHHVLLTTGTFLQGRIHVG-LNNFPGGRLGDA-PATGLSASLRA-IGLELGRLKTGTTPR
MNMG_DESAG       SRAVCVTAGTFMSGLIHVG-LTHFSGGRLGDP-AAQGLSASLRA-VGLELGRLKTGTTPR
MNMG_LAWIP       SQYVILTTGTFLSGLMHIG-QKNFSGGRLGDV-GTSKLSSSLHS-IGLHLGRLKTGTTPR
MNMG_SYNFM       ADAVVLATGTFLRGLVHIG-TTSVEAGRAGEL-ASYPLANQLQR-LGFTLGRMKTGTPAR
MNMG_SYNAS       AKAVVITTGTFLNGLVHVG-TSHYPAGRAGEI-ASISLANCLRK-MGFEMGRMKTGTPPR
MNMG_CHLTE       AKAAILACGTFLNGLIHIG-MDHFPGGRSTAEPPVEGLTESL-ASLGFSFGRLKTGTPPR
MNMG_CHLCH       GKSAILTCGTFLNGLIHVG-MNHFAGGRTIAEPPVVGLTENL-CAHGFQAGRLKTGTPPR
MNMG_CHLPM       AGAAILTCGTFLNGLIHIG-MNHFPGGRTIAEPPVTGLTESL-VAAGFTTARLKTGTPPR
MNMG_CHLL3       GRAAILTCGTFLNGLIHIG-MDHYPGGRTIAEPPVTGLTENL-ILAGFEAGRLKTGTPPR
MNMG_CHLPD       GKSVILCCGTFLNGLIHIG-MNHFPGGRTIAEPPVSGLTENL-QSLGFRAGRLKTGTPPR
MNMG_BACFR       ARCIVLTAGTFLNGLMHVG-KTQLPGGR-MAEPASYKLTESI-AKHGIEYGRMKTGTPVR
MNMG_BACFN       ARCIVLTAGTFLNGLMHVG-KTQLPGGR-MAEPASYKLTESI-AEHGIEYGRMKTGTPVR
MNMG_BACTN       AKCIVLTAGTFLNGLMHVG-RHQLPGGR-MAEPASYQLTESI-ARHGIAYGRMKTGTPVR
MNMG_PHOV8       AKCIVLTAGTFLNGLMHIG-HKQLAGGR-MAEPASYHLTESI-TRHGITAGRMKTGTPVR
MNMG_PARD8       AGAVVLTNGTFLNGLLHIG-RTQIRGGR-IAEPAATGLTEQL-ISLGIQTDRMKTGTPVR
MNMG_PORGI       ARTVVLTTGTFLGGVMHFG-ERMIEGGR-IAEPAFHGITEQL-RDLGFRTDRMKTGTPAR
MNMG_FLAJ1       SKSVVLTNGTFLNGLIHIG-EKQFGGGR-AGESAATGITEDL-VKAGFEAGRMKTGTPPR
MNMG_FLAPJ       GKSVVLTNGTFLNGLIHIG-DKQFGGGR-AGESAAYGITEDL-VKAGFESGRMKTGTPPR
MNMG_GRAFK       AKSVVCTNGTFLNGLIHIG-DKQFGGGR-AGERAATGITKDL-IEVGFEAGRMKTGTPPR
MNMG_CYTH3       CKSVVLTNGTFLNGIIHIG-EKKLGGGR-TGEKAATGITEQL-VELGFESGRMKTGTPPR
MNMG_SULMW       SKSVILTNGTFLNGIIHIG-DKKNSGGR-ISENSVKGLTEKL-KKIGFFSGRMKTGTSPR
MNMG_SALRD       APCVVLTTGTFSNGVIHVG-EQNFGGGR-IGESASHGITGCL-HDLGFESGRLKTGTPPR
MNMG_BORAP       SSVVVLTTGTFLRGKIFIG-EYRANMGR-LAEFSAYGLDKTL-LGLGFEMGRLKTGTPAR
MNMG_BORBP       SNVVVLTTGTFLRGKIFIG-EYRANMGR-LAEFSAYGLDKTL-LSLGFEMGRLKTGTPAR
MNMG_BORBU       SSVVVLTTGTFLRGKIFIG-EYRADMGR-LAEFSAYGLDKTL-LGLGFEMGRLKTGTPAR
MNMG_TREDE       AKAVVLATGTFMEGKIYIG-EYESPDGR-LGERAAIGLGPAL-AKKGFTVGRLKTGTPMR
MNMG_TREPA       ARAVVLTTGTFMEGRVYIG-EYEAPEGR-LGEHAAEGLGAAL-RKKGFQMGRLKTGTPAR
MNMG1_FUSNN      AKVIVLATGTFLKGKIVIG-DVSYSAGR-QGETSAEKLSDSL-RELGIKIERYQTATPPR
MNMG2_FUSNN      AKAVIIATGTFLRGLIHIG-EINFSAGR-MGELSSEELPLSL-EKIGLKLERFKTGTPTR
MNMG_ENDTX       ADAVVITTGTFLKGTIHLG-KMHFNGGR-FNEVSALYLSKSLIEDCGLKLGRFKTTTTPR
MNMG_ONYPE       AKTVIITTGTYLASQILIG-DTKKSSGP-NGVPTTYGISTQL-KELGFEVIRLKTGTPPR
MNMG_AYWBP       AKTVIITTGTYLASQILIG-DTKKASGP-NGVPTTYGISTQL-KEIGFEVIRLKTGTPPR
MNMG_ACHLI       AQTVIITTGTYLGSQILIG-HEKTSSGP-NGERTTRGISNQL-KNLGFEMLRLKTGTPPR
MNMG_MYCCT       AKAVIITTGTYLKSEILKG-IDRYESGP-NNEKTTKGISKSL-IDLGIKLMRFKTGTPAR
MNMG_MYCMS       AKAVIITTGTYLKSEILKG-VDRYESGP-NNEKTTKGISQSL-IDLGIKLMRFKTGTPAR
MNMG_MESFL       SKCVVLTTGTYLKSEILTG-HEKFSSGP-NEEPTSNGISESL-KKSGVELFRFKTGTPPR
MNMG_MYCGE       SDAVIITTGTYLRSKTYCG-NTVKNQGP-DQSKNSEKLSTNL-INRGFKTIRLKTGTPPR
MNMG_MYCPN       SDAVIVTTGTYLKAKTYCG-SLSKEEGP-DRAKRSEYLSTNL-IKRGFKTLRLKTGTPPR
MNMG_MYCGA       AGAVIITTGTYLKSLTFSG-KDVKNEGP-EGFKNSNNLSEWF-KVNGFELIRLKTGTPPR
MNMG_UREPA       ADYVIITTGTYLKSITHRG-SVCVDEGA-DGTKNAKFLSDAL-VKLGFELIRLKTGTPAR
MNMG_UREP2       ADYVIITTGTYLKSITHRG-SVCVDEGA-DGTKNAKFLSDAL-VKLGFELIRLKTGTPAR
MNMG_MYCPE       SNYLIVTTGTFLDSSIHIG-HKVIKKGP-DDFNGSYLLAKQI-KELDFQTIRLKTGTPPR
MNMG_MYCH7       SKTVIITTGTYMDSKVLRG-SLAIPSGP-DGQQTSNLLSNNL-KRLGFELQRLKTGTPPR
MNMG_MYCHJ       SKTVIITTGTYMDSKVLRG-SLAIPSGP-DGQQTSNLLSNNL-KRLGFELQRLKTGTPPR
MNMG_MYCH2       SKTVIITTGTYMDSKVLRG-SLAIPSGP-DGQQTSNLLSNNL-KTLGFELQRLKTGTPPR
MNMG_MYCPU       SNLVVMTTGTYMNSRILRG-SDIEHTGP-NGEKTGIGLSKAL-ERLGFELIRLKTGTPPR
MNMG_MYCS5       AKVCVLTTGTYMNSQILRG-SSVTVSGP-DGQKTTNKISESL-KKLGFELQRFKTGTPAR
MNMG_MYCMO       TKTAIITAGTYLDSYILRG-EEKYSSGP-DGEKTSNSLSNSL-IKLGFKLLRLKTGTPPR
MNMG_MYCAP       AKVCVITTGTYMNSRILRG-QDITTSGP-DNEKTTPKLSASL-AKLGFTLQRLKTGTPPR
MNMG_THEM4       AKAVILTTGTFLRGKIFIG-RDTMEAGR-MGDLPAKGLSKSL-MDIGFKLSRFKTGTPSR
MNMG_FERNB       AKAVILTTGTFLRGKIFIG-RETMEAGR-MGDFSARGLTNSL-IKLGFTVGRFKTGTPAR
MNMG_THEMA       GKAVIVTTGTFLRGKIFIG-RSTFPAGR-MGEFPATKLTESL-IELGFEVGRFKTGTPAR
MNMG_THESQ       GKAVIVTTGTFLRGKIFIG-RSTFPAGR-MGEFPATKLTESL-IELGFEVGRFKTGTPAR
MNMG_THEP1       GKAVIVTTGTFLRGKIFIG-RSTFPAGR-MGEFPATKLTESL-IELGFEVGRFKTGTPAR
MNMG_PETMO       AKVVILTTGTFLRGKIFVG-RNTFEAGR-MGELPANSLTYSL-IKEGLEVSRFKTGTPAR
MNMG_BDEBA       GKATIITTGTFMNGVMHIG-LRQEAGGR-VGDQPSIGLSDQL-AQFGFEVKRLKTGTPAR
MNMG_ALKMQ       SHSVILATGVYLRGKIYIG-EVNYESGPNGLF-PSMHLSEKL-TKLGCNMRRFKTGTPAR
MNMG_ALKOO       GKAVILATGVYLKSKIFMG-EVNYESGPNGLF-PALYLSEKL-KALGCNMRRFKTGTPAR
MNMG_CLOD6       SKAVILATGVYLNSKIYMG-EVAFYEGPNALG-YAKYLTDSL-VELGLRMRRFKTGTPAR
MNMG_FINM2       TRAVILATGTYLKGLVMMG-EYTYESGPHGMK-SSKKLSYSL-KNLGIELRRFKTGTPAR
MNMG_CALS8       AKAVVLATGTFLGGRIIIG-ETVYDGGPDGMH-PAKYLTESL-KKLGIEMMRFKTGTPAR
MNMG_ACET2       SKVVILATGTYLKGKIIIG-DVSYSGGPDGLF-PANKLSDSL-REMGIELMRFKTGTPAR
MNMG1_CALS4      CKACIITTGTFLKGRVIIG-EVDFESGPSGLF-PASELSEAL-KRLGFKLMRFKTGTPPR
MNMG2_CALS4      CKACIITTGTFLRGRVIIG-EVGFESGPSGLF-PAKELSEAI-KRLGFKMMRFNTSTPPR
MNMG_THEP3       CKACIITTGTFLKGRVIIG-DVSFDSGPSGLF-PANQLSETL-KRLGFKLMRFKTGTPAR
MNMG_THEPX       CKACIITTGTFLKGRVIIG-DVSFDSGPSGLF-PANQLSETL-KRLGFKLMRFKTGTPAR
MNMG_CLOB1       TKAIILCTGTYLKGKIIIG-DIIYSSGPSGLY-PANDLSQSL-LDLGINLRRFKTGTPAR
MNMG_CLOBH       TKAIILCTGTYLKGKIIIG-DIIYSSGPSGLY-PANDLSQSL-LDLGINLRRFKTGTPAR
MNMG_CLOBL       TKAIILCTGTYLKGKIIIG-DIIYSSGPSGLY-PANDLSQSL-LDLGINLRRFKTGTPAR
MNMG_CLOBK       TKAIILCTGTYLKGKIIIG-DIIYSSGPSGLY-PANDLSQSL-LNLGINLRRFKTGTPAR
MNMG_CLOBM       TKAIILCTGTYLKGKIIIG-DIIYSSGPSGLY-PANDLSQSL-LDLGINLRRFKTGTPAR
MNMG_CLONN       VKAAILCTGVYLKSRIIIG-DINYEGGPSGLA-PANMLSQSL-IESGIKITRFKTGTPAR
MNMG_CLOAB       ANTIVLATGTYLRSRIIIG-EVNYSGGPSGLF-PANELSQSL-IDVGIKLRRFKTGTPAR
MNMG_CLOTE       AKTVVLATGTYLNARIIIG-EVAYSGGPNGLF-PAKELTKNL-MDLGISIRRFKTGTPAR
MNMG_CLOK5       TKTIVLSTGTYLKGKVIIG-DVSYSSGPNGFM-PANDLSQSL-LDLGIEIRRFKTGTPAR
MNMG_CLOP1       CKAVIMTSGTYLQSRIIIG-DVSYSQGPNGLS-NANELSKSL-IDLGIDLRRFKTGTPAR
MNMG_CLOPS       CKAVIMTSGTYLQSRIIIG-DVSYSQGPNGLS-NANELSKSL-IDLGIDLRRFKTGTPAR
MNMG_CLOPE       CKAVIMTSGTYLQSRIIIG-DVSYSQGPNGLS-NANELSKSL-IDLGIDLRRFKTGTPAR
MNMG_CLOB8       CKAVILATGTYLKGKIIIG-EVSYSGGPNGLF-PANDLSQSL-LDLGVSLRRFKTGTPAR
MNMG_LACP7       CKVVILCTGVYLNARCIYG-ETSHYTGPNGLP-SANHLTESL-KKLGIEMYRFKTGTPAR
MNMG_NATTJ       CEQLVITSGTYLKGRIIVG-DVDYSGGPNGQQ-AAYGLSEDF-KQHGISLMRFKTGTPAR
MNMG_BACVZ       AKTVVLTTGTYLRGRIILG-DLSYSSGPNNQQ-PSIKLSEHL-EELGFDLVRFKTGTPPR
MNMG_BACSU       AKAVVMTTGTYLRGRIILG-DLSYSSGPNNQQ-PSIKLSEHL-EELGFDLVRFKTGTPPR
MNMG_BACLD       SKTVVLTTGTFLRGKIILG-DLSYSSGPNNQQ-PSIKLSEHL-EELGFDLVRFKTGTPPR
MNMG_BACP2       AKSVVLTTGTFLKGRIILG-DLSYSSGPNNQQ-PSIKLSDHL-ADLGFDLVRFKTGTPPR
MNMG_BACAH       AKTVVITTGTFLRGEIIMG-DLKYSSGPNNQQ-PSITLSEHL-EELGFDLVRFKTGTPPR
MNMG_BACHK       AKTVVITTGTFLRGEIIMG-DLKYSSGPNNQQ-PSITLSEHL-EELGFDLVRFKTGTPPR
MNMG_BACAN       AKTVVITTGTFLRGEIIMG-DLKYSSGPNNQQ-PSITLSEHL-EELGFDLVRFKTGTPPR
MNMG_BACCZ       AKTVVITTGTFLRGEIIMG-DLKYSSGPNNQQ-PSITLSEHL-EELGFDLVRFKTGTPPR
MNMG_BACC1       AKTVVITTGTFLRGEIIMG-DLKYSSGPNNQQ-PSITLSEHL-EELGFDLVRFKTGTPPR
MNMG_BACCR       AKTVVITTGTFLRGEIIMG-DLKYSSGPNNQQ-PSITLSEHL-EELGFDLVRFKTGTPPR
MNMG_BACMK       AKTVVITTGTFLRGEIIMG-DLKYSSGPNNQQ-PSITLSEHL-EELGFDLVRFKTGTPPR
MNMG_BACCN       AKTVVITTGTFLRGEIIMG-DLKYSSGPNNQQ-PSITLSEHL-EELGFELVRFKTGTPPR
MNMG_GEOKA       AKAVVITTGTFLRGEIIIG-DIKYSSGPNNQQ-PSIKLSEHL-EELGFELVRFKTGTPPR
MNMG_GEOTN       AKAVVITTGTFLRGEIIIG-DIKYSSGPNNQQ-PSIKLSEHL-EELGFELVRFKTGTPPR
MNMG_LYSSC       AKTVVVTTGTFLRGEIIIG-DIKYSSGPNNQQ-PSIRLADNL-KELGFDLVRFKTGTPPR
MNMG_STAA2       SKAVIITTGTFLRGEIILG-NMKYSSGPNHQL-PSITLSDNL-RELGFDIVRFKTGTPPR
MNMG_STAA9       SKAVIITTGTFLRGEIILG-NMKYSSGPNHQL-PSITLSDNL-RELGFDIVRFKTGTPPR
MNMG_STAAR       SKAVIITTGTFLRGEIILG-NMKYSSGPNHQL-PSITLSDNL-RELGFDIVRFKTGTPPR
MNMG_STAAS       SKAVIITTGTFLRGEIILG-NMKYSSGPNHQL-PSITLSDNL-RELGFDIVRFKTGTPPR
MNMG_STAA1       SKAVIITTGTFLRGEIILG-NMKYSSGPNHQL-PSITLSDNL-RELGFDIVRFKTGTPPR
MNMG_STAAM       SKAVIITTGTFLRGEIILG-NMKYSSGPNHQL-PSITLSDNL-RELGFDIVRFKTGTPPR
MNMG_STAAW       SKAVIITTGTFLRGEIILG-NMKYSSGPNHQL-PSITLSDNL-RELGFDIVRFKTGTPPR
MNMG_STAAN       SKAVIITTGTFLRGEIILG-NMKYSSGPNHQL-PSITLSDNL-RELGFDIVRFKTGTPPR
MNMG_STAAB       SKAVIITTGTFLRGEIILG-NMKYSSGPNHQL-PSITLSDNL-RELGFDIVRFKTGTPPR
MNMG_STAA8       SKAVIITTGTFLRGEIILG-NMKYSSGPNHQL-PSITLSDNL-RELGFDIVRFKTGTPPR
MNMG_STAA3       SKAVIITTGTFLRGEIILG-NMKYSSGPNHQL-PSITLSDNL-RELGFDIVRFKTGTPPR
MNMG_STAAC       SKAVIITTGTFLRGEIILG-NMKYSSGPNHQL-PSITLSDNL-RELGFDIVRFKTGTPPR
MNMG_STAAE       SKAVIITTGTFLRGEIILG-NMKYSSGPNHQL-PSITLSDNL-RELGFDIVRFKTGTPPR
MNMG_STAAT       SKAVIITTGTFLRGEIILG-NMKYSSGPNHQL-PSITLSDNL-RELGFDIVRFKTGTPPR
MNMG_STAES       SKAVIITTGTFLRGEIILG-NLKYSSGPNHQL-PSVTLADNL-RKLGFDIVRFKTGTPPR
MNMG_STAEQ       SKAVIITTGTFLRGEIILG-NLKYSSGPNHQL-PSVTLADNL-RKLGFDIVRFKTGTPPR
MNMG_STAHJ       AQAVVITTGTFLRGEIILG-NMKYSSGPNHQL-PSITLADNL-RELGFEVVRFKTGTPPR
MNMG_STAS1       SEAVIITTGTFLRGEIILG-NMKYSSGPNHQL-PSISLADNL-RGLGFEVVRFKTGTPPR
MNMG_LISMO       AKTVVITTGTFSRGEIIVG-ELRYSSGPNNQQ-PSVKLSEHL-EELGFELRRFKTGTPPR
MNMG_LISMF       AKTVVITTGTFSRGEIIVG-ELRYSSGPNNQQ-PSVKLSEHL-EELGFELRRFKTGTPPR
MNMG_LISIN       AKTVVITTGTFSRGEIIVG-ELRYSSGPNNQQ-PSVKLSEHL-EELGFELRRFKTGTPPR
MNMG_LISW6       AKTVVITTGTFSRGEIIVG-ELRYSSGPNNQQ-PSVKLSEHL-EELGFELRRFKTGTPPR
MNMG_OCEIH       ADSVIVTTGTFMRGKVLMG-DLEYESGPNNQR-VSIKLSEDL-EKHGFEITRFKTGTPPR
MNMG_BACSK       AKAVVVTTGTYLRGKIILG-ELSYESGPNNMQ-PSIKLSDHL-KELGFDLVRFKTGTPPR
MNMG_ALKHC       AKAVVVTTGTYLRGKIIIG-DLAYESGPNNMQ-PSINLSYHL-QELGFEMVRFKTGTPPR
MNMG_EXIS2       AKAVIITTGTFMRGKIIIG-ELSYESGPNNQM-PSVNLSKHL-EELGFELARFKTGTPPR
MNMG_LEVBA       AKAVVIAAGTAARGKIIIG-ELMYSSGPNNSQ-PATKLTANL-PKYGFDLERFKTGTPPR
MNMG_LACPL       AKSVVLTTGTAARGKIIIG-ELMYSSGPNNSQ-PAMKLSGDL-ERLGFNLERFKTGTPPR
MNMG_PEDPA       AKSVVLTLGTAARGKIIIG-ELQYSSGPNNSQ-AALELTKNLTEKYHFDLERFKTGTPPR
MNMG_LACS1       AKSVVLTTGTAARGKIIIG-ELMYSSGPNNTQ-PALELSKNL-AKLGFELKRFKTGTPPR
MNMG_ENTFA       SQAVVITAGTALRGEIIIG-ELKYSSGPNNSQ-PSVGLANHL-KELGLEIDRFKTGTPPR
MNMG_LACSS       ADSVILTAGTASRGKIIIG-ELTYSSGPNNSI-PSIKLSESL-EDNGFVLTRFKTGTPPR
MNMG_LACP3       AKSVVLTAGTSSRGKIIIG-ELMYSSGPNNSL-PSIKLSENL-EQLGFKLRRFKTGTPPR
MNMG_LACAC       AKSVVLTTGTAARGKIIIG-ELMYSSGPNNTT-PSIKLSENL-EKLGFKLRRFKTGTPPR
MNMG_LACH4       AKSVVLTTGTAARGKIIIG-ELTYSSGPNNTT-PSIKLSENL-EKLGFKLRRFKTGTPPR
MNMG_LACJO       AKSVVLTTGTAARGKIIIG-ELAYSSGPNNSL-PSIKLPENL-EKLGFKLRRFKTGTPPR
MNMG_LACGA       AKSVVLTTGTAARGKIIIG-ELTYSSGPNNSL-PSIKLPENL-EKLGFKLRRFKTGTPPR
MNMG_LACDA       AKSVVLTTGTAARGRIFIG-ELNYSSGPNNTI-PAIKLSESL-ERLGFKLRRFKTGTPPR
MNMG_LACDB       AKSVVLTTGTAARGRIFIG-ELNYSSGPNNTI-PAIKLSESL-ERLGFKLRRFKTGTPPR
MNMG_LACLM       AKAVIITTGTALRGEIIIG-ELKYSSGPNNSL-SSIGLADNL-REIGFEIGRFKTGTPPR
MNMG_LACLS       AKAVIITTGTALRGEIIIG-ELKYSSGPNNSL-SSIGLADNL-HEIGFEIGRFKTGTPPR
MNMG_LACLA       AKAVIITTGTALRGEIIIG-ELKYSSGPNNSL-SSIGLADNL-REIGFEIGRFKTGTPPR
MNMG_STRA3       AKSVVITTGTALRGEIILG-DLKYSSGPNNSL-ASVTLADNL-RDLGLEIGRFKTGTPPR
MNMG_STRA5       AKSVVITTGTALRGEIILG-DLKYSSGPNNSL-ASVTLADNL-RDLGLEIGRFKTGTPPR
MNMG_STRA1       AKSVVITTGTALRGEIILG-ELKYSSGPNNSL-ASVTLADNL-RDLGLEIGRFKTGTPPR
MNMG_STRP1       AKAVVVTTGTALRGEIILG-ELKYSSGPNNSL-ASVTLADNL-KKLGLEIGRFKTGTPPR
MNMG_STRPD       AKAVVVTTGTALRGEIILG-ELKYSSGPNNSL-ASVTLADNL-KKLGLEIGRFKTGTPPR
MNMG_STRPB       AKAVVVTTGTALRGEIILG-ELKYSSGPNNSL-ASVTLADNL-KKLGLEIGRFKTGTPPR
MNMG_STRPC       AKAVVVTTGTALRGEIILG-ELKYSSGPNNSL-ASVTLADNL-KKLGLEIGRFKTGTPPR
MNMG_STRPG       AKAVVVTTGTALRGEIILG-ELKYSSGPNNSL-ASVTLADNL-KKLGLEIGRFKTGTPPR
MNMG_STRP8       AKAVVVTTGTALRGEIILG-ELKYSSGPNNSL-ASVTLADNL-KKLGLEIGRFKTGTPPR
MNMG_STRPF       AKAVVVTTGTALRGEIILG-ELKYSSGPNNSL-ASVTLADNL-KKLGLEIGRFKTGTPPR
MNMG_STRPM       AKAVVVTTGTALRGEIILG-ELKYSSGPNNSL-ASVTLADNL-KKLGLEIGRFKTGTPPR
MNMG_STRP3       AKAVVVTTGTALRGEIILG-ELKYSSGPNNSL-ASVTLADNL-KKLGLEIGRFKTGTPPR
MNMG_STRP6       AKAVVVTTGTALRGEIILG-ELKYSSGPNNSL-ASVTLADNL-KKLGLEIGRFKTGTPPR
MNMG_STRT2       AKAVVVTTGTALRGEIIIG-DLKYSSGPNNSL-ASVTLADNL-KELGLEIGRFKTGTPPR
MNMG_STRT1       AKAVVVTTGTALRGEIIIG-DLKYSSGPNNSL-ASVTLADNL-KELGLEIGRFKTGTPPR
MNMG_STRTD       AKAVVVTTGTALRGEIIIG-DLKYSSGPNNSL-ASVTLADNL-KELGLEIGRFKTGTPPR
MNMG_STRMU       AQAVIVTTGTALRGEIILG-ELKYSSGPNNSL-ASVTLADNL-RDLGLEIGRFKTGTPPR
MNMG_STRGC       AKAVIVTTGTALRGEIIIG-DLKYSSGPNHSL-AAIPLADNL-RDLGFEIGRFKTGTPPR
MNMG_STRSV       AKAVIVTTGTALRGEIIIG-DLKYSSGPNHSL-AAIPLADNL-RDLGFEIGRFKTGTPPR
MNMG_STRR6       AKAVIVTTGTALRGEIIIG-DLKYSSGPNHSL-ASINLADNL-KELGLEIGRFKTGTPPR
MNMG_STRP2       AKAVIVTTGTALRGEIIIG-DLKYSSGPNHSL-ASINLADNL-KELGLEIGRFKTGTPPR
MNMG_STRPN       AKAVIVTTGTALRGEIIIG-DLKYSSGPNHSL-ASINLADNL-KELGLEIGRFKTGTPPR
MNMG_STRPI       AKAVIVTTGTALRGEIIIG-DLKYSSGPNHSL-ASINLADNL-KELGLEIGRFKTGTPPR
MNMG_STRSY       AKAVVVTTGTALRGEIIIG-DLKYSSGPNNSL-ASITLADNL-KELGLEIGRFKTGTPPR
MNMG_STRS2       AKAVVVTTGTALRGEIIIG-DLKYSSGPNNSL-ASITLADNL-KELGLEIGRFKTGTPPR
MNMG_DESRM       ARAVVVTTGTYLKGRIIIG-NVHFPGGPNSQF-PSVNLSENL-RSLGLELGRFKTGTPAR
MNMG_PELTS       AGAVVLTTGTYLKGRIIIG-DLSFPGGPNGQF-PSVTLSDCL-ADLGIKLGRFKTGTPAR
MNMG_CARHZ       SRAVVVTSGTYLNSRIIIG-DVHYPSGPAGFP-YASLLSKSL-ADLGFKLGRFKTGTPAR
MNMG_MOOTA       CRAIVLTTGTYLRGRIIIG-EVAYAGGPNGQF-PAIELAASL-KELGLRMGRFKTGTPPR
MNMG_HELMI       APALVITTGTYLRGRIIIG-DLHYPGGPNGYF-PSVALAASL-RDIGVRLGRFKTGTPAR
MNMG_SYNWW       CQALVLTTGTYLKGRIIVG-DISFDGGPGNQF-PAARLSESL-KRMGLRLGRFKTGTPPR
MNMG_DESAP       APAVIVTTGTYLRSRVLVG-ETSFESGPNGQF-PAVGLAANL-RENGFELGRFKTGTPPR
MNMG_SYMTH       AKAVVLSTGTYLHGRTIIG-EVQRSSGPGGLA-PAVGLTESL-KRLGFEVGRFKTGTPPR
MNMG_DESHY       APNVILTSGTYLRGRIIIG-DAMYEGGPNGQQ-TAMNLSGAL-KELGLELGRFKTGTPPR
MNMG_ROSCS       SRALVLTTGTFLRGRAITG-EAIWGAGRAGEA-PATALGEDL-AALGFPLVRLKTGTPPR
MNMG_ROSS1       CRALVLTTGTFLRGRAITG-DAIWGAGRAGEA-PATALGEDL-AALGFPLVRLKTGTPPR
MNMG_CHLAA       APAVILTTGTFLRGRAITG-EAMWGAGRAGEA-PAMALSEDL-AALGFPLVRLKTGTPPR
MNMG_DEIRA       ARSVVLAAGTFMRGVTWYG-RQSRPEGRQGEP-PSRFLSAPLER-GGHVLKRYKTGTPPR
MNMG_DEIGD       ARSVVVAAGTFMRGVTWYG-RYSRPEGRQGEP-PSRFLSAPLAR-AGHRLKRYKTGTPPR
MNMG_THET2       AKAVVVAGGTFLSGVVWYG-RKSRPAGRQGEP-PARFLSQSLKA-VGHTLRRFKTGTPPR
MNMG_THET8       AKAVVVAGGTFLSGVVWYG-RKSRPAGRQGEP-PARFLSQSLKA-VGHTLRRFKTGTPPR
MNMG_MYXXD       ASAVLLTTGTFLQALMHVG-EQKEVGGRLGDD-AARGLSESLRA-LGFTLGRFKTGTPAR
                         *    .    *       *          :             * .* *  *

MNMG_NOSS1       VDKRSVDYSKMQLQPGDA-----------EVRWFSFDP----------------------
MNMG_TRIV2       VDKRSVDYSKMQLQPGDE-----------EVRWFSFDP----------------------
MNMG_TRIEI       VDKRSVDYTDLEAQPGDE-----------KVRWFTFDP----------------------
MNMG_SYNY3       VDRRSVDYDKLEPQPPDE-----------QVSWFSFDP----------------------
MNMG_SYNP2       VDRRSVDYSKMEIQPADE-----------EVRWFSFDP----------------------
MNMG_MICAN       VDKRSVDYSRMEPQPPDD-----------EVRWFSFDP----------------------
MNMG_ACAM1       VDKRSADFSVMEPQPPDQ-----------QVRWFSFDP----------------------
MNMG_SYNP6       VDKRSVDYSRLEPQPGDP-----------EVRWFSFDP----------------------
MNMG_SYNE7       VDKRSVDYSRLEPQPGDP-----------EVRWFSFDP----------------------
MNMG_THEEB       VDRRSVDYSKMEPQPPDE-----------QVRWFSFDP----------------------
MNMG_SYNJB       VDRRSVDFSVMERQPGDP-----------DVRWFSFDP----------------------
MNMG_SYNJA       VDRRSVDFSVMERQPGDP-----------DLRWFSFDP----------------------
MNMG_PROM1       VDRRTIDLDSLDEQLSDA-----------SDKFFSFDP----------------------
MNMG_PROMT       VDRRTIDLDSLDEQLSDA-----------SDKFFSFDP----------------------
MNMG_PROMA       VDRRTIDLGSLEEQKSDA-----------ADRFFSFDP----------------------
MNMG_PROM3       VDRRSIALDQLEEQPSDA-----------ADRFFSFDP----------------------
MNMG_PROMM       VDRRSIALDQLEEQPSDA-----------ADRFFSFDP----------------------
MNMG_SYNSC       VDRRSIALDQLEEQPSDA-----------ADRFFSFDP----------------------
MNMG_SYNPX       VDRRSIALDQLEEQPSDA-----------ADHFFSFDP----------------------
MNMG_SYNS9       VDRRSIALDQLEEQPSDA-----------ADRFFSFDP----------------------
MNMG_SYNPW       VDRRSIALDQLEEQPSDA-----------ADRFFSFDP----------------------
MNMG_SYNS3       VDRRSIALDQLEAQPSDA-----------ADRFFSFDP----------------------
MNMG_SYNR3       VDRRSVALETLEEQPSDA-----------HERWFSFDP----------------------
MNMG_PROMS       VDKRSIIFDELDVQPSTA-----------VDKYFSFDP----------------------
MNMG_PROM0       VDKRSIIFDDLDIQPSTA-----------ADKYFSFDP----------------------
MNMG_PROM9       VDKRSIIFDELDAQPSTA-----------ADKYFSFDP----------------------
MNMG_PROM2       VDKKSIIFDELDTQPSTA-----------AGKYFSFDP----------------------
MNMG_PROM5       VDKKSISFDALDIQPSTA-----------SDKYFSFDP----------------------
MNMG_PROMP       VDKKSISFDELDIQPSTA-----------SDKYFSFDP----------------------
MNMG_CHLTR       LLASSIDFSVMEEQPGDHN------------VCFVHRNEMFVPTL---------------
MNMG_CHLTA       LLASSIDFSVMEEQPGDHN------------VCFVHRNEMFVPTL---------------
MNMG_CHLT2       LLASSIDFSVMEEQPGDHN------------VCFVHRNEMFVPTL---------------
MNMG_CHLTB       LLASSIDFSVMEEQPGDHN------------VCFVHRNEMFVPTL---------------
MNMG_CHLMU       LLSSSIDFSIMEEQPGDQN------------VCFVHREEAFVPKL---------------
MNMG_CHLAB       LLASSIDFSVTEEQPGDPG------------VGFVHRSEPFVPPL---------------
MNMG_CHLCV       LLASSIDFSVAEEQPGDPG------------VGFVHRDEPFVPPL---------------
MNMG_CHLFF       LLASSIDFSVTEEQPGDPG------------VGFVHRDEPFVPPL---------------
MNMG_CHLPN       LLASSINFSCMEEQPGDLG------------VGFVHRTEPFQPPL---------------
MNMG_PARUW       INKRSIDFSCTEEQPGDPG------------VKFSYDNE-GIPRL---------------
MNMG_RHOBA       LNARTIDYSGLEEQPGDDDP-----------QPFSYLNDAIS------------------
MNMG_OPITP       LLGRSLDFSKMEEQKGDANP-----------TFFAFHDTREDGGVFHVEHGKPQG-----
MNMG_AQUAE       LDKRTIDFSALEVAPGDDPP-----------PKFSFWTEPVGSYWFP-------------
MNMG_ECOLI       IDARTIDFSVLAQQHGDN-----------PMPVFSFM-----------------------
MNMG_ECOL6       IDARTIDFSVLAQQHGDN-----------PMPVFSFM-----------------------
MNMG_ECO24       IDARTIDFSVLAQQHGDN-----------PMPVFSFM-----------------------
MNMG_ECODH       IDARTIDFSVLAQQHGDN-----------PMPVFSFM-----------------------
MNMG_ECOL5       IDARTIDFSVLAQQHGDN-----------PMPVFSFM-----------------------
MNMG_ECOHS       IDARTIDFSVLAQQHGDN-----------PMPVFSFM-----------------------
MNMG_ECOLC       IDARTIDFSVLAQQHGDN-----------PMPVFSFM-----------------------
MNMG_SHIBS       IDARTIDFSVLAQQHGDN-----------PMPVFSFM-----------------------
MNMG_SHISS       IDARTIDFSVLAQQHGDN-----------PMPVFSFM-----------------------
MNMG_ECOUT       IDARTIDFSVLAQQHGDN-----------PMPVFSFM-----------------------
MNMG_ECOK1       IDARTIDFSVLAQQHGDN-----------PMPVFSFM-----------------------
MNMG_ECOSM       IDARTIDFSVLAQQHGDN-----------PMPVFSFM-----------------------
MNMG_ECO57       IDARTIDFSVLAQQHGDN-----------PMPVFSFM-----------------------
MNMG_SHIDS       IDARTIDFSVLAQQHGDN-----------PMPVFSFM-----------------------
MNMG_SHIFL       IDARTIDFSVLAQQHGDN-----------PMPVFSFM-----------------------
MNMG_SHIF8       IDARTIDFSVLAQQHGDN-----------PMPVFSFM-----------------------
MNMG_SALCH       IDARTIDFSVLAQQHGDN-----------PMPVFSFM-----------------------
MNMG_SALTY       IDARTIDFSVLAQQHGDN-----------PMPVFSFM-----------------------
MNMG_SALPB       IDARTIDFSVLAQQHGDN-----------PMPVFSFM-----------------------
MNMG_SALPA       IDARTIDFSVLAQQHGDN-----------PMPVFSFM-----------------------
MNMG_SALTI       IDARTIDFSVLAQQHGDN-----------PMPVFSFM-----------------------
MNMG_CITK8       IDARTIDFSVLAQQHGDN-----------PMPVFSFM-----------------------
MNMG_SALAR       IDARTIDFSVLAQQHGDN-----------PMPVFSFM-----------------------
MNMG_ENT38       IDARTIDFSVLAQQHGDT-----------PIPVFSFM-----------------------
MNMG_KLEP7       IDARTIDFSVLAQQHGDN-----------PMPVFSFM-----------------------
MNMG_CROS8       IDARTIDFSVLDQQHGDN-----------PMPVFSFM-----------------------
MNMG_PECAS       IDARTIDFSVLPQQHGDN-----------PMPVFSFL-----------------------
MNMG_YERPE       IDARTIDFSQLTPQLGDT-----------PIPVFSFL-----------------------
MNMG_YERPY       IDARTIDFSQLTPQLGDT-----------PIPVFSFL-----------------------
MNMG_YERPA       IDARTIDFSQLTPQLGDT-----------PIPVFSFL-----------------------
MNMG_YERPN       IDARTIDFSQLTPQLGDT-----------PIPVFSFL-----------------------
MNMG_YERPP       IDARTIDFSQLTPQLGDT-----------PIPVFSFL-----------------------
MNMG_YERPS       IDARTIDFSQLTPQLGDT-----------PIPVFSFL-----------------------
MNMG_YERP3       IDARTIDFSQLTPQLGDT-----------PIPVFSFL-----------------------
MNMG_YERE8       IDARTIDFSQLAPQLGDT-----------PIPVFSFL-----------------------
MNMG_SERP5       IDARSIDFSVLAPQHGDT-----------PIPVFSFM-----------------------
MNMG_PHOLL       IDARTIDFSQLTQQLGDN-----------PTPVFSFL-----------------------
MNMG_SODGM       IDAHSIDFSRLATQHGDD-----------PLPVFSFL-----------------------
MNMG_VIBCH       IDANSVDFSVLEAQHGDN-----------PTPVFSFM-----------------------
MNMG_VIBC3       IDANSVDFSVLEAQHGDN-----------PTPVFSFM-----------------------
MNMG_VIBCB       IDARSVDFSVLEAQHGDN-----------PTPVFSFM-----------------------
MNMG_VIBPA       IDARTVDFSVLEAQHGDN-----------PTPVFSFM-----------------------
MNMG_VIBVU       IDARSVDFSVLEAQHGDN-----------PTPVFSFM-----------------------
MNMG_VIBVY       IDARSVDFSVLEAQHGDN-----------PTPVFSFM-----------------------
MNMG_ALIF1       IDARSVDFSGLEAQPGDN-----------PTPVFSFL-----------------------
MNMG_PHOPR       IDARTVDFSRLQAQHGDN-----------PIPTFSFM-----------------------
MNMG_AERHH       IDARSVDLSVMQAQYGDD-----------PRPVFSFI-----------------------
MNMG_AERS4       IDARSVDLSVMQAQYGDD-----------PRPVFSFI-----------------------
MNMG_COLP3       LDARSLDFSVMEEQAGDT-----------PSPVFSFM-----------------------
MNMG_PSEA6       LDARTLDYSVMQEQLGDS-----------PTPVFSFM-----------------------
MNMG_IDILO       IASHSVDFSVMQEQPGDN-----------PTPVFSYM-----------------------
MNMG_PSET1       IDARTVDFSKMQEQAGDT-----------PIPVFSFM-----------------------
MNMG_SHEB5       IDANTIDFSQMTEQKGDS-----------PLPVMSFM-----------------------
MNMG_SHEB8       IDANTIDFSQMTEQKGDS-----------PLPVMSFM-----------------------
MNMG_SHEB9       IDANTIDFSQMAEQKGDS-----------PLPVMSFM-----------------------
MNMG_SHEPC       IDANTIDFSQMAEQKGDS-----------PLPVMSFM-----------------------
MNMG_SHESW       IDANTIDFSQMAEQKGDS-----------PLPVMSFM-----------------------
MNMG_SHESM       IDANTIDFTQMTEQKGDT-----------PLPVMSFM-----------------------
MNMG_SHESR       IDANTIDFTQMTEQKGDT-----------PLPVMSFM-----------------------
MNMG_SHESA       IDANTIDFTQMTEQKGDT-----------PLPVMSFM-----------------------
MNMG_SHEON       IDANTIDFSQMTEQKGDT-----------PLPVMSFM-----------------------
MNMG_SHEDO       IDANSIDFSQMTEQKGDT-----------PLPVMSFV-----------------------
MNMG_SHEFN       IDANTIDFTQMTEQKGDT-----------PLPVMSFI-----------------------
MNMG_SHEHH       IDANTIDFSLMTEQKGDN-----------PLPVMSFI-----------------------
MNMG_SHEPA       IDANTIDFSQMTEQKGDD-----------PLPVMSFI-----------------------
MNMG_SHESH       IDANTINFDLMTEQKGDT-----------PLPVMSFI-----------------------
MNMG_SHEWM       IDANTINFDLMTEQKGDT-----------PLPVMSFI-----------------------
MNMG_SHELP       IDANTINFDLMTEQKGDD-----------PLPVMSFI-----------------------
MNMG_SHEAM       IDARTIDFSVMTEQKGDT-----------PLPVMSFI-----------------------
MNMG_PSYIN       IDSRSIDFSALEVQHGDN-----------PTPVFSFL-----------------------
MNMG_ACTP2       LDARTINFDVLAKQHGDA-----------ELPVMSFM-----------------------
MNMG_ACTPJ       LDARTINFDVLAKQHGDA-----------ELPVMSFM-----------------------
MNMG_HAEDU       LDARTINFEVLAKQPGDE-----------VLPVMSFM-----------------------
MNMG_HAEIN       IDARTINFDILAKQHGDE-----------VLPVFSFM-----------------------
MNMG_HAEIG       IDARTINFDILAKQHGDE-----------VLPVFSFM-----------------------
MNMG_HAEIE       IDARTINFDILAKQHGDE-----------VLPMFSFM-----------------------
MNMG_HAEI8       IDARTINFDILAKQHGDA-----------VLPVFSFM-----------------------
MNMG_HAES1       IDARTINFDILAKQYGDE-----------KLPVFSFM-----------------------
MNMG_HISS2       IDARTINFDILAKQYGDE-----------KLPVFSFM-----------------------
MNMG_MANSM       LDARTINFDILAKQHGDA-----------QLPVFSFM-----------------------
MNMG_PASMU       IDARTIDFSVLAKQHGDE-----------KLPVFSFM-----------------------
MNMG_ACTSZ       LDARTINFDILAKQYGDA-----------ELPVFSFM-----------------------
MNMG_HYDCU       IDARTVDFEAMQMQPGDD-----------PMPVFSYM-----------------------
MNMG_ACIAC       IDGRSIDFSQCEEQPGDG---MPGGVNEGTLPVFSFM-----------------------
MNMG_ACISJ       IDGRSIDFSQCEEQPGDG---MPGGVNEGQVPVFSFMAHAY-------------------
MNMG_VEREI       IDGRSIDWSQCEEQPGDG---MPGGVNAGQVPVFSFMAHAY-------------------
MNMG_POLNA       IDGRSIDFSKCGVQPGDG---MPGGT-PGPVPVFSFM-----------------------
MNMG_POLSJ       IDGRTIDFSKCIEQPGDG---MPGGT-AGPVPVFSFM-----------------------
MNMG_RHOFT       LDGRSIDFSKCGEQPGDG---MPGGM-SPVMPVFSFM-----------------------
MNMG_LEPCP       IDGRSIDFSKLIEQPGDGVAAADGTPASSPMPVFSFL-----------------------
MNMG_METPP       IDGRTIDFERLLEQPGD----------ADPVPVFSYM-----------------------
MNMG_BURCA       IDGRTIDFSKLDEQPGDL----------DPIPVFSFL-----------------------
MNMG_BURCH       IDGRTIDFSKLDEQPGDL----------DPIPVFSFL-----------------------
MNMG_BURCC       IDGRTIDFSKLDEQPGDL----------DPIPVFSFL-----------------------
MNMG_BURCM       IDGRSIDFSKLDEQPGDL----------DPIPVFSFL-----------------------
MNMG_BURA4       IDGRSIDFSKLDEQPGDL----------DPIPVFSFL-----------------------
MNMG_BURL3       IDGRSIDFSQLTEQPGDL----------DPVPVFSFL-----------------------
MNMG_BURVG       IDGRSIDFSKLDEQPGDL----------DPIPVFSFL-----------------------
MNMG_BURMA       IDGRTIDFSKLDEQPGDL----------DPIPVFSFL-----------------------
MNMG_BURM9       IDGRTIDFSKLDEQPGDL----------DPIPVFSFL-----------------------
MNMG_BURP0       IDGRTIDFSKLDEQPGDL----------DPIPVFSFL-----------------------
MNMG_BURM7       IDGRTIDFSKLDEQPGDL----------DPIPVFSFL-----------------------
MNMG_BURMS       IDGRTIDFSKLDEQPGDL----------DPIPVFSFL-----------------------
MNMG_BURP1       IDGRTIDFSKLDEQPGDL----------DPIPVFSFL-----------------------
MNMG_BURPS       IDGRTIDFSKLDEQPGDL----------DPIPVFSFL-----------------------
MNMG_BURP6       IDGRTIDFSKLDEQPGDL----------DPIPVFSFL-----------------------
MNMG_BURTA       IDGRTIDFSKLEEQPGDL----------DPVPVFSFL-----------------------
MNMG_PARXL       IDGRTIDFSQLEEQPGDL----------DPVPVFSFL-----------------------
MNMG_CUPNH       IDGRTIDFSVMEEQPGDL----------DPVPVFSFL-----------------------
MNMG_CUPPJ       IDGRTIDFSVMEEQPGDL----------DPVPVFSFL-----------------------
MNMG_CUPMC       IDGRTIDFSVMEEQPGDL----------DPVPVFSFL-----------------------
MNMG_RALSO       IDGRTIDFSVLEAQPGDL----------DPVPVFSFL-----------------------
MNMG_JANMA       IDGRSIDFSVMQEQPGDL----------DPIPVFSVM-----------------------
MNMG_HERAR       IDGRSIDFSVMTEQPGDL----------DPIPVFSVM-----------------------
MNMG_BORBR       IDGRSINYSVLEEQPGDL----------DPVPVFSFL-----------------------
MNMG_BORPA       IDGRSINYSVLEEQPGDL----------DPVPVFSFL-----------------------
MNMG_BORPE       IDGRSINYSVLEEQPGDL----------DPVPVFSFL-----------------------
MNMG_BORPD       IDGRTIDYSVLEEQPGDL----------DPVPVFSFL-----------------------
MNMG_BORA1       IDGRTINYSVLEEQPGDL----------DPIPVFSFM-----------------------
MNMG_AZOSB       LDARSIDFSVMTVQPGDD-----------PVPVFSFL-----------------------
MNMG_AROAE       LDARTIDFSVMQEQPGDD-----------PVPVFSFL-----------------------
MNMG_DECAR       LDGKTIDFSVMEEQHSDD-----------PLPVFSFL-----------------------
MNMG_METFK       IDGRTIDYSVMAEQPGDS-----------PVPVFSFL-----------------------
MNMG_THIDA       IDGRTIDYSRTQVQPGDD-----------PAPVFSFM-----------------------
MNMG_NITMU       IDGRTIDYSAVAAQPGDA-----------PVPVFSFM-----------------------
MNMG_NEIG1       IDGRTIDFSQLTEQPGDT-----------PVPVMSVR-----------------------
MNMG_NEIMA       IDGRTIDFSQLTEQPGDT-----------PVPVMSVR-----------------------
MNMG_NEIMB       IDGRTIDFSQLTEQPGDT-----------PVPVMSVR-----------------------
MNMG_NEIM0       IDGRTIDFSQLTEQPGDT-----------PVPVMSVR-----------------------
MNMG_NEIMF       IDGRTIDFSQLTEQPGDT-----------PVPVMSVR-----------------------
MNMG_CHRVO       IDGRSVDFSVMEEQPGDT-----------PEPVFSYR-----------------------
MNMG_POLAQ       IDGRTIDFSVMLEQPGDL----------DPVPVFSYL-----------------------
MNMG_ACIBT       IDARSVDFSVMTPQPGDF-----------PSPVMSFM-----------------------
MNMG_ACIBY       IDARSVDFSVMTTQPGDF-----------PSPVMSFM-----------------------
MNMG_ACIAD       IDARSVDFSVMTPQPGDF-----------PSPVMSFM-----------------------
MNMG_PSYA2       IDARSVDFSVMAVQPGDT-----------PLPVMSYM-----------------------
MNMG_PSYCK       IDARSVDFSVMTVQPGDT-----------PLPVMSYM-----------------------
MNMG_PSYWF       IDARTVDFSVMQTQPGDT-----------PLPVMSFM-----------------------
MNMG_PSEAE       IDGRSVDFSVMTEQPGDT-----------PIPVMSFL-----------------------
MNMG_PSEAB       IDGRSVDFSVMTEQPGDT-----------PIPVMSFL-----------------------
MNMG_PSEA7       IDGRSVVFSVMTEQPGDT-----------PIPVMSFL-----------------------
MNMG_PSEPU       IDGRSVDFSVMTEQPGDT-----------PIPVMSFM-----------------------
MNMG_PSEPK       IDGRSVDFSVMTEQPGDT-----------PIPVMSFM-----------------------
MNMG_PSEP1       IDGRSVDFSVMTEQPGDT-----------PIPVMSFM-----------------------
MNMG_PSEPG       IDGRSVDFSVMTEQPGDT-----------PIPVMSFM-----------------------
MNMG_PSEPW       IDGRSVDFSVMTEQPGDT-----------PIPVMSFM-----------------------
MNMG_PSEE4       IDGRSVDFSVMTEQPGDT-----------PIPVMSFM-----------------------
MNMG_PSEF5       IDGRSVDFSVMTEQPGDT-----------PIPVMSFL-----------------------
MNMG_PSEPF       IDGKSVDFSVMTEQPGDT-----------PIPVMSFM-----------------------
MNMG_PSE14       IDGRSVDFSVMTEQPGDT-----------PIPVMSFL-----------------------
MNMG_PSEU2       IDGRSVDFSVMTEQPGDT-----------PIPVMSFL-----------------------
MNMG_PSESM       IDGRSVDFSVMTEQPGDT-----------PILVMSFL-----------------------
MNMG_PSEMY       IDGRSVDFSVMTEQPGDT-----------PTPLMSFL-----------------------
MNMG_PSEU5       IDGRSVDFSQMTEQPGDT-----------PLPVMSFL-----------------------
MNMG_ALCBS       IDGKSVDFSVMEEQWGDN-----------PLPVMSYL-----------------------
MNMG_HAHCH       IDARSVDFSVMEAQPGDT-----------PIPVMSFM-----------------------
MNMG_MARMS       IDARSVDFSQMQAQPGDD-----------IDPVMSYM-----------------------
MNMG_SACD2       IDARSVNFDGLEKQWGEE-----------KTPVMSYM-----------------------
MNMG_CHRSD       LDAKSVDFSVLETQPGDD-----------PTPVMSYL-----------------------
MNMG_MARHV       IDARTVDFSAMQQQWGDD-----------PTPVMSFI-----------------------
MNMG_ALKEH       LDGRTIDWARLTEQPGDD-----------PAPVFSFL-----------------------
MNMG_NITOC       IDGRSIDYSQLEVQPGDD-----------PVPVFSFL-----------------------
MNMG_METCA       IDRRSVDFSRMAEQPGDD-----------PTPVFSFL-----------------------
MNMG_XANAC       IDGRTLDYGVMAEQPGDD-----------PLPVMSFM-----------------------
MNMG_XANC5       IDGRTLDYGVMAEQPGDD-----------PLPVMSFM-----------------------
MNMG_XANOR       IDGRTLDYGVMGEQPGDD-----------PLPVMSFM-----------------------
MNMG_XANOM       IDGRTLDYGVMGEQPGDD-----------PLPVMSFM-----------------------
MNMG_XANCP       IDGRTLDYTMMDEQPGDD-----------PLPVMSFM-----------------------
MNMG_XANC8       IDGRTLDYTMMDEQPGDD-----------PLPVMSFM-----------------------
MNMG_XANCB       IDGRTLDYTMMDEQPGDD-----------PLPVMSFM-----------------------
MNMG_XYLFA       IDGRTLNYTAMQEQPGDA-----------PRPTMSFI-----------------------
MNMG_XYLFT       IDGRTLNYTAMQEQPGDA-----------PRPTMSFI-----------------------
MNMG_COXBU       IDGRTINYSQLIEQPSDQ-----------PLPLMSYW-----------------------
MNMG_COXBN       IDGRTINYSQLIEQPSDQ-----------PLPLMSYW-----------------------
MNMG_COXBR       IDGRTINYSQLIEQPSDQ-----------PLPLMSYW-----------------------
MNMG_LEGPC       IDRRTIDFSQMVEQPGDT-----------PVPVFSYL-----------------------
MNMG_LEGPA       IDRRTIDFSQMVEQPGDT-----------PVPVFSYL-----------------------
MNMG_LEGPL       IDRRTIDFSQMVEQPGDT-----------PVPVFSYL-----------------------
MNMG_LEGPH       IDRRTIDFSQMVEQPGDT-----------PVPVFSYL-----------------------
MNMG_NITEU       IDARTIDFRILREQPGDE-----------PVPVFSFL-----------------------
MNMG_NITEC       IDARTIDFQFLREQPGDE-----------PIPTFSFL-----------------------
MNMG_FRATF       IDRRSVDFSVMEVQHGDN-----------PTPYFSFFSKG--------------------
MNMG_FRATH       IDRRSVDFSVMEVQHGDN-----------PTPYFSFFSKG--------------------
MNMG_FRATO       IDRRSVDFSVMEVQHGDN-----------PTPYFSFFSKG--------------------
MNMG_FRATW       IDRRSVDFSVMEVQHGDN-----------PTPYFSFFSKG--------------------
MNMG_FRATT       IDRRSVDFSVMEVQHGDN-----------PTPYFSFFSKG--------------------
MNMG_FRAT1       IDRRSVDFSVMEVQHGDN-----------PTPYFSFFSKG--------------------
MNMG_FRATN       IDRRSVDFSVMEVQHGDN-----------PTPYFSFFSKG--------------------
MNMG_FRAP2       IDSRSVDFSVMDVQHGDT-----------PTPYFSFFSKG--------------------
MNMG_VESOH       LDGRTLDYSLMQVQSGDI-----------PLPTFSFIGV---------------------
MNMG_RUTMC       LDNRTLNYSLMQVQPGDT-----------PLPTFSFMGV---------------------
MNMG_DICNV       IDARSIDFSQMSEQLGDE-----------PLPVFSYL-----------------------
MNMG_BLOFL       IHAKGVNFDCMSVQNSDS-----------PLPVFSFT-----------------------
MNMG_BLOPB       VHTKGINFGSLRAQYSDD-----------PIPVFSFI-----------------------
MNMG_BAUCH       IHASTVNFNILTKQESDN-----------PLPVFSFT-----------------------
MNMG_BUCAI       IDINTVNFNNLLIQNSDT-----------PVPVFSFM-----------------------
MNMG_BUCAP       IDINTINFENLFVQHGDV-----------PTPVFSFM-----------------------
MNMG_BUCBP       INKHTINFSKLDVQYSDN-----------PLPIFSFM-----------------------
MNMG_WIGBR       IDLKSVNFSKLESQYGDT-----------PIPQFSFM-----------------------
MNMG_BUCCC       LKKKSINFDILKKQYGDY-----------PTPVFSFL-----------------------
MNMG_HALHL       IDRRTVAVEQLDAQHGDT-----------PRPLFSPFR----------------------
MNMG_RHIME       LDGRTIDWDRVGRQGPDE-----------NPVPFSFM-----------------------
MNMG_SINMW       LDGRTIDWGRVGRQGPDE-----------NPVPFSFM-----------------------
MNMG_RHIEC       LDGKTIDWQSVGRQGADE-----------ELVPFSFM-----------------------
MNMG_RHIL3       LDGKTIDWQSIGRQGADE-----------ELIPFSFM-----------------------
MNMG_AGRFC       LDGRTIDWNAVDRQAADE-----------DPVPFSFM-----------------------
MNMG_BARHE       LSKKTIRWECLPKQQADE-----------NPVPFSLL-----------------------
MNMG_BARQU       LSKKTINWNCLSKQKADE-----------DPVPFSLL-----------------------
MNMG_BART1       LSKKTIDWDRLSKQQADE-----------NPVPFSFL-----------------------
MNMG_BARBK       LSKKTIRWDVLPKQQADE-----------DPVPFSFL-----------------------
MNMG_BRUAB       LDGRTIDWQSLDMQSADE-----------EPVPFSLM-----------------------
MNMG_BRUA2       LDGRTIDWQSLDMQSADE-----------EPVPFSLM-----------------------
MNMG_BRUC2       LDGRTIDWQSLDMQSADE-----------EPVPFSLM-----------------------
MNMG_BRUSU       LDGRTIDWQSLDMQSADE-----------EPVPFSLM-----------------------
MNMG_BRUSI       LDGRTIDWQSLDMQSADE-----------EPVPFSLM-----------------------
MNMG_BRUME       LDGRTIDWQSLDMQSADE-----------EPVPFSLM-----------------------
MNMG_BRUO2       LDGRTIDWQSLDMQSADE-----------EPVPFSLM-----------------------
MNMG_BRUA4       LDGRTIDWQSLDMQSADE-----------EPVPFSLM-----------------------
MNMG_RHILO       LDGKTIDWASLESQAADE-----------DPVPFSLM-----------------------
MNMG_CHESB       LDGRTIEWNMLGFQKADE-----------DPVPFSLL-----------------------
MNMG_BRASB       LDGTTIDWSAVEMQPGDD-----------PPEPFSVL-----------------------
MNMG_BRASO       LDGTTIDWGAVEMQTGDD-----------PAEPFSVL-----------------------
MNMG_BRADU       LDGTTIDWSAVEMQPGDE-----------PPEPFSVM-----------------------
MNMG_NITHX       LDGATIDWAAVEMQPGDD-----------PPEPFSVM-----------------------
MNMG_NITWN       LDGTTIDWAAVEMQPGDD-----------PPEPFSVL-----------------------
MNMG_RHOPS       LDGRTIDWGAVEMQPGDD-----------PPEPFSVL-----------------------
MNMG_RHOP2       LDGRTIDWGAVEMQPGDD-----------PPEPFSVL-----------------------
MNMG_RHOPA       LDGRTIDWSAVEMQPGDD-----------PAEPFSVL-----------------------
MNMG_RHOP5       LDGKTIYWEAVEMQPGDD-----------PPEPFSVL-----------------------
MNMG_RHOPB       LDGRSIDWGAVEMQPGDE-----------PPEPFSVL-----------------------
MNMG_AZOC5       LDGRTIDWASLEMQPGDD-----------DPEPFSAL-----------------------
MNMG_METPB       LDGRTIDWTALEMQHADA-----------DPVPFSTL-----------------------
MNMG_METRJ       LDGRTIDWSGLEMQEADA-----------EPVPFSTL-----------------------
MNMG_METS4       LDGRTIDWAGIEKQAADD-----------EPVPFSSL-----------------------
MNMG_BEII9       LDGRSIDWSRLERQSGDV-----------EPEPFSFL-----------------------
MNMG_PARL1       LAGDSIDWSSLEVQPGDD-----------PPVPFSFL-----------------------
MNMG_RHORT       LDGRTIAWATLESQPGDE-----------PPPPFSFL-----------------------
MNMG_MAGSA       LDGRTIHWDSLDRQEGDD-----------PPVPFSYL-----------------------
MNMG_CAUVC       LDGKTIAWDRLESQAADD-----------TPVPFSYL-----------------------
MNMG_CAUSK       LDGKTIAWDRLEMQAADE-----------QPEPFSFL-----------------------
MNMG_MARMM       LLKSTIDWDSLEQQAADD-----------VPVPFSFM-----------------------
MNMG_HYPNA       LDGRTIHWDRLEMQPADE-----------QPIPFSFL-----------------------
MNMG_GLUOX       LARDSIDWDNLPADPGDA-----------EPEAFSPM-----------------------
MNMG_GLUDA       LDRTSIDWDSLAEDRGDA-----------VPEPFSRL-----------------------
MNMG_GRABC       IDRRSIAWEDLPEDRGEN-----------PPTPFSTL-----------------------
MNMG_ACICJ       LDRRSIDWEALPEDRGEA-----------EPAPFSLL-----------------------
MNMG_RUEPO       LDGRTIDWSILERQDGDD-----------DPVLFSFL-----------------------
MNMG_RUEST       LDGRTINWDILDSQPGDE-----------DPTLFSFL-----------------------
MNMG_ROSDO       LSSKSINWDVLEEQPGDD-----------EPTLFSFL-----------------------
MNMG_DINSH       LDKRSIAWDKLEPQPGDE-----------DPTLFSFL-----------------------
MNMG_RHOS1       LDGRTIRWAELEMQPGDE-----------DPVVFSFL-----------------------
MNMG_CERS4       LDGRTIRWTELEMQPGDE-----------DPVVFSFL-----------------------
MNMG_CERS5       LDGRTIDWTQLEMQPGDA-----------DPVMFSFL-----------------------
MNMG_PARDP       ILRQSIDWESLHQQPGDE-----------EPVMFSYL-----------------------
MNMG_JANSC       LAAKSINWEALDHQPSDD-----------DPTFFSFL-----------------------
MNMG_NOVAD       IDGRTIDWARLPEQPSDD-----------DPWTMSPL-----------------------
MNMG_ERYLH       LDGRTIDWAALEEQPSDG-----------EDWTLSAL-----------------------
MNMG_SPHAL       LDGRTIDWARLQEQPSDG-----------GRWTCSTW-----------------------
MNMG_SPHWW       LDGRTIDWARLDRQPSDG-----------EGWTFSAL-----------------------
MNMG_ZYMMO       LDGRTIDWARLQRQPSDE-----------DAWTMASY-----------------------
MNMG_ANAMM       IDRSSIDWSATAEQKGDL-----------VPTPFSFL-----------------------
MNMG_ANAPZ       IDRDSINWSKLLEQKGDV-----------LPTPFSFM-----------------------
MNMG_EHRCJ       LDINSINFAVLQEQKGDI-----------HPSPFSYI-----------------------
MNMG_EHRCR       LDINSINFSGLQEQKGDS-----------EPSPFSYM-----------------------
MNMG_EHRRG       LDRNSINFSGLQEQKGDT-----------PPSPFSYM-----------------------
MNMG_EHRRW       LDRNSINFSGLQEQKGDT-----------PPSPFSYM-----------------------
MNMG_WOLPM       LDRGTINWSILQEQVGDN-----------PPVPFSYL-----------------------
MNMG_WOLTR       LDRSTINWSILEEQVGNN-----------PPMPFSYL-----------------------
MNMG_NEOSM       LYKDSINYSALVEQPGDS-----------PPIPFSYM-----------------------
MNMG_RICRO       IDGRTIDYSKTILQPGDK-----------IPRPFSEL-----------------------
MNMG_RICRS       IDGRTIDYSKTILQPGDK-----------IPRPFSEL-----------------------
MNMG_RICCN       IDGRTIDYSKTILQPGDK-----------IPRPFSEL-----------------------
MNMG_RICM5       IDGRTIDYSKTILQPGDK-----------IPRPFSEL-----------------------
MNMG_RICFE       IDGRTIDYSKTALQPGDK-----------TPRPFSEL-----------------------
MNMG_RICAH       IDGRTIDYSKTALQPGDK-----------APRPFSEL-----------------------
MNMG_RICCK       IDGLTIDYSKTVLQPGDK-----------TPRPFSAL-----------------------
MNMG_RICB8       IDGRTIDYSKVESQPGDK-----------VPRPFSEL-----------------------
MNMG_RICBR       IDGRTIDYSKVESQPGDK-----------VPRPFSEL-----------------------
MNMG_RICPR       IDGRTIDYSKTALQQGDQ-----------IPRPFSEL-----------------------
MNMG_RICTY       IDGRTIDYSKTTLQQGDQ-----------IPRPFSEL-----------------------
MNMG_ORITB       IDSRTIDYSKLEEQPGDL-----------IPTPFSEI-----------------------
MNMG_PELUB       LDARTIKYDNLEEQFADE-----------DPYFFSFL-----------------------
MNMG_KORVE       LDGRSIDWSKFAVQPGDA-----------EPTPFSFR-----------------------
MNMG_SOLUE       LDGRSIDWSSFEPQAGDA-----------EPTPFSFL-----------------------
MNMG_MAGMM       LDGRTVNIEKLNRQDGDA-----------IPSPFSFM-----------------------
MNMG_CAMJE       VDAKSIDFSVLEIQDGDV-----------NPKAFSFRSR---------------------
MNMG_CAMJJ       VDAKSIDFSVLEIQDGDV-----------NPKAFSFRSR---------------------
MNMG_CAMJR       VDAKSIDFSVLEIQDGDV-----------NPKAFSFRSR---------------------
MNMG_CAMJ8       VDAKSIDFSVLEIQDGDV-----------NPKAFSFRSK---------------------
MNMG_CAMJD       VDATSIDFSVLEIQDGDV-----------NPKAFSFRSR---------------------
MNMG_CAMC1       IDAKTINFEILEKQDGDA-----------KPVAFSFRTK---------------------
MNMG_CAMC5       IDAKTIDFSVLERQEGDA-----------KPAAFSFRTQ---------------------
MNMG_CAMFF       VLAKSIDFSVLERQDGDQ-----------DPTPFSFRTK---------------------
MNMG_CAMHC       VDAKTIDFSALELQNGDA-----------QAHPFSFKTRFFANEIEKFTKNLSKNFD---
MNMG_NITSB       IDAKTIDFSRMEVQPGDE-----------NPIPFSFRTDRK-------------------
MNMG_SULDN       VDASTIDFSVMEEQGGDE-----------LPNPFSFRTNREEF-----------------
MNMG_ARCB4       LDANSIDFSVMDMHGGDV-----------NPAPFSFRTNKS-------------------
MNMG_SULNB       IDAKSVDTSVMEVQPGDT-----------PPPPFSFRTDKS-------------------
MNMG_HELPY       VAGNSIDFEGLEEHFGDT-----------NPPYFSYKTK---------------------
MNMG_HELPH       VAGNSIDFEGLEEHFGDT-----------NPPYFSYKTK---------------------
MNMG_HELPJ       VAGNSIDFEGLEEHFGDA-----------NPPYFSYKTK---------------------
MNMG_HELAH       VAGKSINFEGLEEHFGDT-----------NPPYFSYKTK---------------------
MNMG_HELHP       IDGRSIDFSALEIHNGDE-----------KPPHFSYKTI---------------------
MNMG_WOLSU       IASESIDFSVMEQHPGDL-----------PPPPFSFSTKKE-------------------
MNMG_LEPIN       IHKNSVDLSVLTIQEGDS-----------NPSPFSFSTD---------------------
MNMG_LEPIC       IHKNSVDLSVLTIQEGDS-----------NPSPFSFSTD---------------------
MNMG_LEPBJ       IHKNSVDLSVLAIQDGDA-----------NPSPFSFSTE---------------------
MNMG_LEPBL       IHKNSVDLSVLAIQDGDA-----------NPSPFSFSTE---------------------
MNMG_LEPBA       VHKNSINFDGLEIQDGDE-----------NPRPFSFSTK---------------------
MNMG_LEPBP       VHKNSINFDGLEIQDGDE-----------NPRPFSFSTK---------------------
MNMG_GEOMG       LDGRTIDFTRLEPQHGDD-----------PPVPFSFSTER--------------------
MNMG_GEOSL       LDGNTIDFSRLEPQYGDD-----------PPVPFSFSTER--------------------
MNMG_GEOUR       LDGRTIDFSRLEPQYGDN-----------PPIPFSFSTDK--------------------
MNMG_PELPD       LDGRTIDFSRLEPQHGDN-----------PPQPFSFSTER--------------------
MNMG_PELCD       LDGNTIDYDRLVPQHGDV-----------PPKPFSADTEK--------------------
MNMG_DESPS       IDSLTIDYSELEAQESDM-----------PPAHFSFDSQGK-------------------
MNMG_DESVH       LLRDSIDFSMMEVQPPDD-----------PPRPFSFRGPG--------------------
MNMG_DESVV       LLRDSIDFSLMEVQPPDD-----------PPRPFSFRGPG--------------------
MNMG_DESAG       LLRDSINFDVMVEQPGDN-----------PPRPFSFRSRH--------------------
MNMG_LAWIP       LLKTSIDFTSMEMQLGDT-----------PIPSFSFHGPK--------------------
MNMG_SYNFM       LGRRSIDFSRFREQHGDE-----------APKPFSLFTDS--------------------
MNMG_SYNAS       LKASTIDFSRLERQDSDP-----------AFEPFSLSTER--------------------
MNMG_CHLTE       IDSRSVDYTIVTEQPGDV-----------DPVPFSFS-STSV------------------
MNMG_CHLCH       IDSRSIDYRKVDEQPGDI-----------EPILFSFE-SKGA------------------
MNMG_CHLPM       VDRRSIDYSIVIEQKGDE-----------NPPPFSFS-SGSI------------------
MNMG_CHLL3       IDRRSVDYSRVEEQKGDE-----------NPPPFSFS-TPTL------------------
MNMG_CHLPD       IDSRSVNYSLVEEQSGDP-----------DPRPFSFH-TDSL------------------
MNMG_BACFR       IDGRSVHYELMDTQDGEC-----------DFHKFSFM-NTSV------------------
MNMG_BACFN       IDGRSVHYELMDTQDGEC-----------DFHKFSFM-NTSV------------------
MNMG_BACTN       IDARSIHFDLMDTQDGEC-----------DFHKFSFM-NTST------------------
MNMG_PHOV8       IDGRSVHYDLMETQDGEN-----------DFHRFSFM-SEP-------------------
MNMG_PARD8       IDGRSVHFDEMEEQPGEN-----------DFHKFSYM-DTSH------------------
MNMG_PORGI       IDGRSIDFSLTTEQSGEE-----------DHHRFSYM-DTPR------------------
MNMG_FLAJ1       VDGRSLDYSKMNEEKGDA-----------KPDKFSYS-DLTK------------------
MNMG_FLAPJ       VDGRSLDYSKMNVEAGDI-----------NPSKFSYS-DVTK------------------
MNMG_GRAFK       VDGRSLDYSKMTEQPGDD-----------IPGKFSYS-DETK------------------
MNMG_CYTH3       VDGRSLDYSVMQEQEGDE-----------NPSKFSYS-KQTT------------------
MNMG_SULMW       LDGRSLDFSKMIEQLGDF-----------PIEPFSYL-SNLN------------------
MNMG_SALRD       VDGRSIDYSVMEKQPGDP-----------DATAFSFLTDDLP------------------
MNMG_BORAP       IHRKSVDFSKTEVQFGDS-----------DIIPFSFS--NGK------------------
MNMG_BORBP       IHKKSVDFSKTEVQFGDS-----------DIIPFSFS--NGN------------------
MNMG_BORBU       IHKKSVDFSKTEVQFGDS-----------DIIPFSFS--NGK------------------
MNMG_TREDE       ILRRSFDSSLTEEQEADE-----------IMRPFSFS--NAE------------------
MNMG_TREPA       VLRKSVDLSVMEKQEADA-----------IMRPFSFA--HVE------------------
MNMG1_FUSNN      LDKKTIDFSQLEELKGEE-----------HPRYFSLFTKKE-------------------
MNMG2_FUSNN      IDGRTIDYSVLEEQPGDKS----------QVLKFSNRTKDED------------------
MNMG_ENDTX       INSRSIDYSKMTEQFGDE-----------KPVPFSYSTKVEEW-----------------
MNMG_ONYPE       VKKNSIDYSQTKIQMGDN-----------LEQIFSFV-PQTN------------------
MNMG_AYWBP       VKKNSIDYSQTKIQMGDN-----------LEQTFGFLTPQTT------------------
MNMG_ACHLI       IARDSIDYSKTVPQPGDG-----------VFQTFSHDSPITD------------------
MNMG_MYCCT       VYRDSVDLSRAIIEPGTD-----------MKLAFSFSTNTYT------------------
MNMG_MYCMS       VYRDSVDLSNAVLEPGTD-----------MKLAFSFSTSTYT------------------
MNMG_MESFL       IYKNSVDLSKAIKEPGTD-----------AKLAFSFSTNEYT------------------
MNMG_MYCGE       ILKTSLDYNQMELEINNN-----------QNLAFSTTNKNFL------------------
MNMG_MYCPN       ILRESLDFSQMAVEANTT-----------PHLAFSFTTKNYL------------------
MNMG_MYCGA       IKKDSIDYSNLQIEPGNG-----------TELYFSHWSKN-K------------------
MNMG_UREPA       IKKDSIDFTNMILEPGTN-----------QKIAFSHYHPVYK------------------
MNMG_UREP2       IKKDSIDFTNMILEPGTN-----------QKIAFSHYHPVYK------------------
MNMG_MYCPE       ILKNSIDYSKLQIEPGTN-----------KKYSFSHFDRKFL------------------
MNMG_MYCH7       IFTSSIDFSKVEKEVLPV-----------YNINFSFQSKH--------------------
MNMG_MYCHJ       IFTSSIDFSKVEKEVLPV-----------YNINFSFQSKH--------------------
MNMG_MYCH2       IFTSSIDFSKVEKEVLPV-----------YNINFSFQSKH--------------------
MNMG_MYCPU       IYSDSIDFSKVEEEVLDV-----------NGYVFSPRSNV--------------------
MNMG_MYCS5       IYKSSIDFSKVEKEILDT-----------NDLNFSNRSNK--------------------
MNMG_MYCMO       IYANSIDFSEVEEEILPE-----------SNLNFSIYHSK--------------------
MNMG_MYCAP       IYSDSINFDEVEQEVLSD-----------VNISFSSRSNL--------------------
MNMG_THEM4       VLKSSINFSKMIRQDTDD-----------EPRAFSHFSEP-K------------------
MNMG_FERNB       VLKKSIDFSKMVRQDTDD-----------KPWAFSHFNEP-K------------------
MNMG_THEMA       VLKRSINFSVMERQDTSD-----------EPLAFSFFDEP-R------------------
MNMG_THESQ       VLKRSINFSVMERQDTSD-----------EPLAFSFFDEP-R------------------
MNMG_THEP1       VLKRSINFSVMERQDTSD-----------EPLAFSFFDEP-R------------------
MNMG_PETMO       VRKDSIDFSKFDIQETAD-----------EPLAFSYWSQP-R------------------
MNMG_BDEBA       LLKDSIDWSKTIPQAGDE-----------KVYPFSFRSSD-K------------------
MNMG_ALKMQ       IHQDSVDFSKMEEHLGDE-----------EIVPFSFMNDG------IE------------
MNMG_ALKOO       IHKDSIDFSKVSVQIEDE-----------EIVPFSFMNEA------LE------------
MNMG_CLOD6       VHRDSIDFSVMSLQEGDE-----------KVTPFSFMNEN------IE------------
MNMG_FINM2       VHRDSLNYEVMTVQPGDD-----------DVIPFSFLNDGK----DIS------------
MNMG_CALS8       VHRRSLDFSKMQIQLGDE-----------VITPFSFEH--E----TLE------------
MNMG_ACET2       VNRRSIDFSKMEEQPGDE-----------RIVPFSFEN--E----EIK------------
MNMG1_CALS4      VDKRSIDFSKMEIQPGDE-----------VITPFSFMH--D----KIE------------
MNMG2_CALS4      VDKRTVDFSKMIMQPGDE-----------VITPFSFMH--D----KIE------------
MNMG_THEP3       VDKRSIDFSKMEIQPGDE-----------VITPFSYMH--D----KIE------------
MNMG_THEPX       VDKRSIDFSKMEIQPGDE-----------VITPFSYMH--D----KIE------------
MNMG_CLOB1       INKRSVDFSKMIEQPGDE-----------KIVPFSFIH--N----KLD------------
MNMG_CLOBH       INKRSVDFSKMIEQPGDE-----------KIVPFSFIH--N----KLD------------
MNMG_CLOBL       INKRSVDFSKMIEQPGDE-----------KIVPFSFIH--N----KLD------------
MNMG_CLOBK       INKRSVDFSKMIEQPGDE-----------KIVPFSFIH--N----KLD------------
MNMG_CLOBM       INKRSVDFSKMVEQPGDE-----------KIVPFSFIH--D----KLD------------
MNMG_CLONN       INRRTVDFSKMIEQKGDE-----------NIVPFSFMS--E----NIE------------
MNMG_CLOAB       INKRSVDFSKMVEQPGDE-----------RIIPFSFLN--D----KLE------------
MNMG_CLOTE       VNKKTIDFSKMIEQPGDE-----------KIVPFSFLT--D----KLE------------
MNMG_CLOK5       VNRRSVDFSKMIEQPGDK-----------RIVPFSFMS--E----NLD------------
MNMG_CLOP1       INKRSVDFSKMIEQPGDE-----------EIIPFSFIS--G----NID------------
MNMG_CLOPS       VNKRSVDFSKMIEQPGDE-----------EIIPFSFIS--G----NID------------
MNMG_CLOPE       INKRSVDFSKMIEQPGDE-----------EIIPFSFIS--G----NID------------
MNMG_CLOB8       INRRSVDFSKMIEQNGDD-----------NIIPFSFMS--E----NIE------------
MNMG_LACP7       IDKRSIDFSKMEEQFGDE-----------KVVPFSFINNPE----DIE------------
MNMG_NATTJ       VYRKSLNFDEMEIQHGDD-----------YPWRFSFYHS------SER------------
MNMG_BACVZ       VSSDSIDYSKTEIQPGDP-----------VPRAFSYETVEYI------------------
MNMG_BACSU       VKSDTIDYSKTEIQPGDD-----------VPRAFSYETVEYI------------------
MNMG_BACLD       VNSHSIDYSKTEIQPGDE-----------VPRAFSYETVEYI------------------
MNMG_BACP2       VNSHSIDYSKTEIQPGDD-----------VPRAFSYETVEYI------------------
MNMG_BACAH       VNSNTIDYSKTEIQPGDD-----------KPRAFSFETTKFI------------------
MNMG_BACHK       VNSNTIDYSKTEIQPGDD-----------KPRAFSFETTKFI------------------
MNMG_BACAN       VNSNTIDYSKTEIQPGDD-----------KPRAFSFETTKFI------------------
MNMG_BACCZ       VNSNTIDYSKTEIQPGDD-----------KPRAFSFETTKFI------------------
MNMG_BACC1       VNSNTIDYSKTEIQPGDD-----------KPRAFSFETTKFI------------------
MNMG_BACCR       VNSNTIDYSKTEIQPGDD-----------KPRAFSFETTKFI------------------
MNMG_BACMK       VNSNTIDYSKTEIQPGDD-----------KPRAFSFETTKFI------------------
MNMG_BACCN       VNSNTIDYSKTEIQPGDD-----------QPRAFSFETTKFI------------------
MNMG_GEOKA       VNSRTIDYSKTEIQPGDK-----------EPRAFSYETTKYI------------------
MNMG_GEOTN       VNSRTIDYSKTEIQPGDE-----------EPRAFSYETTKYI------------------
MNMG_LYSSC       VNNRTIDYDKTEIQPGDE-----------VPRAFSFETTEFI------------------
MNMG_STAA2       VNSKTIDYSKTEIQPGDD-----------VGRAFSFETTEYI------------------
MNMG_STAA9       VNSKTIDYSKTEIQPGDD-----------VGRAFSFETTEYI------------------
MNMG_STAAR       VNSKTIDYSKTEIQPGDD-----------VGRAFSFETTEYI------------------
MNMG_STAAS       VNSKTIDYSKTEIQPGDD-----------VGRAFSFETTEYI------------------
MNMG_STAA1       VNSKTIDYSKTEIQPGDD-----------VGRAFSFETTEYI------------------
MNMG_STAAM       VNSKTIDYSKTEIQPGDD-----------VGRAFSFETTEYI------------------
MNMG_STAAW       VNSKTIDYSKTEIQPGDD-----------VGRAFSFETTEYI------------------
MNMG_STAAN       VNSKTIDYSKTEIQPGDD-----------VGRAFSFETTEYI------------------
MNMG_STAAB       VNSKTIDYSKTEIQPGDD-----------VGRAFSFETTEYI------------------
MNMG_STAA8       VNSKTIDYSKTEIQPGDD-----------VGRAFSFETTEYI------------------
MNMG_STAA3       VNSKTIDYSKTEIQPGDD-----------VGRAFSFETTEYI------------------
MNMG_STAAC       VNSKTIDYSKTEIQPGDD-----------VGRAFSFETTEYI------------------
MNMG_STAAE       VNSKTIDYSKTEIQPGDD-----------VGRAFSFETTEYI------------------
MNMG_STAAT       VNSKTIDYSKTEIQPGDD-----------VGRAFSFETTEYI------------------
MNMG_STAES       VNARTIDYSKTEIQPGDD-----------IGRAFSFETTEFI------------------
MNMG_STAEQ       VNARTIDYSKTEIQPGDD-----------IGRAFSFETTEFI------------------
MNMG_STAHJ       VNAKTIDYSKTEIQPGDD-----------VGRAFSFETTEYI------------------
MNMG_STAS1       VNAKTIDYSKTEIQPGDD-----------VGRAFSFETTEYI------------------
MNMG_LISMO       VKSSTIDYSKTEEQPGDD-----------HPRAFSFDTVEML------------------
MNMG_LISMF       VKSSTIDYSKTEEQPGDD-----------HPRAFSFDTVEML------------------
MNMG_LISIN       VKSSTIDYSKTEEQPGDD-----------HPRAFSFDTVEMM------------------
MNMG_LISW6       VKSSTIDYSKTEEQPGDD-----------HPRAFSFDTVDMM------------------
MNMG_OCEIH       VNSHTIDYSKTEIQPGDD-----------NPKSFSYETTEQI------------------
MNMG_BACSK       VHGNTIDYKKTEIQPGDD-----------KPRAFSYETTKFI------------------
MNMG_ALKHC       VNGETIDYDKTEIQPGDE-----------VPRAFSYETTKYI------------------
MNMG_EXIS2       IDGKTIDYSKTEIQPGDA-----------VALPFSHETTQMI------------------
MNMG_LEVBA       VDGNTIHYDETEEQPGDV-----------EPNHFSFTTPDS--AYLDL------------
MNMG_LACPL       VDGNTIDYSVTEEQPGDP-----------EPHHFSFETKDA--DYIDL------------
MNMG_PEDPA       VDGGTINYDETEEQPGDE-----------VPNHFSFQTPDS--KYIEL------------
MNMG_LACS1       VDGNTIDYDKTEEQPGDV-----------EPNHFSYESKDE--DYLKV------------
MNMG_ENTFA       VKSSTIDYSVTEEQPGDK-----------EPNHFSYSTPDS--AYN--------------
MNMG_LACSS       VDGTTIDFSKTEEQPGDK-----------EPNHFSFETPDS--AYL--------------
MNMG_LACP3       VNGNTIDFDKTEEQPGDK-----------TPNHFSFTTPDS--VYL--------------
MNMG_LACAC       VNGNTIDYSKTEEEPGDK-----------VPRHFSYESKDE--NYL--------------
MNMG_LACH4       VNGNTIDYSKTEEEPGDK-----------TPRHFSYESKDV--DYL--------------
MNMG_LACJO       VDGNTIDYSKTQEEPGDK-----------EPRHFSYTSKDS--DYL--------------
MNMG_LACGA       VDGNTVDYSKTQEEPGDK-----------EPRHFSYTSKDS--DYL--------------
MNMG_LACDA       VNRHTIDYSKTEEEPGDK-----------EPRHFSFTSRDE--DYL--------------
MNMG_LACDB       VNRHTIDYSKTEEEPGDK-----------EPRHFSFTSRDE--DYL--------------
MNMG_LACLM       VLASSIDYDKTEIQPGDE-----------APNHFSFMSSDE--DYL--------------
MNMG_LACLS       VLASSIDYDKTEIQPGDE-----------APNHFSFMSSDE--DYL--------------
MNMG_LACLA       VLASSIDYDKTEIQPGDE-----------APNHFSFMSSDE--NYL--------------
MNMG_STRA3       VKASSINYEKTEIQPGDE-----------QPNHFSFMSRDE--DYI--------------
MNMG_STRA5       VKASSINYEKTEIQPGDE-----------QPNHFSFMSRDE--DYI--------------
MNMG_STRA1       VKASSINYEKTEIQPGDE-----------QPNHFSFMSRDE--DYI--------------
MNMG_STRP1       VKASSINYDQTEIQPGDD-----------KPNHFSFMSKDA--DYL--------------
MNMG_STRPD       VKASSINYDQTEIQPGDD-----------KPNHFSFMSKDA--DYL--------------
MNMG_STRPB       VKASSINYDQTEIQPGDD-----------KPNHFSFMSKDA--DYL--------------
MNMG_STRPC       VKASSINYDQTEIQPGDD-----------KPNHFSFMSKDA--DYL--------------
MNMG_STRPG       VKASSINYDQTEIQPGDD-----------KPNHFSFMSKDA--DYL--------------
MNMG_STRP8       VKASSINYDQTEIQPGDD-----------KPNHFSFMSKDA--DYL--------------
MNMG_STRPF       VKASSINYDQTEIQPGDD-----------KPNHFSFMSKDA--DYL--------------
MNMG_STRPM       VKASSINYDQTEIQPGDD-----------KPNHFSFMSKDA--EYL--------------
MNMG_STRP3       VKASSINYDQTEIQPGDD-----------KPNHFSFMSKDA--DYL--------------
MNMG_STRP6       VKASSINYDQTEIQPGDD-----------KPNHFSFMSKDA--DYL--------------
MNMG_STRT2       VKASSINYEETEIQPGDE-----------KPNHFSFLSKDE--DYL--------------
MNMG_STRT1       VKASSINYEETEIQPGDE-----------KPNHFSFLSKDE--DYL--------------
MNMG_STRTD       VKASSINYEETEIQPGDE-----------KPNHFSFLSKDE--DYL--------------
MNMG_STRMU       VKANSIHYDETEIQPGDK-----------KANHFSFMSKDE--DYL--------------
MNMG_STRGC       VKASSINYDVTEIQPGDE-----------KANHFSYTSRDE--DYV--------------
MNMG_STRSV       VKASSINYDVTEIQPGDE-----------KANHFSYTSRDE--DYV--------------
MNMG_STRR6       VKASSINYDVTEIQPGDE-----------VPNHFSYTSRDE--DYV--------------
MNMG_STRP2       VKASSINYDVTEIQPGDE-----------VPNHFSYTSRDE--DYV--------------
MNMG_STRPN       VKASSINYDVTEIQPGDE-----------VPNHFSYTSRDE--DYV--------------
MNMG_STRPI       VKASSINYDVTEIQPGDE-----------APNHFSYTSRDE--DYV--------------
MNMG_STRSY       VNARTINYEDTEIQPGDE-----------KPNHFSFLSKDE--DYL--------------
MNMG_STRS2       VNARTINYEDTEIQPGDE-----------KPNHFSFLSKDE--DYL--------------
MNMG_DESRM       VDRRTIDFTKMTIQPGDE-----------EVHNFSYIS------PVTQ------------
MNMG_PELTS       VDRNSIDFSKMSIQPGDK-----------KTHNFSFIS------EIKE------------
MNMG_CARHZ       VDKRTVDFSKMIEQPGDD-----------RPLYFSYMS------EGIK------------
MNMG_MOOTA       VSGRSINWDKMTEQPGDP-----------GPLRFSFWE------EGPE------------
MNMG_HELMI       VDGRTVDFSQMVEQPGDR-----------EPLNFSFLS------PRIE------------
MNMG_SYNWW       IDSKSVDFSKMIEQPGDK-----------RPLRFSFIS------PLIN------------
MNMG_DESAP       IDRRTLDFSRMTPQHGDE-----------DCPGFSFAAGN----RGKE------------
MNMG_SYMTH       VDGRTVDFSRMVRQDGDP-----------EPHRFSFMS------PLDH------------
MNMG_DESHY       IHRRSVDYTKFTVQPGDS-----------VPWRYSFMPTQSMFWGRDV------------
MNMG_ROSCS       IDARTIDFSQTSVQQGSP-----------TPLFFGHYYRVLGEIPPEPAFTGAPACAYPE
MNMG_ROSS1       IDARTIDFSLTSVQHGSA-----------TPLFFGFYYRALNEAPPEPAFGGPPASAYPE
MNMG_CHLAA       LAAATIDFSLTELQPGSD-----------TPLSFGHYYPELGETIPPPEYHGPPAPVYPH
MNMG_DEIRA       VRADSVRFADLLEIPADP-----------QPRGFT-------------------------
MNMG_DEIGD       VRADSVRFADLLEIPADP-----------QPRGFT-------------------------
MNMG_THET2       IRADSVDFGRLEVVPPEV-----------PPGSFT-------------------------
MNMG_THET8       IRADSVDFGRLEVVPPEV-----------PPGSFT-------------------------
MNMG_MYXXD       LARASIDWDALEPQPGDT-----------RVRPFSWRTKVEG----------------EG
                 :                                                           

MNMG_NOSS1       -DVWVEREQLPCHMTRTTPETHRLIRENLHLSPVYG--GWVEAKGPRYCPSIEDKIVRFV
MNMG_TRIV2       -DVWVEREQLPCHMTRTTPETHRLIRENLHLSPVYG--GWVEAKGPRYCPSIEDKIVRFV
MNMG_TRIEI       -EVWVEREQMCCYLTRTTPETHKLIRDNLHLSPVYG--GWVDAKGPRYCPSIEDKIVRFA
MNMG_SYNY3       -EVWVEREQMNCYLTRTTAKTHQLIKDNLHLSPIYG--GFIDSKGPRYCPSIEDKIVRFA
MNMG_SYNP2       -EAWVEREQMPCYLTRTTPKTHQLIKDNLHLSPIYG--GFIDSKGPRYCPSIEDKIVRFA
MNMG_MICAN       -EVWIEREQMNCHLTRTTAATHQLIRDNLHLSPIYG--GFIDSKGPRYCPSIEDKIVRFA
MNMG_ACAM1       -AVWIEREQMNCYITRTTPETHQLIQDNLHLSPVYG--GWVDAKGPRYCPSIEDKIVRFA
MNMG_SYNP6       -EAWVEREQLPCYLTRTTAETHKLIRDNLYLTPVYG--GYIDAKGPRYCPSIEDKIVRFA
MNMG_SYNE7       -EAWVEREQLPCYLTRTTAETHKLIRDNLHLTPVYG--GYIDAKGPRYCPSIEDKIVRFA
MNMG_THEEB       -TVWVERPQMNCYLTRTTPETHRLIREHLHLTPVYG--GWVDAKGPRYCPSIEDKIVRFA
MNMG_SYNJB       -EVWVPREQMDCYLTRTTPETHRIIRENLHETPVYG--GWVEAKGPRYCPSIEDKIVRFA
MNMG_SYNJA       -EVWVPREQMDCYLTRTTPETHRIIRENLHETPVYG--GWVEAKGPRYCPSIEDKIVRFA
MNMG_PROM1       -LSWKSGEQMSCHITRTTKETHQLIKNNLHLTPIYG--GFIDSKGPRYCPSIEDKIVRFA
MNMG_PROMT       -LSWKSGEQMSCHITRTTKQTHQLIKNNLHLTPIYG--GFIDSKGPRYCPSIEDKIVRFA
MNMG_PROMA       -ERWKSGQQMSCYMTRTTQKTHQLIKNNLHLTPIYG--GFINSKGPRYCPSIEDKIVRFS
MNMG_PROM3       -TTWVSGEQMSCHITRTTASTHQLIKENLELTPIYG--GFLDSKGPRYCPSIEDKIVRFA
MNMG_PROMM       -TAWVSGEQMSCHITRTTASTHQLIKENLELTPIYG--GFLDSKGPRYCPSIEDKIVRFA
MNMG_SYNSC       -AAWVSGEQMSCHITRTTAETHQLIRDNLHLTAIYG--GVIDSKGPRYCPSIEDKIVRFA
MNMG_SYNPX       -AAWVSGEQMSCHITRTTAETHQLIRDNLHLTAIYG--GVIDSKGPRYCPSIEDKIVRFA
MNMG_SYNS9       -AAWVSGEQMSCHITRTTAETHQLIRDNLHLTAIYG--GVIDSKGPRYCPSIEDKIVRFA
MNMG_SYNPW       -AAWSSGEQMSCHITRTTAATHQLIKDNLHLTAIYG--GVIDSKGPRYCPSIEDKIVRFA
MNMG_SYNS3       -TAWASGEQMSCHITRTTAATHQLIKDNLHLTAIYG--GIIDSKGPRYCPSIEDKIVRFA
MNMG_SYNR3       -EAWVSSEPMSCHITRTTAATHQLIKDNLHLTPIYG--GFIDSKGPRYCPSIEDKIVRFA
MNMG_PROMS       -DIKNNMPQVSCHITRTTTKTHQLIRDNLHLTPIYG--GFIDSKGPRYCPSIEDKIVKFA
MNMG_PROM0       -DIKNNMPQVSCHITRTTTKTHQLIRDNLHLTPIYG--GFIDSKGPRYCPSIEDKIVKFA
MNMG_PROM9       -NIKNNMPQVSCHITRTTTKTHQLIRDNLHLTPIYG--GFIDSKGPRYCPSIEDKIVKFA
MNMG_PROM2       -DIKNNMPQVSCHITRTTSKTHQLIRDNLHLTPIYG--GFIDSKGPRYCPSIEDKIVKFA
MNMG_PROM5       -KIKNDMPQICCHITRTTQKTHELIRNNLHLTPIYG--GFIDSKGPRYCPSIEDKIVKFA
MNMG_PROMP       -KIKNNMPQVSCHITRTTLKTHELIRNNLHLTPIYG--GFIDSKGPRYCPSIEDKIVKFA
MNMG_CHLTR       -------PQVSCHITHTTDQTKDLITKNLHRSALYG--GRIEGVGPRYCPSIEDKIVKFA
MNMG_CHLTA       -------PQVSCHITHTTDQTKDLITKNLHRSALYG--GRIEGVGPRYCPSIEDKIVKFA
MNMG_CHLT2       -------PQVSCHITHTTDQTKDLITKNLHRSALYG--GRIEGVGPRYCPSIEDKIVKFA
MNMG_CHLTB       -------PQVSCHITHTTDQTKDLITKNLHRSALYG--GRIEGVGPRYCPSIEDKIVKFA
MNMG_CHLMU       -------PQVSCHITYTTDKTKDLIANNLHRSALYG--GRIEGVGPRYCPSIEDKIVKFA
MNMG_CHLAB       -------PQVSCYITHTTEKTKDIIAANIHRSALYG--GRIEGIGPRYCPSIEDKIVKFA
MNMG_CHLCV       -------PQVSCYITHTTQKTKDIIAANISRSALYG--GRIEGIGPRYCPSIEDKIVKFA
MNMG_CHLFF       -------PQVSCYITHTTEKTKEIITANIRRSALYG--GRIEGIGPRYCPSIEDKIVKFA
MNMG_CHLPN       -------PQLSCFITHTMEKTKAIISANLHRSALYG--GCIEGVGPRYCPSIEDKIVKFS
MNMG_PARUW       -------PQVSCYITYTTEETKQIILSNIHRSPMYS--GKIKGVGPRYCPSIEDKVVRFS
MNMG_RHOBA       ------SPQMACHIAHTNERVHDLIRANLDRAPMYS--GQIDSRGPRYCPSIEDKVVRFA
MNMG_OPITP       EAIPPGCEQVSCWMTYTTARTAELVRENLSRSAMYG--GEIEGVGPRYCPSIEDKFVRFA
MNMG_AQUAE       ----KGKEQVNCWITYTTPKTHEIIRKNLHRTALYG--GLIKGIGPRYCPSIEDKIVKFP
MNMG_ECOLI       GNASQHPQQVPCYITHTNEKTHDVIRSNLDRSPMY--AGVIEGVGPRYCPSIEDKVMRFA
MNMG_ECOL6       GNASQHPQQVPCYITHTNEKTHDVIRSNLDRSPMY--AGVIEGVGPRYCPSIEDKVMRFA
MNMG_ECO24       GNASQHPQQVPCYITHTNEKTHDVIRSNLDRSPMY--AGVIEGVGPRYCPSIEDKVMRFA
MNMG_ECODH       GNASQHPQQVPCYITHTNEKTHDVIRSNLDRSPMY--AGVIEGVGPRYCPSIEDKVMRFA
MNMG_ECOL5       GNASQHPQQVPCYITHTNEKTHDVIRSNLDRSPMY--AGVIEGVGPRYCPSIEDKVMRFA
MNMG_ECOHS       GNASQHPQQVPCYITHTNEKTHDVIRSNLDRSPMY--AGVIEGVGPRYCPSIEDKVMRFA
MNMG_ECOLC       GNASQHPQQVPCYITHTNEKTHDVIRSNLDRSPMY--AGVIEGVGPRYCPSIEDKVMRFA
MNMG_SHIBS       GNASQHPQQVPCYITHTNEKTHDVIRSNLDRSPMY--AGVIEGVGPRYCPSIEDKVMRFA
MNMG_SHISS       GNASQHPQQVPCYITHTNEKTHDVIRSNLDRSPMY--AGVIEGVGPRYCPSIEDKVMRFA
MNMG_ECOUT       GNASQHPQQVPCYITHTNEKTHDVIRSNLDRSPMY--AGVIEGVGPRYCPSIEDKVMRFA
MNMG_ECOK1       GNASQHPQQVPCYITHTNEKTHDVIRSNLDRSPMY--AGVIEGVGPRYCPSIEDKVMRFA
MNMG_ECOSM       GNASQHPQQVPCYITHTNEKTHDVIRSNLDRSPMY--AGVIEGVGPRYCPSIEDKVMRFA
MNMG_ECO57       GNASQHPQQVPCYITHTNEKTHDVIRSNLDRSPMY--AGVIEGVGPRYCPSIEDKVMRFA
MNMG_SHIDS       GNASQHPQQVPCYITHTNEKTHDVIRSNLDRSPMY--AGVIEGVGPRYCPSIEDKVMRFA
MNMG_SHIFL       GNASLHPQQVPCYITHTNEKTHDVIRSNLDRSPMY--AGVIEGVGPRYCPSIEDKVMRFA
MNMG_SHIF8       GNASLHPQQVPCYITHTNEKTHDVIRSNLDRSPMY--AGVIEGVGPRYCPSIEDKVMRFA
MNMG_SALCH       GNASQHPQQVPCYITHTNEKTHDVIRNNLDRSPMY--AGVIEGIGPRYCPSIEDKVMRFA
MNMG_SALTY       GNASQHPQQVPCYITHTNEKTHDVIRNNLDRSPMY--AGVIEGIGPRYCPSIEDKVMRFA
MNMG_SALPB       GNASQHPQQVPCYITHTNEKTHDVIRNNLDRSPMY--AGVIEGIGPRYCPSIEDKVMRFA
MNMG_SALPA       GNASQHPQQVPCYITHTNEKTHDVIRNNLDRSPMY--AGVIEGIGPRYCPSIEDKVMRFA
MNMG_SALTI       GNAFQHPQQVPCYITHTNEKTHDVIRNNLDRSPMY--AGVIEGIGPRYCPSIEDKVMRFA
MNMG_CITK8       GNASQHPQQVPCYITHTNEKTHDVIRNNLDRSPMY--AGVIEGIGPRYCPSIEDKVMRFA
MNMG_SALAR       GNASQHPQQVPCYITHTNEKTHDVIRNNLDRSPMY--AGVIEGIGPRYCPSIEDKVMRFS
MNMG_ENT38       GNAAQHPQQVPCYITHTNEKTHDVIRNNLDRSPMY--AGVIEGIGPRYCPSIEDKVMRFA
MNMG_KLEP7       GSADQHPRQVPCYITHTNEKTHDVIRNNLDRSPMY--AGVIEGIGPRYCPSIEDKVMRFA
MNMG_CROS8       GSADQHPRQVPCYVTHTNEKTHDVIRNNLDRSPMY--AGVIEGIGPRYCPSIEDKVMRFA
MNMG_PECAS       GNAGQHPAQMPCYITHTNEKTHEVIRNNLDRSPMY--AGIIEGIGPRYCPSIEDKVMRFA
MNMG_YERPE       GNAEQHPEQMACHITYTNEKTHEVIRNNLDRSPMY--AGIIEGIGPRYCPSIEDKVMRFA
MNMG_YERPY       GNAEQHPEQMACHITYTNEKTHEVIRNNLDRSPMY--AGIIEGIGPRYCPSIEDKVMRFA
MNMG_YERPA       GNAEQHPEQMACHITYTNEKTHEVIRNNLDRSPMY--AGIIEGIGPRYCPSIEDKVMRFA
MNMG_YERPN       GNAEQHPEQMACHITYTNEKTHEVIRNNLDRSPMY--AGIIEGIGPRYCPSIEDKVMRFA
MNMG_YERPP       GNAEQHPEQMACHITYTNEKTHEVIRNNLDRSPMY--AGIIEGIGPRYCPSIEDKVMRFA
MNMG_YERPS       GNAEQHPEQMACHITYTNEKTHEVIRNNLDRSPMY--AGIIEGIGPRYCPSIEDKVMRFA
MNMG_YERP3       GNAEQHPEQMACHITYTNEKTHEVIRNNLDRSPMY--AGIIEGIGPRYCPSIEDKVMRFA
MNMG_YERE8       GNASQHPEQMACHITYTNEKTHEVIRNNLDRSPMY--AGIIEGIGPRYCPSIEDKVMRFA
MNMG_SERP5       GNAGQHPEQMACYITYTNEKTHDVIRNNLDRSPMY--AGIIEGIGPRYCPSIEDKVMRFA
MNMG_PHOLL       GNVKQHPQQIPCYITHTNEKTHDVIRNNLDRSPMY--TGIIEGIGPRYCPSIEDKVMRFA
MNMG_SODGM       GSADQHPRQIPCYITYTNDKTHEVIRQNLDRSPMY--AGIIEGVGPRYCPSIEDKVMRFA
MNMG_VIBCH       GKREHHPRQIPCYITHTNERTHDVIRANLDRSPMY--AGIIEGIGPRYCPSIEDKVMRFA
MNMG_VIBC3       GKREHHPRQIPCYITHTNERTHDVIRANLDRSPMY--AGIIEGIGPRYCPSIEDKVMRFA
MNMG_VIBCB       GKREHQPRQIPCFITHTNEKTHDVIRNNLDRSPMY--AGVIEGIGPRYCPSIEDKVMRFA
MNMG_VIBPA       GKREHHPRQIPCFITHTNEQTHEVIRNNLDRSPMY--AGVIEGIGPRYCPSIEDKVMRFA
MNMG_VIBVU       GDRTHHPRQIPCFITHTNEQTHEVIRNNLDRSPMY--AGIIEGIGPRYCPSIEDKVMRFA
MNMG_VIBVY       GDRTHHPRQIPCFITHTNEQTHEVIRNNLDRSPMY--AGIIEGIGPRYCPSIEDKVMRFA
MNMG_ALIF1       GKREHHPQQVNCFITHTNEKTHDVIRNNLDRSPMY--AGVIEGIGPRYCPSIEDKVMRFA
MNMG_PHOPR       GKTSDHPRQIPCYITYTNEKTHDVIRNNLDRSPMY--SGVIEGIGPRYCPSIEDKVMRFA
MNMG_AERHH       GDASQHPRQVPCYVTHTNERTHEVIRNNLDRSPMY--AGVIEGIGPRYCPSIEDKITRFA
MNMG_AERS4       GDASQHPRQVPCYVTHTNERTHDVIRNNLDRSPMY--AGVIEGIGPRYCPSIEDKITRFA
MNMG_COLP3       GSQADHPEQISCFITHTNEQTHQHIRDGLDRSPMY--TGVIEGVGPRYCPSIEDKITRFA
MNMG_PSEA6       GKREDHPRQIACYITHTNSKTHDIIRGGLDRSPMY--TGVIEGIGPRYCPSIEDKINRFA
MNMG_IDILO       GSRSDHPQQIPCYITHTNENTHEIIRSGLDRSPMY--SGVIEGVGPRYCPSIEDKIVRFA
MNMG_PSET1       GKPSDHPQQIPCYITFTNEKTHDVIRKNLHRSPMY--GGVIEGIGPRYCPSIEDKIVRFA
MNMG_SHEB5       GDVSHHPKQISCWITHTNEKTHEIIRGGLDRSPMY--SGVIEGIGPRYCPSIEDKIHRFA
MNMG_SHEB8       GDVSHHPKQISCWITHTNEKTHEIIRGGLDRSPMY--SGVIEGIGPRYCPSIEDKIHRFA
MNMG_SHEB9       GDVSHHPKQISCWITHTNEKTHEIIRGGLDRSPMY--SGVIEGIGPRYCPSIEDKIHRFA
MNMG_SHEPC       GDVSHHPKQISCWITHTNEKTHEIIRGGLDRSPMY--SGVIEGIGPRYCPSIEDKIHRFS
MNMG_SHESW       GDVSHHPKQISCWITHTNEKTHEIIRGGLDRSPMY--SGVIEGIGPRYCPSIEDKIHRFS
MNMG_SHESM       GDVSHHPKQISCWITHTNEKTHDIIRGGLDRSPMY--SGVIEGIGPRYCPSIEDKIHRFS
MNMG_SHESR       GDVSHHPKQISCWITHTNEKTHDIIRGGLDRSPMY--SGVIEGIGPRYCPSIEDKIHRFS
MNMG_SHESA       GDVSHHPKQISCWITHTNEKTHDIIRGGLDRSPMY--SGVIEGIGPRYCPSIEDKIHRFS
MNMG_SHEON       GDVSHHPKQISCWITHTNEKTHDIIRGGLDRSPMY--SGVIEGIGPRYCPSIEDKIHRFS
MNMG_SHEDO       GNVDQHPRQISCHITHTNEKTHDIIRGGLDRSPMY--SGVIEGIGPRYCPSIEDKIHRFA
MNMG_SHEFN       GDVSQHPRQVSCFITHTNEKTHDIIRGGLDRSPMY--SGVIEGIGPRYCPSIEDKIHRFA
MNMG_SHEHH       GDVNDHPEQVSCYITHTNERTHDIIRGGLDRSPMY--SGIIEGIGPRYCPSIEDKINRFA
MNMG_SHEPA       GDVNDHPEQVSCHITHTNERTHDIIRGGLDRSPMY--SGIIEGIGPRYCPSIEDKVNRFA
MNMG_SHESH       GDVSHHPRQVSCFVTHTNERTHDIIRGGLDRSPMY--SGIIEGVGPRYCPSIEDKINRFA
MNMG_SHEWM       GDVSQHPKQISCFVTHTNEKTHDIIRGGLDRSPMY--SGVIEGVGPRYCPSIEDKIHRFA
MNMG_SHELP       GDVKDHPKQISCFITHTNERTHDIIRGGLDRSPMY--SGVIEGIGPRYCPSIEDKINRFA
MNMG_SHEAM       GDLSQHPEQISCYITHTNEQTHDIIRGGLDRSPMY--SGVIEGIGPRYCPSIEDKIHRFA
MNMG_PSYIN       GDRSEHPRQIPCYITHTNEKTHDIIRRNLDRSPMY--SGVIEGVGPRYCPSIEDKVMRFA
MNMG_ACTP2       GSVDLHPRQIPCHITHTNEQTHDLIRNSLDRSPMY--TGIIEGIGPRYCPSIEDKVMRFS
MNMG_ACTPJ       GAVDLHPRQIPCYITHTNEQTHDLIRNSLDRSPMY--TGVIEGSGPRYCPSIEDKVMRFS
MNMG_HAEDU       GEVGQHPRQIPCYITHTNHQTHDIIRANLDRSPMY--TGIIEGIGPRYCPSIEDKVMRFG
MNMG_HAEIN       GSVDDHPQQIPCYITHTNEQTHEVIRNNLDRSPMY--TGVIEGIGPRYCPSIEDKVMRFA
MNMG_HAEIG       GSVDDHPQQIPCYITHTNEQTHEVIRNNLDRSPMY--TGVIEGIGPRYCPSIEDKVMRFS
MNMG_HAEIE       GSVDDHPQQIPCYITYTNEQTHEVIRNNLDRSPMY--TGVIEGIGPRYCPSIEDKVMRFS
MNMG_HAEI8       GSVSDHPQQIPCYITHTNEQTHEVIRNNLDRSPMY--TGVIEGIGPRYCPSIEDKVMRFA
MNMG_HAES1       GSVEQHPEQIPCYITHTNDQTHDVIRKNLDRSPMY--TGVIEGIGPRYCPSIEDKVIRFS
MNMG_HISS2       GSVEQHPEQIPCYITHTNDQTHDVIRKNLDRSPMY--TGVIEGIGPRYCPSIEDKVIRFS
MNMG_MANSM       GSVDQHPRQIPCFITHTNEQTHEVIRNNLDRSPMY--TGVIEGIGPRYCPSIEDKVMRFA
MNMG_PASMU       GSVDQHPRQIPCFITHTNEQTHEVIRNNLDRSPMY--AGIIEGIGPRYCPSIEDKVMRFS
MNMG_ACTSZ       GSTDQHPRQIPCFITHTNEQTHDVIRNNLDRSPMY--TGVIEGIGPRYCPSIEDKIMRFA
MNMG_HYDCU       GKVSMHPEQMPCYITYTNEQTHDFIRDSLDQSPMYSDAGEIDSVGPRYCPSIEDKVMRFS
MNMG_ACIAC       GSTAMHPRQVPCWITHTNERTHEIIRSGFDRSPMFT--GKIEGVGPRYCPSVEDKINRFA
MNMG_ACISJ       GGAAMHPRQVPCWITHTNARTHEIIRSGFDRSPMFT--GKIEGVGPRYCPSVEDKINRFA
MNMG_VEREI       GGARMHPQQLPCWITHTNQRTHAIIRSGFDRSPMFT--GSIEGVGPRYCPSVEDKINRFA
MNMG_POLNA       GGNVPHPKQVPCWITHTNERTHDIIRSGFDRSPMFT--GKIDGVGPRYCPSVEDKINRFA
MNMG_POLSJ       GGAIPHPQQMPCWITHTNERTHEIIRSGFDRSPMFT--GKIDGVGPRYCPSVEDKINRFA
MNMG_RHOFT       GRVEQHPPQMSCWTTHTNERTHEIIRSGFDRSPMFT--GKIEGVGPRYCPSVEDKINRFA
MNMG_LEPCP       GSAAQHPRQMPCWITNTNQRTHDILRTGFDRSPMFT--GVIEGVGPRYCPSIEDKINRFA
MNMG_METPP       GDAAMHPRQLPCWITHTSERTHEIIRSGFDRSPMFT--GVIEGVGPRYCPSIEDKVNRFA
MNMG_BURCA       GRADQHPQQLPCWVTHTNERTHDIIRGGLDRSPMYT--GVIEGVGPRYCPSIEDKIHRFA
MNMG_BURCH       GRADQHPQQLPCWVTHTNERTHDIIRGGLDRSPMYT--GVIEGVGPRYCPSIEDKIHRFA
MNMG_BURCC       GRAEQHPQQLPCWVTHTNERTHDIIRGGLDRSPMYT--GVIEGVGPRYCPSIEDKIHRFA
MNMG_BURCM       GRAEQHPQQLPCWVTHTNERTHDIIRGGLDRSPMYT--GVIEGVGPRYCPSIEDKIHRFA
MNMG_BURA4       GRAEQHPQQLPCWVTHTNERTHDIIRGGLDRSPMYT--GVIEGVGPRYCPSIEDKIHRFA
MNMG_BURL3       GRAEQHPQQLPCWVTHTNERTHDIIRGGLDRSPMYT--GVIEGVGPRYCPSIEDKIHRFA
MNMG_BURVG       GRAEQHPQQLPCWVTHTNERTHDIIRGGLDRSPMYT--GVIEGVGPRYCPSIEDKIHRFA
MNMG_BURMA       GRAEQHPQQLPCWVTHTNERTHDIIRSGLDRSPMYT--GVIEGVGPRYCPSIEDKIHRFA
MNMG_BURM9       GRAEQHPQQLPCWVTHTNERTHDIIRSGLDRSPMYT--GVIEGVGPRYCPSIEDKIHRFA
MNMG_BURP0       GRAEQHPQQLPCWVTHTNERTHDIIRSGLDRSPMYT--GVIEGVGPRYCPSIEDKIHRFA
MNMG_BURM7       GRAEQHPQQLPCWVTHTNERTHDIIRSGLDRSPMYT--GVIEGVGPRYCPSIEDKIHRFA
MNMG_BURMS       GRAEQHPQQLPCWVTHTNERTHDIIRSGLDRSPMYT--GVIEGVGPRYCPSIEDKIHRFA
MNMG_BURP1       GRAEQHPQQLPCWVTHTNERTHDIIRSGLDRSPMYT--GVIEGVGPRYCPSIEDKIHRFA
MNMG_BURPS       GRAEQHPQQLPCWVTHTNERTHDIIRSGLDRSPMYT--GVIEGVGPRYCPSIEDKIHRFA
MNMG_BURP6       GRAEQHPQQLPCWVTHTNERTHDIIRSGLDRSPMYT--GVIEGVGPRYCPSIEDKIHRFA
MNMG_BURTA       GRPEQHPEQLPCWVTHTNERTHDIIRSGLDRSPMYT--GVIEGVGPRYCPSIEDKIHRFA
MNMG_PARXL       GRVEQHPRQVPCWVTHTNARTHDIIRGGLDRSPMYT--GVIEGVGPRYCPSIEDKIHRFA
MNMG_CUPNH       GRPEQHPQQLPCWITHTNSRTHDIIRGGLDRSPMYT--GVIEGVGPRYCPSIEDKIHRFA
MNMG_CUPPJ       GRPEQHPQQLPCWISHTNSRTHDIIRGGLDRSPMYT--GVIEGVGPRYCPSIEDKIHRFA
MNMG_CUPMC       GRPEQHPQQLPCWITHTNSRTHDVIRGGLDRSPMYT--GVIEGVGPRYCPSIEDKIHRFA
MNMG_RALSO       GRTDMHPRQVPCWVTHTNERTHDIIRAGLNRSPMYT--GVIEGVGPRYCPSIEDKIHRFA
MNMG_JANMA       GSVAMHPKQMPCWITHTNEKTHDLIRSGLDRSPMYT--GVIEGVGPRYCPSIEDKIHRFA
MNMG_HERAR       GSVAMHPQQMPCWITHTNEKTHELIRGGLDRSPMYT--GMIEGVGPRYCPSIEDKIHRFA
MNMG_BORBR       GKASMHPRQLPCWITHTNARTHEIIRGGLDRSPMYS--GVIEGVGPRYCPSIEDKIHRFA
MNMG_BORPA       GKASMHPRQLPCWITHTNARTHEIIRGGLDRSPMYS--GVIEGVGPRYCPSIEDKIHRFA
MNMG_BORPE       GKASMHPRQLPCWITHTNARTHEIIRGGLDRSPMYS--GVIEGVGPRYCPSIEDKIHRFA
MNMG_BORPD       GNAAMHPRQLPCWITHTNARTHDIIRGGLDRSPMYS--GVIEGVGPRYCPSIEDKIHRFA
MNMG_BORA1       GSAALHPRQLPCWITHTNERTHDIIRGGLDRSPMYS--GVIEGIGPRYCPSIEDKIHRFA
MNMG_AZOSB       GSAAQHPAQLPCWMTHTNTRTHDVIRANLDRSPMYS--GVIEGVGPRYCPSIEDKIHRFA
MNMG_AROAE       GRASQHPQQLPCWITHTNERTHDIIRANLDRSPMYS--GVIEGVGPRYCPSIEDKIHRFA
MNMG_DECAR       GNAAQHPKQLPCWITETNERTHDIIRSGLDRSPMYT--GVIEGVGPRYCPSIEDKIHRFA
MNMG_METFK       GSAEQHPAQLPCWITFTNEKTHDIIRSGLDRSPMYT--GVIEGVGPRYCPSVEDKIHRFA
MNMG_THIDA       GDRSMHPAQRPCWITHTTVATHEIIRGGLDRSPLYA--GVIEGVGPRYCPSIEDKITRFA
MNMG_NITMU       GNAASHPKQVSCWITHTNSQTHDIIRSGLDRSPLFS--GAIEGIGPRYCPSIEDKVVRFS
MNMG_NEIG1       GNAEMHPRQVSCWITHTNTQTHDIIRSGFDRSPMFT--GKIEGVGPRYCPSIEDKINRFA
MNMG_NEIMA       GNAEMHPRQVSCWITHTNTQTHDIIRSGFDRSPMFT--GKIEGVGPRYCPSIEDKINRFA
MNMG_NEIMB       GNADMHPRQVSCWITHTNTQTHDIIRSGFDRSPMFT--GKIEGVGPRYCPSIEDKINRFA
MNMG_NEIM0       GNAEMHPRQVSCWITHTNTQTHDIIRSGFDRSPMFT--GKIEGVGPRYCPSIEDKINRFA
MNMG_NEIMF       GSADMHPRQVSCWITHTNTQTHDIIRSGFDRSPMFT--GKIEGVGPRYCPSIEDKINRFA
MNMG_CHRVO       GKRAMHPKQLPCWITHTNERTHDIIRSGFDRSPMFT--GVIEGVGPRYCPSIEDKINRFA
MNMG_POLAQ       GRPEQHPKQVPCWISHTNEQTHDIIRGGLDRSPMYT--GVIEGVGPRYCPSIEDKIHRFA
MNMG_ACIBT       GDVSMHPEQVNCYITHTNEKTHDIIRGGLDRSPMYT--GVIEGVGPRYCPSIEDKIHRFS
MNMG_ACIBY       GDVSMHPEQVNCYITHTNEKTHDIIRGGLDRSPMYT--GVIEGVGPRYCPSIEDKIHRFS
MNMG_ACIAD       GDVSMHPEQVSCYITHTNEKTHDIIRGGLDRSPMYT--GVIEGVGPRYCPSIEDKIHRFA
MNMG_PSYA2       GDVSMHPEQVNCYITHTNARTHDIIRENLDRSPMFS--GKIEGVGPRYCPSIEDKIHRFA
MNMG_PSYCK       GDVSMHPEQVNCYITHTNARTHDIIRENLDRSPMFS--GKIEGVGPRYCPSIEDKIHRFA
MNMG_PSYWF       GNVDMHPEQVNCFITHTNEKTHDIIRKHLDRSPLFS--GTIEGVGPRYCPSIEDKIHRFA
MNMG_PSEAE       GSKEQHPEQVSCWITHTNARTHEIIAANLDRSPMYS--GVIEGIGPRYCPSIEDKIHRFA
MNMG_PSEAB       GSKEQHPEQVSCWITHTNARTHEIIAANLDRSPMYS--GVIEGIGPRYCPSIEDKIHRFA
MNMG_PSEA7       GSKEQHPEQVSCWITHTNARTHEIIAANLDRSPMYS--GVIEGIGPRYCPSIEDKIHRFA
MNMG_PSEPU       GNAEMHPRQVSCWITHTNARTHEIIASNLDRSPMYS--GVIEGVGPRYCPSIEDKIHRFA
MNMG_PSEPK       GNAEMHPRQVSCWITHTNARTHEIIASNLDRSPMYS--GVIEGVGPRYCPSIEDKIHRFA
MNMG_PSEP1       GNAEMHPRQVSCWITHTNARTHEIIASNLDRSPMYS--GVIEGVGPRYCPSIEDKIHRFA
MNMG_PSEPG       GNAEMHPRQVSCWITHTNARTHEIIASNLDRSPMYS--GVIEGVGPRYCPSIEDKIHRFA
MNMG_PSEPW       GNAAMHPRQVSCWITHTNARTHEIIASNLDRSPMYS--GVIEGVGPRYCPSIEDKIHRFA
MNMG_PSEE4       GNAAMHPRQVSCWITHTNARTHEIIASNLDRSPMYS--GVIEGIGPRYCPSIEDKIHRFA
MNMG_PSEF5       GSKEQHPPQVSCWITHTNARTHEIIASNLDRSPMYS--GVIEGIGPRYCPSIEDKIHRFA
MNMG_PSEPF       GNKEQHPRQVSCWITHTNARTHEIIAANLDRSPMYSAAGEIEGIGPRYCPSIEDKIHRFA
MNMG_PSE14       GNKEQHPPQVSCWITHTNARTHEIIASNLDRSPMYS--GVIEGIGPRYCPSIEDKIHRFA
MNMG_PSEU2       GNKEQHPPQVSCWITHTNARTHEIIASNLDRSPMYS--GVIEGIGPRYCPSIEDKIHRFA
MNMG_PSESM       GSKEQHPAQVSCWITHTNARTHEIIASNLDRSPMYS--GVIEGIGPRYCPSIEDKIHRFA
MNMG_PSEMY       GKREHQPKQISCWITHTNARTHEIIAANLDRSPMYS--GVIEGVGPRYCPSIEDKIHRFA
MNMG_PSEU5       GSREQHPPQVSCWITHTNARTHEIIAANLDRSPMYS--GVIEGVGPRYCPSIEDKIHRFA
MNMG_ALCBS       GKVEEHPQQVCCYITHTNAQTHDIIRSGFDRSPMFT--GVIDGVGPRYCPSIEDKVNRYP
MNMG_HAHCH       GSVDLHPHQVNCFITRTNERTHEIIRGGMDRSPMYT--GVIEGVGPRYCPSIEDKVNRFS
MNMG_MARMS       GNRAMHPRQIECFITHTNERTHDIIRAGMDRSPMYT--GVIEGVGPRYCPSIEDKIVRFA
MNMG_SACD2       GSLADHPEQTCCWITHTNAQTHDFIRSGFDRSPMFT--GVIEGVGPRYCPSIEDKVNRFA
MNMG_CHRSD       GRRDQHPRQVACHIAHTNARTHEIIHANLDRSPMYS--GVIGGVGPRYCPSIEDKVNRFA
MNMG_MARHV       GSRDEHPEQICCYVTRTTEETHDIIRSGFDRSPMFA--GNIEGVGPRYCPSIEDKVNRFA
MNMG_ALKEH       GRPDEHPAQVPCHIAHTRPETHDIIRGALDRSPMYS--GTIEGVGPRYCPSIEDKVVRFA
MNMG_NITOC       GSAEDHPQQVSCHITRTNLCTHEIIRASLDRSPIYS--GEIEGIGPRYCPSIEDKVVRFS
MNMG_METCA       GTREEHPPQVSCYITRTNERTHELIRAGLDRSPMFT--GVIEGIGPRYCPSIEDKVVRFA
MNMG_XANAC       GQVSDHPRQVSCWITQTTEQTHEIIRNALHRSPLYS--GQIEGIGPRYCPSIEDKVVRFA
MNMG_XANC5       GQVSDHPRQVSCWITQTTEQTHEIIRNALHRSPLYS--GQIEGIGPRYCPSIEDKVVRFA
MNMG_XANOR       GQVSDHPRQVSCWITQTTEQTHDIIRNALHRSPLYS--GQIEGIGPRYCPSIEDKVVRFA
MNMG_XANOM       GQVSDHPRQVSCWITQTTEQTHDIIRNALHRSPLYS--GQIEGIGPRYCPSIEDKVVRFA
MNMG_XANCP       GQVSDHPTQVSCWITHTTEQTHDIIRGALHRSPLYS--GQIEGIGPRYCPSIEDKVVRFA
MNMG_XANC8       GQVSDHPTQVSCWITHTTEQTHDIIRGALHRSPLYS--GQIEGIGPRYCPSIEDKVVRFA
MNMG_XANCB       GQVSDHPTQVSCWITHTTEQTHDIIRGALHRSPLYS--GQIEGIGPRYCPSIEDKVVRFA
MNMG_XYLFA       GNSASHPPQVSCWITQTTERTHEIIRAALHRSPLYS--GQIEGAGPRYCPSIEDKVVRFA
MNMG_XYLFT       GNSASHPPQVSCWITQTTERTHEIIRAALHRSPLYS--GQIEGTGPRYCPSIEDKVVRFA
MNMG_COXBU       SHGEDRPRQVSCFITQTNEKTHDIIRNGLKTSPLFS--GVIEGVGPRYCPSIEDKIVRFA
MNMG_COXBN       SHGEDRPRQVSCFITQTNEKTHDIIRNGLKTSPLFS--GVIEGVGPRYCPSIEDKIVRFA
MNMG_COXBR       SHGEDRPRQVSCFITQTNEKTHDIIRNGLKTSPLFS--GVIEGVGPRYCPSIEDKIVRFA
MNMG_LEGPC       GTASDHPQQVPCHITHTTEATHDIIRNNLDKSPMYA--GVIEGVGPRYCPSIEDKIVRFA
MNMG_LEGPA       GTASDHPQQVPCHITHTTEATHDIIRNNLDKSPMYA--GVIEGVGPRYCPSIEDKIVRFA
MNMG_LEGPL       GTASDHPQQVSCHITHTTEATHDIIRNNLDKSPMYA--GVIEGVGPRYCPSIEDKIVRFA
MNMG_LEGPH       GAASDHPQQVPCHITHTTEATHDIIRNNLDKSPMYA--GVIEGVGPRYCPSIEDKIVRFA
MNMG_NITEU       GNITQHPRQISCWMTRTNERTHEIIRTGLDRSPLYT--GKIEGIGPRYCPSIEDKVVRFS
MNMG_NITEC       GNTAQHPRQVSCWMTRTNEKTHEIIRAGLDHSPLYT--GKIEGIGPRYCPSIEDKVVRFS
MNMG_FRATF       --KIEHPRQIPCYITYTNNETHKIITDNLDKSAMYS--GLIEGIGPRYCPSIEDKVVRFA
MNMG_FRATH       --KIEHPRQIPCYITYTNNETHKIITDNLDKSAMYS--GLIEGIGPRYCPSIEDKVVRFA
MNMG_FRATO       --KIEHPRQIPCYITYTNNETHKIITDNLDKSAMYS--GLIEGIGPRYCPSIEDKVVRFA
MNMG_FRATW       --KIEHPRQIPCYITYTNNETHKIITDNLDKSAMYS--GLIEGIGPRYCPSIEDKVVRFA
MNMG_FRATT       --KIEHPRQIPCYITYTNNETHKIITDNLDKSAMYS--GLIEGIGPRYCPSIEDKVVRFA
MNMG_FRAT1       --KIEHPRQIPCYITYTNNETHKIITDNLDKSAMYS--GLIEGIGPRYCPSIEDKVVRFA
MNMG_FRATN       --KIEHPRQIPCYITYTNNETHKIITDNLDKSAMYS--GLIEGIGPRYCPSIEDKVVRFA
MNMG_FRAP2       --KIEHPRQIPCYITYTNSKTHEIITNNLDKSAMYS--GLIEGIGPRYCPSIEDKVVRFA
MNMG_VESOH       --KEEHPRQIPCYITHTNKRTHDLIRSGLKDSPIFT--GNIESIGPRYCPSIEDKVVRFN
MNMG_RUTMC       --KEDHPRQIPCYITHTNEKTHDLIRDGLKDSPMFT--GNIEGISPRYCPSIEDKVVRFS
MNMG_DICNV       GNVNEHPRQIPCHITHTNTQTHDIIREYIDQAPMYA-GVIKDAFGPRYCPSIEDKVMRFH
MNMG_BLOFL       GSFEQHPKQIPCYSTYTNKKTHDIIRLNLNQSPVYS--GLINGISPRYCPSIEDKVVRFS
MNMG_BLOPB       GSTKLHPTQVPCYITHTNNKTHEIVRSNLYQSPMYT--GLIKGIAPRYCPSIEDKITRFS
MNMG_BAUCH       GSVSEHPRQIPCYITYTNKNTHDIIYNNLHYSPIYT--KNIEGIGPRYCPSIEDKIIHFA
MNMG_BUCAI       GNVSHHPKQIPCYLTHTNEKTHEIIRKNLDKSPIYT--GFLKGLGPRYCPSIEDKIVRFP
MNMG_BUCAP       GDISNHPLQIPCFLTHTNEKTHEIIRKNLHKSPLYT--GIIKGVGPRYCPSIEDKIVRFP
MNMG_BUCBP       GNQKEHPRQIPCYITATNEKTHEIVRKNLKKSPIYS--GLITGIGPRYCPSIEDKIVRFS
MNMG_WIGBR       KFVGIRPKQLPCYITYTNKNTHNIIIDNIKHSPIYN--GSIKGIGPRYCPSIEDKVVRFS
MNMG_BUCCC       GKIEQHPKQVPCYITYTNDHTHSIIKKNLHLSPLYS--GSITGIGPRYCPSIEDKIIKFP
MNMG_HALHL       -PPEAPLPEAACLISWTTPETHRIIRDALDHSPMYS--GAIQSSGPRYCPSIEDKVVRFA
MNMG_RHIME       -TDAIINRQIDCGVTRTTDATHKIIADNIHQSAM--YSGQIEGVGPRYCPSIEDKIVRFG
MNMG_SINMW       -TDAIVNRQIDCGVTRTTDATHKIIADNIHRSAM--YSGQIEGVGPRYCPSIEDKIVRFG
MNMG_RHIEC       -TDSITTRQVECGVTRTTEATHRIIVDNIKHSAM--YSGQIEGVGPRYCPSIEDKLVKFG
MNMG_RHIL3       -TDTITTRQIECGVTRTTEATHRIIVDNIMRSAM--YSGQIEGVGPRYCPSIEDKLVKFG
MNMG_AGRFC       -TDHILNPQIECGVTRTTPASHKIIQDNIHLSAM--YSGQIEGVGPRYCPSIEDKITRFG
MNMG_BARHE       -TEKIEQPQIECAITRTNAQTHQIIRENIHRSAL--YSGNIEGLGPRYCPSIEDKIVKFG
MNMG_BARQU       -TEKIEQPQIECAITRTNTQTHQIIRENIHRSAL--YSGMIEGLGPRYCPSVEDKIVKFG
MNMG_BART1       -TEKIEQPQIECAITRTNAQTHQIIRDNIHRSAL--YSGNIEGLGPRYCPSVEDKIVKFG
MNMG_BARBK       -TEKIKQPQIECAITRTNAQTHHIISENIHRSAL--YSGAIEGVGPRYCPSIEDKIIKFG
MNMG_BRUAB       -TDRITTPQIECGITRTTPETHDIIRANLHRSAM--YSGSIEGIGPRYCPSVEDKIVKFG
MNMG_BRUA2       -TDRITTPQIECGITRTTPETHDIIRANLHRSAM--YSGSIEGIGPRYCPSVEDKIVKFG
MNMG_BRUC2       -TDRITTPQIECGITRTTPETHDIIRANLHRSAM--YSGSIEGIGPRYCPSVEDKIVKFG
MNMG_BRUSU       -TDRITTPQIECGITRTTPETHDIIRANLHRSAM--YSGSIEGIGPRYCPSVEDKIVKFG
MNMG_BRUSI       -TDRITTPQIECGITRTTPETHDIIRANLHRSAM--YSGSIEGIGPRYCPSVEDKIVKFG
MNMG_BRUME       -TDRITTPQIECGITRTTPETHDIIRANLHRSAM--YSGSIEGIGPRYCPSVEDKIVKFG
MNMG_BRUO2       -TDRITTPQIECGITRTTPETHDIIRANLHRSAM--YSGSIEGIGPRYCPSVEDKIVKFG
MNMG_BRUA4       -TDRITIPQIDCGITRTTPETHAVIRANLHRSAM--YSGSIEGIGPRYCPSVEDKIVKFG
MNMG_RHILO       -SDRITTPQIECGITRTTSATHELIRANLGRSAM--YSGSIEGVGPRYCPSIEDKIVKFG
MNMG_CHESB       -SEKIQNPQITCGITRTTTDTHRIIQENLDKSAM--YSGQIEGIGPRYCPSIEDKIVKFG
MNMG_BRASB       -TQTITTPQIQCGITRTTTATHDVIRANVHRSPM--YSGQIKSTGPRYCPSVEDKIVRFG
MNMG_BRASO       -TETITTPQIQCGITRTTIATHEVIRANVHRSPM--YSGQIKSTGPRYCPSVEDKIVRFG
MNMG_BRADU       -TDRITTPQIQCGITRTTAATHEVIRANVHRSPM--YSGQIKSSGPRYCPSIEDKIVRFG
MNMG_NITHX       -TSRITTPQIRCGITRTMPATHEVIRANVHRSPI--YSGQIRSSGPRYCPSLEDKVVRFG
MNMG_NITWN       -TARITTPQIQCGITRTTPATHDLIRTNVHRSPI--YSGQITSSGPRYCPSIEDKVVRFG
MNMG_RHOPS       -TPAITTPQIECGITRTTPATHAVIRDNVHRSPM--YSGQIQSTGPRYCPSIEDKIVRFG
MNMG_RHOP2       -TPAITTPQIECGITRTLPATHEVIRANVHRSPM--YSGQIQSSGPRYCPSIEDKIVKFG
MNMG_RHOPA       -TPAITTPQIECGITRTTTATHEVIRANVHRSPM--YSGQIQSTGPRYCPSIEDKIVKFG
MNMG_RHOP5       -TARISNPQILCGITRTTPATHDLIRANVHRSPM--YSGQIQSSGPRYCPSIEDKIVRFG
MNMG_RHOPB       -TEKITNPQIECGITRTTPATHAVIRANVHRSPM--YSGQIQSSGPRYCPSIEDKIVRFG
MNMG_AZOC5       -TTALPNPQVSCGITRTTQATHDVIRANLSRSAM--YSGRIESTGPRYCPSIEDKVVRFG
MNMG_METPB       -TERITTPQIACGITRTTQRVHDLIRENLHRSPM--YSGGISSRGPRYCPSIEDKVVRFG
MNMG_METRJ       -TERITNPQIRCGITRTTRAVHDLIRANLHRSPM--YSGGIASRGPRYCPSIEDKVVRFG
MNMG_METS4       -TDRITTPQIECGVTRTTQAVHDLIRANLHRSPM--YSGGITSRGPRYCPSIEDKVVRFG
MNMG_BEII9       -TEAITRPQVDCFITTTTPETHAVIRENLHYSPV--YSGAINGRGPRYCPSIEDKVVRFA
MNMG_PARL1       -TTEITTPQVPCHITRTTAEGHRIIEDNLHVSPV--YSGQIEGVGPRYCPSIEDKVVRFR
MNMG_RHORT       -TTAITTPQISCAITETTAETHRVIRENLHRAPL--YSGQIQGVGPRYCPSIEDKVVRFA
MNMG_MAGSA       -TERITTPQVACGITATTPETHAIIRANLERAPM--YSGQIQSTGPRYCPSIEDKVVRFA
MNMG_CAUVC       -NHRIDVPQIACGVTYTTEETHRIIAERIGESLV--YSGRATGVGPRYCPSIEDKVVRFA
MNMG_CAUSK       -TTRIDVPQIQCGITYTTAETHKIIAERLGESAV--YGGRATGIGPRYCPSIEDKVVRFA
MNMG_MARMM       -TDRIEVHQISCAVTRTTEATHKIIADNLGQSAV--YSGAIAGRGPRYCPSIEDKVVRFA
MNMG_HYPNA       -NSEITVRQVQCGITWTTPETHAIIEAHMNESAV--YSGAISGRGPRYCPSIEDKVNRFG
MNMG_GLUOX       -TTAIINPQVVCRISHTTAETHRIINENLHRSAM--YGGAIAGRGPRYCPSIEDKVVRFA
MNMG_GLUDA       -TQAIDNPQLSCRITATTPRTHALIREHLHLSAV--YGGAIAGRGPRYCPSIEDKVVRFA
MNMG_GRABC       -NHHIDLPQISCRISETTADTHQIIRDNLHRSAV--YGGMLSGKGPRYCPSIEDKVVRFP
MNMG_ACICJ       -TGRIANPQISCRISETTPETHAIINANLHRSAV--YGGRIDGAGPRYCPSIEDKVVRFA
MNMG_RUEPO       -SKGAYARQIACGITHTNAQTHEIIRKNLSRSAM--YGGHIEGVGPRYCPSIEDKIVRFA
MNMG_RUEST       -STNTSAPQIACGITHTNEKTHEIIRDNLELSAM--YGGHIEGVGPRYCPSIEDKIVRFA
MNMG_ROSDO       -SKGVSARQVSCGITHTNVRTHDIIRDNITRSAM--YGGHIDGVGPRYCPSIEDKIIRFA
MNMG_DINSH       -SAGPHLRQVHCAVTHTNERTHEIIRKNLSRSAM--YGGSIEGVGPRYCPSIEDKVVRFS
MNMG_RHOS1       -NRVPKARQIACGITHTNARTHQIVRDNLSRSAM--YGGHIEGVGPRYCPSIEDKIVRFA
MNMG_CERS4       -NRAPKARQIACGITHTNARTHQIVRDNLSRSAM--YGGHIEGVGPRYCPSIEDKIVRFA
MNMG_CERS5       -NHAPVARQISCGITSTNERTHEIVRDNLHQSAM--YGGHIEGVGPRYCPSIEDKIVRFA
MNMG_PARDP       -NTVPEAPQVSCAITHTNPDTHRIIRENLARSAM--YGGRIDGVGPRYCPSIEDKVVRFA
MNMG_JANSC       -TKRVRARQIACGITHTNPHTHDIIEQNLGRSAM--YGGNIDSVGPRYCPSIEDKVVRFA
MNMG_NOVAD       -TPARPLPQVFCAIARTNARTHEIIRGGLDRSPL--FTGAIGAQGPRYCPSIEDKIHRFG
MNMG_ERYLH       -TPARSNPEIFCGITRTNARAHDIIRANLNRSPL--FSGAIDAQGPRYCPSIEDKIHRFG
MNMG_SPHAL       -NNARTVPQIFCAITRTNAESHRIIAENLHRSPL--FTGAIGAAGPRYCPSIEDKIHRFA
MNMG_SPHWW       -TPHRLVPQLACAITRTNQRTHDVIRAGLDRSPL--FSGAITGVGPRYCPSIEDKVHRFG
MNMG_ZYMMO       -GAGRVAPQIACSLTRSNQKTHDIIRAGLDRSPL--FSGAIEGRGPRYCPSIEDKIMKFG
MNMG_ANAMM       -SDAIVLPQVSCYITHTNTKTHEIVRNNLHLAAS--CASLVDVAAPRYCPSIEEKVRRFP
MNMG_ANAPZ       -SECVSLPQISCYVTHTNEKTHEIIRRNLHLAGSR-CESLLDVMAPRYCPSIEEKIRRFP
MNMG_EHRCJ       -SQSIDLPQISCYLTATNNKTHEVIKNNLHRAAA--SNLLKDIKAPRYCPSIEEKVRRFS
MNMG_EHRCR       -SQSIDLPQISCYLTATNTRTHEVIKNNLHRAAA--SNSLKDIKAPRYCPSIEEKVRRFS
MNMG_EHRRG       -SESINLPQISCYLTATNTKTHEVIKNNLHKAAA--SNLLKEIKAPRYCPSIEEKVRRFS
MNMG_EHRRW       -SESINLPQISCYLTATNTKTHEVIKNNLHKAAA--SNLLKEIKAPRYCPSIEEKVRRFS
MNMG_WOLPM       -TEKINQPQVSCFITHTNENTHKIIRENLHRSAS---SYLDDIIAPRYCPSIEVKVNKFA
MNMG_WOLTR       -TEKINQPQVSCFITYTNENTHRIIQANLHRSAS---SYLNDIVAPRYCPSIEAKVKKFA
MNMG_NEOSM       -NTEITVPQVSCYITHTNGKTHEIIRNSLKFSAI---RNGVSARGPRYCPSIEDKVVRFA
MNMG_RICRO       -TNIVNVSQINCFITKTTSETHDIIRENLDKSAM--YSGQIEGIGPRYCPSIEDKIVRFS
MNMG_RICRS       -TNIVNVSQINCFITKTTSETHDIIRENLDKSAM--YSGQIEGIGPRYCPSIEDKIVRFS
MNMG_RICCN       -TNIVNVSQINCFITKTTSETHDIIRENLDKSAM--YSGQIEGIGPRYCPSIEDKIVRFS
MNMG_RICM5       -TNIVNVSQINCFITKTTSETHDIIRENLDKSAM--YSGQIEGIGPRYCPSIEDKIVRFS
MNMG_RICFE       -TSVVNVPQINCFITKTTSETHDIIRENLNKSAM--YSGQIEGIGPRYCPSIEDKIVRFS
MNMG_RICAH       -TNVVNVPQINCFITKTTSETHDIIRENLNKSAM--YSGQIEGIGPRYCPSIEDKIVRFS
MNMG_RICCK       -TNIVDVPQINCFITKTTSETHDIIRENLDKSAM--YSGQIEAIGPRYCPSIEDKIVRFS
MNMG_RICB8       -TDNVNVPQINCFVTKTTTETHNVIRANLDKSAM--YSGQIEGIGPRYCPSIEDKIVRFS
MNMG_RICBR       -TDNVNVPQINCFVTKTTTETHNVIRANLDKSAM--YSGQIEGIGPRYCPSIEDKIVRFS
MNMG_RICPR       -TDVIDVPQINCFITKTTSETHDIIRENLDKSAM--YSGQIEGIGPRYCPSIEDKIVKFS
MNMG_RICTY       -TDAIDVPQINCFITKTTAETHDIIRENLDKSAM--YSGQIKGIGPRYCPSIEDKIVKFS
MNMG_ORITB       -TKKVLVPQIKCYITRTNEITHKIIKENLHLSAM--YSGQIQGTGPRYCPSIEDKIIRFS
MNMG_PELUB       -TKKNLNKQISCRMTYTNEKVHKIIQKNLKRSAM--YSGSIQGVGPRYCPSIEDKIVKFA
MNMG_KORVE       -TKKITQKQVPCYIAHTTPETHQLIRENVHRSPMY--SGQIQSTGPRYCPSIEDKIVKFP
MNMG_SOLUE       -TGRIERQQIQCHIGYTTDETRRVLQEAIPRSPLY--SGQIEGVGPRYCPSIEDKFVKFP
MNMG_MAGMM       -HDKIERPEMPCWIAQTSKETKQIIEKNIHRSAMY--SGQIEGVGPRYCPSIEDKIKKFK
MNMG_CAMJE       ---NFNPTQLPCYIARTNTTTHEIIKNNFYRAPLFT--GQIEGVGPRYCPSIEDKINRFS
MNMG_CAMJJ       ---NFNPTQLPCYIARTNTTTHEIIKNNFYRAPLFT--GQIEGVGPRYCPSIEDKINRFS
MNMG_CAMJR       ---NFNPTQLPCYIARTNTTTHEIIKNNFYRAPLFT--GQIEGVGPRYCPSIEDKINRFS
MNMG_CAMJ8       ---NFNPTQLPCYIARTNTTTHEIIKNNFYRAPLFT--GQIEGVGPRYCPSIEDKINRFS
MNMG_CAMJD       ---NFNPTQLPCYIARTNTTTHEIIKNNFYRAPLFT--GQIEGVGPRYCPSIEDKINRFS
MNMG_CAMC1       ---NFSPTQLPCYIAYTNETTHEIIRSNFDKAPLFT--GQIEGIGPRYCPSIEDKINRFG
MNMG_CAMC5       ---HFAPEQLPCYIAYTNETTHEIIRSNFDKAPLFT--GQIEGIGPRYCPSIEDKINRFG
MNMG_CAMFF       ---EFNKTQLPCYIAYTNEKTHEIIRSNFDRAPLFT--GQIEGIGPRYCPSIEDKINRFG
MNMG_CAMHC       ENGNFNPTQIPCYITYTNEKTHEIIRNNFDRAPLFT--GQIHGIGPRYCPSIEDKINKFA
MNMG_NITSB       ---RFNPTQLPCYITYTNERTHEIIESNFHRAPLFT--GQIEGVGPRYCPSIEDKIYRFR
MNMG_SULDN       ---RKTKKQIPCYITYTNQNTHDIIESNFYRAPMFT--GQIEGRGPRYCPSIEDKINRFR
MNMG_ARCB4       ---DFAPTQFPCYITYTNEKTHEIISSNFYRAPLFT--GQIEGLGPRYCPSIEDKVNRFA
MNMG_SULNB       ---TFNPKQLPCYVAYTNERTHEIIESNFYRAPMFS--GQIEGVGPRYCPSIEDKINRFR
MNMG_HELPY       ---DFNPTQLSCFITYTNPITHQIIRDNFHRAPLFS--GQIEGIGPRYCPSIEDKINRFS
MNMG_HELPH       ---DFNPTQLSCFITYTNPITHQIIRDNFHRAPLFS--GQIEGIGPRYCPSIEDKINRFS
MNMG_HELPJ       ---DFNPTQLSCFITYTNPITHQIIRDNFHRAPLFS--GQIEGIGPRYCPSIEDKINRFS
MNMG_HELAH       ---NFNPTQLSCFITYTNPTTHQIIRDNFHRAPLFS--GQIEGIGPRYCPSIEDKINRFS
MNMG_HELHP       ---NFSPTQLPCFVTYTNENTHKIIRDNFHRAPLFT--GQIEGVGPRYCPSIEDKVNRFA
MNMG_WOLSU       ---EFAPTQLPCYVTYTNEKTHEIIRSNFHRAPMFT--GQIEGIGPRYCPSIEDKVNRFK
MNMG_LEPIN       ---KITRKQIPCFITYTNAETHKLIHENLNLSPMYS--GQIQSTGPRYCPSIEDKVVRFA
MNMG_LEPIC       ---KITRKQIPCFITYTNAETHKLIHENLNLSPMYS--GQIQSTGPRYCPSIEDKVVRFA
MNMG_LEPBJ       ---KITRRQIPCYITYTNVETHKLIHENLSLSPMYS--GQIQSTGPRYCPSIEDKVVRFA
MNMG_LEPBL       ---KITRRQIPCYITYTNVETHKLIHENLSLSPMYS--GQIQSTGPRYCPSIEDKVVRFA
MNMG_LEPBA       ---KIDRKQIPCFITYTNDTTHELIKQNLEYSPMYS--GQIKSVGPRYCPSIEDKVVRFA
MNMG_LEPBP       ---KIDRKQIPCFITYTNDTTHELIKQNLEYSPMYS--GQIKSVGPRYCPSIEDKVVRFA
MNMG_GEOMG       ----IDQPQVPCYIAYTNPRSHEIIRSGLDRSPLYA--GVIEGIGPRYCPSIEDKVVRFP
MNMG_GEOSL       ----IDRPQLPCYIAYTNERTHEIIRSGLDRSPLYS--GVIEGVGPRYCPSIEDKVMRFP
MNMG_GEOUR       ----ITQSQVPCHIAYTNERSHDIIRSGLDRSPLYS--GIIEGVGPRYCPSIEDKVVRFP
MNMG_PELPD       ----ITMRQVPCHIAYTNERSHDIIRSGLDRSPLYA--GIIEGIGPRYCPSIEDKVVRFP
MNMG_PELCD       ----ITSPQVPCFITATNAHTHDIIRQGLDRSPLYQ--GVIEGVGPRYCPSIEDKIMRFP
MNMG_DESPS       ---GYTLPQLPCYITYTNEKTHEIIRKGIDQSPLYA--GIIQGIGARYCPSIEDKIMRFP
MNMG_DESVH       ----VRLPQLPCHVTWTNERTHEAIRAGFDRSPMFT--GVIKGTGARYCPSIEDKVARFP
MNMG_DESVV       ----VRLPQLPCHVTWTNERTHEAIRAGFDRSPMFT--GVIKGTGARYCPSIEDKVARFP
MNMG_DESAG       ----ARMPQVPCYLTWTNEATHEAIRAGFDRSPMFT--GIISGTGARYCPSIEDKIARFP
MNMG_LAWIP       ----PSQPQVPCYITWTNEYTHDVIRSGMDRSPMFT--GVITGTGARYCPSIEDKVARFA
MNMG_SYNFM       ----IALPQVSCFIGKTHQRTHELVRRHIHLSPLYN--GTIRGVSARYCPSLEDKVMRFP
MNMG_SYNAS       ----LGKERLPSYFGYTTSETHRLIRDNIRFSPLYS--GVIKGVSARYCPSLEDKVMRFA
MNMG_CHLTE       ----ANRNLVSCYLTKTTEKTHDILRTGFDRSPLFT--GKVQGVGPRYCPSIEDKISRFP
MNMG_CHLCH       ----LQSKQVSCFITKTTEETHAILRKGFERSPLFT--GKVQGIGPRYCPSVEDKIFRFP
MNMG_CHLPM       ----AGKEQISCFLTKTTHKTHEILRTGFDRSPLFS--GKVQGVGPRYCPSIEDKIHRFT
MNMG_CHLL3       ----KGRAQLSCYVTHSSERTHEILKTGFDRSPLFT--GKVQGIGPRYCPSIEDKIFRFP
MNMG_CHLPD       ----GHRAQVSCFVTKTKETTHELLRTGFSRSPLFS--GKVQGVGPRYCPSVEDKIFRFP
MNMG_BACFR       ----RHLKQLQCWTCFTNEEAHNVLRNGLADSPLFN--GQIQSIGPRYCPSIETKIVTFP
MNMG_BACFN       ----RHLKQLQCWTCFTNEEAHNVLRNGLADSPLFN--GQIQSIGPRYCPSIETKIVTFP
MNMG_BACTN       ----RHLKQLQCWTCYTNEEVHRILREGLPDSPLFN--GQIQSIGPRYCPSIETKIVTFP
MNMG_PHOV8       ----RKLKQLQCWTCFTNEEVHEILRKGLPDSPLFN--GQIQSIGPRYCPSIETKIVTFP
MNMG_PARD8       ----RKLKQLSCWTTFTNEACHDILREGLPDSPLYN--GQIKSIGPRYCPSIETKIVTFA
MNMG_PORGI       ----RVLRQRSCYALYTNPECHEILSKGLDRSPLYN--GQIQSIGPRYCPSIETKIVTFA
MNMG_FLAJ1       ----PLTQQRSCYMTYTSLNVHDILREGFDRSPMFN--GRIKSLGPRYCPSIEDKINRFA
MNMG_FLAPJ       ----PLVHQRDCHMTYTSLLVHDILREGFERSPMFN--GRIKSLGPRYCPSIEDKINRFA
MNMG_GRAFK       ----PLSKQRSCHMTYTSNEVHDILKEGFDRSPMFN--GRIQSIGPRYCPSIEDKINRFA
MNMG_CYTH3       ----SLTKQRSCHITYTNQAVHDTLKEGFDRSPMFT--GRIKGLGPRYCPSVEDKINRFA
MNMG_SULMW       ----ILK-QKKCYITHTNLETHNLLSKEFNRSPIFN--GKIKCVGPRYCPSIEEKVYRFS
MNMG_SALRD       ----SVEAQLSCWLTDTTPETHEVLRTGFDRSPMFT--GALDADGPRYCPSIEDKIDRFS
MNMG_BORAP       ----LDKSQLSCYVTYTNKRTHEIISENMHLSPLYS--GEIVGNGPRYCPSIEDKIVKFK
MNMG_BORBP       ----LDKSQLSCYVTYTNKRTHEIISENMHLSPLYS--GEIVGNGPRYCPSIEDKIVKFK
MNMG_BORBU       ----LDKSQLSCYVTYTNKKTHEIISENMHLSPLYS--GEIVGNGPRYCPSIEDKIVKFK
MNMG_TREDE       ----IHRPYAKCYITHTNQETHDIIRENLHRAALFS--GKITGTGARYCPSIEDKIKKFP
MNMG_TREPA       ----INRPHADCYINYTNERTHQLIRENFHRSPFFS--GRIKAVGTRYCPSIEDKVRKFP
MNMG1_FUSNN      -----KNNTVPTWLTYTSDKTIEVIKEMMKFSPIVS--GMVNTHGPRHCPSIDRKVLNFP
MNMG2_FUSNN      ---ALSRRQISCYIAHTNEKVHEIIRNAKERSPLFN--GTIQGLGPRYCPSIEDKIFRYP
MNMG_ENDTX       ---RKNLKQLSCWLTYTNPITHKIVSDNLGLSSIYI--GEVNSKSPRYCPSIEEKIERYP
MNMG_ONYPE       ----QRPQE-PCFLTHTNQTTHQVIQKHLNQSAMYG--GYVEGTGPRYCPSIEDKVVRFC
MNMG_AYWBP       ----KRPQE-PCFLTHTNQTTHQVIRKHLNQSAMYG--GYVEGIGPRYCPSIEDKVVRFC
MNMG_ACHLI       ----LGHQE-FSYLIHTSPDTKDIIFNNLDASAMYG--GVVEGVGPRYCPSIEDKFVRFK
MNMG_MYCCT       ----PIEKQQPCYLIHSTLETKKIIEDNLEKSAMYS--GTVESIGPRYCPSFEDKVVRFK
MNMG_MYCMS       ----PIEKQQPCYLIHSTLETKKIIEDNLEKSAMYS--GTVKSIGPRYCPSFEDKAVRFR
MNMG_MESFL       ----PIEKQELCYLIHSSSETKKIIEDNLTKSAMYS--GKVESIGPRYCPSFEDKIVRFS
MNMG_MYCGE       ----PLEKQIPCYLVHTNQKIHDLILKNLKKSAMFN--GSISAQGPLYCPSIEDKVFKFS
MNMG_MYCPN       ----PLEQQVICHLIHTNPQIHQLILANLKQSAVFN--GSIKANGPLYCPSIEDKVFRFQ
MNMG_MYCGA       ----YIDYELPCYLIHTTEEIHKIINDNLHLSAMYS--GNITGVGPRYCPSIEDKIVRFS
MNMG_UREPA       ----PYDEQLPCHIIYTNEQTHQIIRENLNKSAMYG--GMISGIGPRYCPSIEDKIVKFS
MNMG_UREP2       ----PYDEQLPCHIIYTNEQTHQIIRENLNKSAMYG--GMISGIGPRYCPSIEDKIVKFS
MNMG_MYCPE       ----DFNKQEVCYLAFTNNKIHEIINNNLDKSAMYS--GFITGTGPRYCPSIEDKVVRFN
MNMG_MYCH7       ----KLKKQISCYLTYTTAKTHDIINKNLGKSSMYS--GLISGVGPRYCPSIEDKIVRFS
MNMG_MYCHJ       ----KIKKQISCYLTYTTAKTHDIINKNLGKSSMYS--GLISGVGPRYCPSIEDKIVRFS
MNMG_MYCH2       ----KLKKQISCYLTYTTAKTHDIINKNLGKSSMYS--GLISGVGPRYCPSIEDKIVRFS
MNMG_MYCPU       ----KIDKQIHCYLTYTNEKTHKIIQDNINKSAMYS--QLIEGTGPRYCPSVEDKIMKFA
MNMG_MYCS5       ----KLNQQVSCYLTYTNEKTHEIILNNLDKSSMYS--GLIKGTGPRYCPSIEDKVVRFS
MNMG_MYCMO       ----KLSKQIHCYLTYTSEKTHQIILDNINKSSMYS--GLIKGIGPRYCPSVEDKIVRFK
MNMG_MYCAP       ----KKPKQIACYLTYTTPETHRIIEENIHRSPMYS--GVIEGIGPRYCPSVEDKIVKFP
MNMG_THEM4       ----VLPKDHPCWLTHTNEKTHKIIRDYLVYSPLYGKVKLIQSVGPRYCPSIEDKVVKFN
MNMG_FERNB       ----VLEKDYPCWLTHTTPESHKIIRDYLIFSPLYGEVKLIQAKGPRYCPSIEDKVVKFE
MNMG_THEMA       ----VLPKDYPCWLTRTNPETHSIIKQYLEFSPLYGTVKLIEGIGPRYCPSIEDKVVKFK
MNMG_THESQ       ----VLPKDYPCWLTRTNPETHSIIKQYLEFSPLYGTVKLIEGIGPRYCPSIEDKVVKFK
MNMG_THEP1       ----VLPKDYPCWLTRTNPETHSIIRQYLEFSPLYGTVKLIEGVGPRYCPSIEDKVVKFK
MNMG_PETMO       ----VLTKDYPCYLGRTNSKTHEVIRKYIAFSPLYGDVKLIQSIGPRYCPSIEDKVMKFN
MNMG_BDEBA       ----LKLPQVLCYLTRTTEETHDIIRGNLDKSPMYC--GIIEGVGPRYCPSIEDKITRFA
MNMG_ALKMQ       ------KKQVPCWLTRTTGETHRVIMENLNRSAMYR--GDMESVGPRYCPSIEDKVVRFS
MNMG_ALKOO       ------KEQIPCWLTRTTEETHRIIKENLGRSAMYR--GDIESTGPRYCPSIEDKIVRFS
MNMG_CLOD6       ------KKQEPCYLTRTTEETQKVILDNLKRSAMYS--GVIESTGPRYCPSIEDKVVRFS
MNMG_FINM2       ------KKQEHCYLTYTTLKTKQIIEDNLERSPMYA--GIVKGVGPRYCPSIEDKIVRFP
MNMG_CALS8       ------IEQVPCYLTYTTEETHRIIRENLHRAPLFT--GLIQGVGPRYCPSIEDKVVRFA
MNMG_ACET2       ------KEQVSCYLTYTNSETHRIIRENLHRSGLFG--GLIEGIGPRYCPSIEDKVVRFS
MNMG1_CALS4      ------IEQMPCWLTYTNEKTHKIIRDNIHRAPLFT--GAITGVGVRYCPSIEDKVVKFP
MNMG2_CALS4      ------IEQIPCWLTYTNEKTHKIIRDNIHRAPLYT--GEVEGVGVRYCPSIEDKVMKFP
MNMG_THEP3       ------IEQLPCWLTYTNKRTHEIIMANIHRSPLFS--GEITGVGVRYCPSIEDKVVKFP
MNMG_THEPX       ------IEQLPCWLTYTNKRTHEIIMANIHRSPLFS--GEITGVGVRYCPSIEDKVVKFP
MNMG_CLOB1       ------KDQISCYLTYTSEETHKIIHENIHRSPLYN--GSIEGVGPRYCPSIEDKIVRFP
MNMG_CLOBH       ------KDQISCYLTYTSEETHKIIHENIHRSPLYN--GSIEGVGPRYCPSIEDKIVRFP
MNMG_CLOBL       ------KDQISCYLTYTSEETHKIIHQNIHRSPLYN--GSIEGVGPRYCPSIEDKIVRFP
MNMG_CLOBK       ------KDQISCYLTYTSEETHKIIHENIHRSPLYN--GSIEGVGPRYCPSIEDKIVRFP
MNMG_CLOBM       ------KDQISCYLTYTSEETHKIIHENIHRSPLYN--GSIEGIGPRYCPSIEDKIVRFP
MNMG_CLONN       ------REQISCYLTYSGDETKKVVLENIDRSPLYN--GSIKSVGPRYCPSFEDKIMRFP
MNMG_CLOAB       ------KEQISCYLTYTNEKTHEVIKENIDRSPLYN--GTIKSVGPRYCPSIEDKVMRFP
MNMG_CLOTE       ------REQVSCYLTYTNENTHEVIRKNLHRSPMFN--GSIEGVGARYCPSIEDKVNRFP
MNMG_CLOK5       ------RKQVSCYLTYTTENTTKVIRENINRSPLFN--GSIKSVGPRYCPSIEDKIVRFP
MNMG_CLOP1       ------RDQVSCWLTYTNEETHKVIQENIHRSPMYN--GSIKGVGPRYCPSIEDKVMRFQ
MNMG_CLOPS       ------RDQVSCWLTYTNEETHKVIQENIHRSPMYN--GSIKGVGPRYCPSIEDKVMRFQ
MNMG_CLOPE       ------RDQVSCWLTYTNEETHKVIQENIHRSPMYN--GSIKGVGPRYCPSIEDKVMRFQ
MNMG_CLOB8       ------REQVSCYLTYTNDETRKIIRDNIGRSPIYN--GSIKGVGPRYCPSIEDKIMRFP
MNMG_LACP7       ------KEQISCWLTYTNENTHDIIRDNIHRSPLYS--GNIKGTGPRYCPSIEDKVVKFP
MNMG_NATTJ       ------LKQLPCYLTFTNYETHKIINDSLSRSPLYS--GRIEGTGPRYCPSIEDKIVRFP
MNMG_BACVZ       ------TDQLPCWLTYTSPETHEIIDSNLHRSPMYS--GMIKGTGPRYCPSIEDKVVRFN
MNMG_BACSU       ------TDQLPCWLTYTSPETHEIIDSNLHRSPMYS--GMIKGTGPRYCPSIEDKVVRFN
MNMG_BACLD       ------TDQLPCWLTYTSPETHEIIDNNLHRSPMYS--GMIKGTGPRYCPSIEDKVVRFN
MNMG_BACP2       ------TDQLPCWLTYTSLETHQIIDENLHRSPMYS--GMIKGTGPRYCPSIEDKVVRFN
MNMG_BACAH       ------MDQIPCWLTYTSTETHRLIDENLHRSAMYS--GMIKGTGPRYCPSIEDKVVRFN
MNMG_BACHK       ------MDQIPCWLTYTSTETHRLIDENLHRSAMYS--GMIKGTGPRYCPSIEDKVVRFN
MNMG_BACAN       ------MDQIPCWLTYTSTETHRLIDENLHRSAMYS--GMIKGTGPRYCPSIEDKVVRFN
MNMG_BACCZ       ------MDQIPCWLTYTSTETHRLIDENLHRSAMYS--GMIKGTGPRYCPSIEDKVVRFN
MNMG_BACC1       ------MDQIPCWLTYTSTETHRLIDENLHRSAMYS--GMIKGTGPRYCPSIEDKVVRFN
MNMG_BACCR       ------MDQIPCWLTYTSTETHRLIDENLHRSAMYS--GMIKGTGPRYCPSIEDKVVRFN
MNMG_BACMK       ------MDQIPCWLTYTSTETHRLIDENLHRSAMYS--GMIKGTGPRYCPSIEDKVVRFN
MNMG_BACCN       ------LDQIPCWLTYTSEETHRLIDKNLHRSAMYS--GMIKGTGPRYCPSIEDKVVRFN
MNMG_GEOKA       ------TDQLPCWLTYTTEETHRIIDENLHLSPMYS--GMIKGTGPRYCPSIEDKVVRFH
MNMG_GEOTN       ------TDQLPCWLTYTTEETHRIIDENLHLSPMYS--GMIKGTGPRYCPSIEDKVVRFH
MNMG_LYSSC       ------MDQLPCWLTYTSPETHEIIEANLHLSPMYS--GMIKGTGPRYCPSIEDKVVRFN
MNMG_STAA2       ------LDQLPCWLTYTNAETHKVIDDNLHLSAMYS--GMIKGTGPRYCPSIEDKFVRFN
MNMG_STAA9       ------LDQLPCWLTYTNAETHKVIDDNLHLSAMYS--GMIKGTGPRYCPSIEDKFVRFN
MNMG_STAAR       ------LDQLPCWLTYTNAETHKVIDDNLHLSAMYS--GMIKGTGPRYCPSIEDKFVRFN
MNMG_STAAS       ------LDQLPCWLTYTNAETHKVIDDNLHLSAMYS--GMIKGTGPRYCPSIEDKFVRFN
MNMG_STAA1       ------LDQLPCWLTYTNAETHKVIDDNLHLSAMYS--GMIKGTGPRYCPSIEDKFVRFN
MNMG_STAAM       ------LDQLPCWLTYTNAETHKVIDDNLHLSAMYS--GMIKGTGPRYCPSIEDKFVRFN
MNMG_STAAW       ------LDQLPCWLTYTNAETHKVIDDNLHLSAMYS--GMIKGTGPRYCPSIEDKFVRFN
MNMG_STAAN       ------LDQLPCWLTYTNAETHKVIDDNLHLSAMYS--GMIKGTGPRYCPSIEDKFVRFN
MNMG_STAAB       ------LDQLPCWLTYTNAETHKVIDDNLHLSAMYS--GMIKGTGPRYCPSIEDKFVRFN
MNMG_STAA8       ------LDQLPCWLTYTNAETHKVIDDNLHLSAMYS--GMIKGTGPRYCPSIEDKFVRFN
MNMG_STAA3       ------LDQLPCWLTYTNAETHKVIDDNLHLSAMYS--GMIKGTGPRYCPSIEDKFVRFN
MNMG_STAAC       ------LDQLPCWLTYTNAETHKVIDDNLHLSAMYS--GMIKGTGPRYCPSIEDKFVRFN
MNMG_STAAE       ------LDQLPCWLTYTNAETHKVIDDNLHLSAMYS--GMIKGTGPRYCPSIEDKFVRFN
MNMG_STAAT       ------LDQLPCWLTYTNAETHKVIDDNLHLSAMYS--GMIKGTGPRYCPSIEDKFVRFN
MNMG_STAES       ------LDQLPCWLTYTNGDTHQVIDDNLHLSAMYS--GMIKGTGPRYCPSIEDKFVRFN
MNMG_STAEQ       ------LDQLPCWLTYTNGDTHQVIDDNLHLSAMYS--GMIKGTGPRYCPSIEDKFVRFN
MNMG_STAHJ       ------LDQLPCWLTYTNDRTHKVIDDNLHLSAMYS--GMIKGTGPRYCPSIEDKFVRFN
MNMG_STAS1       ------LDQLPCWLTYTNGDTHQVIDDNLHLSAMYS--GMIKGTGPRYCPSIEDKFVRFN
MNMG_LISMO       ------LDQLPCWLTYTNETTHEIIQANLHRSPMFT--ATKKGTGARYCPSIEDKIVRFS
MNMG_LISMF       ------LDQLPCWLTYTNETTHEIIQANLHRSPMFT--ATKKGTGARYCPSIEDKIVRFS
MNMG_LISIN       ------LEQLPCWLTYTNETTHEIIQANLHRSPMFT--ATKKGTGARYCPSIEDKIVRFS
MNMG_LISW6       ------LDQLPCWLTYTNETTHEIIQANLHRSPMFT--ATKKGTGARYCPSIEDKIVRFS
MNMG_OCEIH       ------TDQIPCWLTYTNEFTHQVINDNLELSSMYS--GMKRGTGPRYCPSIEDKIVRFN
MNMG_BACSK       ------TDQLPCWLTYTSENTHQIISANLGRSPMYS--GMIEGTGPRYCPSIEDKIVRFS
MNMG_ALKHC       ------TDQLPCWLTYTGDKTHQIINDNLGRSPMYS--GMIEGTGPRYCPSIEDKIVRFN
MNMG_EXIS2       ------TEQIPCWLTYTTEYTHQLIDANLHRSPMFS--GMIKGTGPRYCPSIEDKVVRFS
MNMG_LEVBA       ------KNQLSCWLTYTNEKTHEIIKANLDRAPMFT--GVIEGVGPRYCPSIEDKIVRFA
MNMG_LACPL       ------KHQLSCWLTYTNETTHKIIRENLDRAPMFT--GVIEGVGPRYCPSIEDKIVRFA
MNMG_PEDPA       ------KNQLSCWLTYTNEKTHEIIRENLDRAPMFS--GMIEGVGPRYCPSIEDKIVRFA
MNMG_LACS1       ------KDQLSCWLTYTNEYTHKIIQDNLDRAPMFT--GVIEGVGPRYCPSIEDKIVRFS
MNMG_ENTFA       ------QNQEPCWLTYTNETTHEIIQKNLHRAPMFT--GIVEGVGARYCPSIEDKIVRFA
MNMG_LACSS       ------KDQLSCWMTYTNDTTHQVIRDNLDRAPMFT--GVIEGVGPRYCPSIEDKIVRFA
MNMG_LACP3       ------KDQLSCWMTYTNATTHQIIRDNLDRAPMFS--GVIKGVGPRYCPSIEDKIVRFA
MNMG_LACAC       ------QNQISCWMTYTNPVTHEVIRDNLDRAPMFT--GVIKGVGPRYCPSIEDKVVRFA
MNMG_LACH4       ------KNQISCWMTYTNNGTHEIIRENLNRAPMFS--GIIKGVGPRYCPSIEDKVVRFA
MNMG_LACJO       ------EDQMSCYMTYTNTVTHDIIRANLDRAPMFS--GVIKGVGPRYCPSIEDKVVRFA
MNMG_LACGA       ------KDQMSCYMTYTNTVTHDIIRANLDRAPMFS--GVIKGVGPRYCPSIEDKVVRFA
MNMG_LACDA       ------TDQTSCWMTYTNPKTHEIINENLDRSPMFS--GDIVGVGPRYCPSIETKVVRFA
MNMG_LACDB       ------TDQTSCWMTYTNPKTHEIINENLDRSPMFS--GDIVGVGPRYCPSIETKVVRFA
MNMG_LACLM       ------KDQIPCWLTYTTENSHTILRDNLHRAPLFS--GIVKGVGPRYCPSIEDKITRFA
MNMG_LACLS       ------KDQIPCWLTYTTENSHTILRDNLHRAPLFS--GIVKGVGPRYCPSIEDKITRFA
MNMG_LACLA       ------KDQIPCWLTYTTENSHTILRGNLHRAPLFS--GIVKGVGPRYCPSIEDKITRFA
MNMG_STRA3       ------TDQVPCWLTYTNTLSHDIINQNLHRAPMFS--GIVKGVGPRYCPSIEDKIVRFA
MNMG_STRA5       ------TDQVPCWLTYTNTLSHDIINQNLHRAPMFS--GIVKGVGPRYCPSIEDKIVRFA
MNMG_STRA1       ------TDQVPCWLTYTNTLSHDIINQNLHRAPMFS--GIVKGVGPRYCPSIEDKIVRFA
MNMG_STRP1       ------KDQIPCWLTYTNQTSHDIINQNLYRAPMFS--GIVKGVGPRYCPSIEDKIVRFA
MNMG_STRPD       ------KDQIPCWLTYTNQTSHDIINQNLYRAPMFS--GVVKGVGPRYCPSIEDKIVRFA
MNMG_STRPB       ------KDQIPCWLTYTNQTSHDIINQNLYRAPMFS--GIVKGVGPRYCPSIEDKIVRFA
MNMG_STRPC       ------KDQIPCWLTYTNQTSHDIINQNLYRAPMFS--GIVKGVGPRYCPSIEDKIVRFA
MNMG_STRPG       ------KDQIPCWLTYTNQTSHDIINQNLYRAPMFS--GIVKGVGPRYCPSIEDKIVRFA
MNMG_STRP8       ------KDQIPCWLTYTNQTSHDIINQNLYRAPMFS--GIVKGVGPRYCPSIEDKIVRFA
MNMG_STRPF       ------KDQIPCWLTYTNQTSHDIINQNLYRAPMFS--GIVKGVGPRYCPSIEDKIVRFA
MNMG_STRPM       ------KDQIPCWLTYTNQTSHDIINQNLYRAPMFS--GIVKGVGPRYCPSIEDKIVRFA
MNMG_STRP3       ------KDQIPCWLTYTNQTSHDIINQNLYRAPMFS--GIVKGVGPRYCPSIEDKIVRFA
MNMG_STRP6       ------KDQIPCWLTYTNQTSHDIINQNLYRAPMFS--GIVKGVGPRYCPSIEDKIVRFA
MNMG_STRT2       ------QDQIPCWLTYTNQESHDIINNNLHRAPMFS--GIVKGVGPRYCPSIEDKIVRFA
MNMG_STRT1       ------QDQIPCWLTYTNQESHDIINNNLHRAPMFS--GIVKGVGPRYCPSIEDKIVRFA
MNMG_STRTD       ------QDQIPCWLTYTNQESHDIINNNLHRAPMFS--GIVKGVGPRYCPSIEDKIVRFA
MNMG_STRMU       ------KDQIPCWLTYTNQSSHDIINKNLYRAPMFS--GIVKGVGPRYCPSIEDKIVRFA
MNMG_STRGC       ------KDQVPCWLTYTNAESHEIIQNNLHRAPMFS--GIVKGVGPRYCPSIEDKIVRFA
MNMG_STRSV       ------KDQVPCWLTYTNAESHEIIQNNLHRAPMFS--GIVKGVGPRYCPSIEDKIVRFA
MNMG_STRR6       ------KDQVPCWLTYTNGTSHEIIQNNLHRAPMFT--GVVKGVGPRYCPSIEDKIVRFA
MNMG_STRP2       ------KDQVPCWLTYTNGTSHEIIQNNLHRAPMFT--GVVKGVGPRYCPSIEDKIVRFA
MNMG_STRPN       ------KDQVPCWLTYTNGTSHEIIQNNLHRAPMFT--GVVKGVGPRYCPSIEDKIVRFA
MNMG_STRPI       ------KDQVPCWLTYTNGTSHEIIQNNLHRAPMFT--GVVKGVGPRYCPSIEDKIVRFA
MNMG_STRSY       ------LDQIPCWLTYTNATSHEIINSNLHRAPMFS--GIVKGIGPRYCPSIEDKIVRFA
MNMG_STRS2       ------LDQIPCWLTYTNATSHEIINSNLHRAPMFS--GIVKGIGPRYCPSIEDKIVRFA
MNMG_DESRM       ------REQVPCWLTYTTEKTHEIIRENLHRSPLYS--GIIEGVGPRYCPSIEDKIVRFA
MNMG_PELTS       ------REQLPCWLTYTTEETHRIIRENLHRAPLYT--GVIKSQGPRYCPSIETKVVRFS
MNMG_CARHZ       ------RPNVSCWLTYTNLETHTIILENLHRSPLYS--GEIKGVGPRYCPSIEDKVVRFS
MNMG_MOOTA       ------RPNVSCWLTHTNTTTHNIIKDNLHRAPLFS--GLIEGKGPRYCPSIEDKVVRFA
MNMG_HELMI       ------RKQISCWLTYTTEETHQIIRDNLHRSPLYA--GVIEGTGPRYCPSIEDKVVRFA
MNMG_SYNWW       ------RPQLPCWLTHSNKKTHQIVMNNLDRAPMYT--GIIKGIGTRYCPSFEDKVVRFS
MNMG_DESAP       ------QIQVPCWLTYTTARTHEIIRENLDRSPLYT--GIIQGTGPRYCPSIEDKVVRFA
MNMG_SYMTH       ------REQLPCWLTHTTPASHELIRRNLHRAPMFT--GVIEGRGPRYCPSVEDKVVRFA
MNMG_DESHY       ------DKQIPCWLGYTTPETHQIIQDNIHRAPLYS--GKIEGIGPRYCPSIEDKVVRFA
MNMG_ROSCS       PLRAAWRPQLPCYLVHTTPEFHEIVRRNLDRAPLFS--GIIEGVGPRYCPSIEDKIVRFA
MNMG_ROSS1       PLLDAWRPQLPCYLVHTTPEFHEIVRRNLDRAPLFS--GIIEGVGPRYCPSIEDKIVRFA
MNMG_CHLAA       PQLDGWRPQLPCYQVHTTPEFHAIIRENLHRAPLFS--GIIEGVGPRYCPSIEDKIVRFA
MNMG_DEIRA       GTPGPRAAESPTWQTHTTPQTHALIQENLHESPMYA--GDIEGLGPRYCPSIEDKVVKFA
MNMG_DEIGD       GRPGPRAAESPTWQTHTTPETHRLIQENLHESPMYA--GDIAGLGPRYCPSIEDKVVRFA
MNMG_THET2       GNPGPHAARLPTWQTRTTERTHRLILENLHLSPLYA--GDIQGIGPRYCPSIEDKVVRFA
MNMG_THET8       GNPGPHAARLPTWQTRTTARTHRLIRENLHLSPLYA--GDIQGIGPRYCPSIEDKVVRFA
MNMG_MYXXD       GMPFPRQPSVTCALTETTPRTHAVLRDNLHRSPLYQ--GDIVGRGPRYCPSLEDKVVRFA
                                 :       :      :            .  :***.: *   : 

MNMG_NOSS1       DKESHQIFIEPEGRDIPE----LYIQGFSTGLPENLQLQMLRSLPGLENCVMLRPAYAVE
MNMG_TRIV2       DKESHQIFIEPEGRDIPE----LYIQGFSTGLPENLQLQMLRSLPGLENCVMLRPAYAVE
MNMG_TRIEI       DKHSHQIFIEPEGRDIPE----LYIQGFSTGLPEKLQLQMLQSLPGLENCLMLRPAYAVE
MNMG_SYNY3       DKESHQIFIEPEGRDIPE----LYIQGFSTGLPENVQLAMLQTLPGLENCVMLRPAYAVE
MNMG_SYNP2       DKDSHQIFIEPEGRTIPE----LYIQGFSTGLPESLQLQMLQSLPGMEDCVMLRPAYAVE
MNMG_MICAN       DKESHQIFIEPEGRDIPE----LYIQGFSTGLPENVQLAMLRTLPGLENCVMLRAAYAVE
MNMG_ACAM1       DKASHQIFIEPEGRDIPE----LYIQGFSTGLPEALQLRMLRSLPGLEHCAMLRPAYAVE
MNMG_SYNP6       DKESHQIFIEPEGRDIPE----LYIQGFSTGLPEDLQLALLQTLPGLEDCVMLRPAYAVE
MNMG_SYNE7       DKESHQIFIEPEGRDIPE----LYIQGFSTGLPEDLQLALLQTLPGLEDCVMLRPAYAVE
MNMG_THEEB       DKESHQIFIEPEGRNTPE----LYIQGFSTGLPEPLQLQLLRTLPGLENCIMLRPAYAVE
MNMG_SYNJB       DKESHQIFIEPEGRDLPE----LYIQGFSTGMPEKIQIQMLRSLPGLERCVMLRPAYAVE
MNMG_SYNJA       DKESHQIFIEPEGRDLPE----LYIQGFSTGMPEKIQIQMLRSLPGLERCVMLRPAYAVE
MNMG_PROM1       DKDSHQIFLEPEGRDTPE----MYVQGFSTGLPENLQLELLRTLPGLQNCVMLRPAYAVE
MNMG_PROMT       DKDSHQIFLEPEGRDTPE----MYVQGFSTGLPENLQLELLRTLPGLQNCVMLRPAYAVE
MNMG_PROMA       DKESHQIFLEPEGRNTPE----IYIQGLSTGLPEGMQLQLLRTLPGLKNCVMLRPAYAVE
MNMG_PROM3       DKDSHQIFLEPEGRDTPE----IYVQGFSTGLPERLQLDLLRTLPGLEQCIMLRPAYAVD
MNMG_PROMM       DKDSHQIFLEPEGRDTPE----IYVQGFSTGLPERLQLDLLRTLPGLEQCVMLRPAYAVD
MNMG_SYNSC       DKDSHQIFLEPEGRDTPE----IYVQGFSTGLPEPIQLQLLRSLPGLEQAVMLRPAYSVD
MNMG_SYNPX       DKDSHQIFLEPEGRDTPE----IYVQGFSTGLPEPIQLQLLRSLPGLEQAVMLRPAYSVD
MNMG_SYNS9       DKESHQIFLEPEGRDTPE----IYVQGFSTGLPEPIQLQLLRSLPGLEQAVMLRPAYSVD
MNMG_SYNPW       DKDSHQIFLEPEGRDTPE----IYVQGFSTGLPEPIQLQLLRSLPGLEQAVMLRPAYSVD
MNMG_SYNS3       DKDSHQIFLEPEGRDTPE----IYVQGFSTGLPETIQLELLRTLPGLEQCVMLRPAYSVD
MNMG_SYNR3       DKDSHQIFLEPEGRDTPE----LYIQGFSTGLPERLQLKLLRTLPGLEQCVMLRPAYNVE
MNMG_PROMS       NKESHQIFLEPEGINTPE----IYVQGFSTGLPENIQLELLRTLPGLGECKMLRPAYAVE
MNMG_PROM0       DKESHQIFLEPEGINTPE----IYVQGFSTGLPENIQLELLRTLPGLNECKMLRPAYAVE
MNMG_PROM9       DKESHQIFLEPEGINTPE----IYVQGFSTGLPENIQLELLRTLPGLSECKMLRPAYAVE
MNMG_PROM2       DKKSHQIFLEPEGINTPE----IYVQGFSTGLPENIQLELLRTLPGLSKCKMLRPAYAVE
MNMG_PROM5       DKNSHQIFLEPEGINTPE----IYVQGFSTGLPENIQLELLRTLPGLNKCKMLRPAYAVE
MNMG_PROMP       DKNSHQIFLEPEGINTPE----IYVQGFSTGLPENIQLDLLRTLPGLNKCKMLRPAYAVE
MNMG_CHLTR       DKDRHHIFIEPEGLNTQE----VYVNGLSTSMPFDVQYDIIRSVSGLENAIITRPAYAIE
MNMG_CHLTA       DKDRHHIFIEPEGLNTQE----VYVNGLSTSMPFDVQYDIIRSVSGLENAIITRPAYAIE
MNMG_CHLT2       DKDRHHIFIEPEGLNTQE----VYVNGLSTSMPFDVQYDIIRSVSGLENAIITRPAYAIE
MNMG_CHLTB       DKDRHHIFIEPEGLNTQE----VYVNGLSTSMPFDVQYDIIRSVSGLENAIITRPAYAIE
MNMG_CHLMU       DKDRHHIFIEPEGLNTRE----VYVNGLSTSMPFDVQYEIIRSVAGLENAVITRPAYAIE
MNMG_CHLAB       DKERHHIFIEPEGIHTQE----VYVNGLSTSMPFDVQYDMIRSVLGLENAIITRPAYAIE
MNMG_CHLCV       DKERHHIFIEPEGIYTQE----VYVNGLSTSMPFDVQYNMIRSVHGLENAIITRPAYAIE
MNMG_CHLFF       DKERHHIFIEPEGIYTQE----VYVNGLSTSMPFDVQYEMIRSVRGLENAIITRPAYAIE
MNMG_CHLPN       DKERHHVFLEPEGLHTQE----IYANGLSTSMPFDVQYDMIRSVLGLENAIITRPAYAIE
MNMG_PARUW       DKERHQIFLEPEGLQTQE----VYVNGVSSSLPFDVQLAFIKSIPALRHAEIMRPAYAIE
MNMG_RHOBA       DKSSHQLFLEPEGRQTCE----VYVNGISTSLPRDVQDAMFRCIPGLEKAAIMRYGYAVE
MNMG_OPITP       DKPRHLLFLEPEGRGTDE----FYVNGLSTSLPFDVQLELVHSIPGLGEAVLLRPAYAVE
MNMG_AQUAE       DKERHQIFLEPEGLDTIE----IYPNGLSTSLPEEVQWEMYRSIPGLENVVLIRPAYAIE
MNMG_ECOLI       DRNQHQIFLEPEGLTSNE----IYPNGISTSLPFDVQMQIVRSMQGMENAKIVRPGYAIE
MNMG_ECOL6       DRNQHQIFLEPEGLTSNE----IYPNGISTSLPFDVQMQIVRSMQGMENAKIVRPGYAIE
MNMG_ECO24       DRNQHQIFLEPEGLTSNE----IYPNGISTSLPFDVQMQIVRSMQGMENAKIVRPGYAIE
MNMG_ECODH       DRNQHQIFLEPEGLTSNE----IYPNGISTSLPFDVQMQIVRSMQGMENAKIVRPGYAIE
MNMG_ECOL5       DRNQHQIFLEPEGLTSNE----IYPNGISTSLPFDVQMQIVRSMQGMENAKIVRPGYAIE
MNMG_ECOHS       DRNQHQIFLEPEGLTSNE----IYPNGISTSLPFDVQMQIVRSMQGMENAKIVRPGYAIE
MNMG_ECOLC       DRNQHQIFLEPEGLTSNE----IYPNGISTSLPFDVQMQIVRSMQGMENAKIVRPGYAIE
MNMG_SHIBS       DRNQHQIFLEPEGLTSNE----IYPNGISTSLPFDVQMQIVRSMQGMENAKIVRPGYAIE
MNMG_SHISS       DRNQHQIFLEPEGLTSNE----IYPNGISTSLPFDVQMQIVRSMQGMENAKIVRPGYAIE
MNMG_ECOUT       ERNQHQIFLEPEGLTSNE----IYPNGISTSLPFDVQMQIVRSMQGMENAKIVRPGYAIE
MNMG_ECOK1       ERNQHQIFLEPEGLTSNE----IYPNGISTSLPFDVQMQIVRSMQGMENAKIVRPGYAIE
MNMG_ECOSM       DRNQHQIFLEPEGLTSNE----IYPNGISTSLPFDVQMQIVRSMQGMENAKIVRPGYAIE
MNMG_ECO57       DRNQHQIFLEPEGLTSNE----IYPNGISTSLPFDVQMQIVRSMQGMENAKIVRPGYAIE
MNMG_SHIDS       DRNQHQIFLEPEGLTSNE----IYPNGISTSLPFDVQMQIVRSMQGMENAKIVRPGYAIE
MNMG_SHIFL       DRNQHQIFLEPEGLTSNE----IYPNGISTSLPFDVQMQIVRSMQGMENAKIVRPGYAIE
MNMG_SHIF8       DRNQHQIFLEPEGLTSNE----IYPNGISTSLPFDVQMQIVRSMQGMENAKIVRPGYAIE
MNMG_SALCH       DRNQHQIFLEPEGLTSNE----IYPNGISTSLPFDVQMQIVRSMQGMENAKIVRPGYAIE
MNMG_SALTY       DRNQHQIFLEPEGLTSNE----IYPNGISTSLPFDVQMQIVRSMQGMENAKIVRPGYAIE
MNMG_SALPB       DRNQHQIFLEPEGLTSNE----IYPNGISTSLPFDVQMQIVRSMQGMENAKIVRPGYAIE
MNMG_SALPA       DRNQHQIFLEPEGLTSNE----IYPNGISTSLPFDVQMQIVRSMQGMENAKIVRPGYAIE
MNMG_SALTI       DRNQHQIFLEPEGLTSNE----IYPNGISTSLPFDVQMQIVRSMQGMENAKIVRPGYAIE
MNMG_CITK8       DRNQHQIFLEPEGLTSNE----IYPNGISTSLPFDVQMQIVRSMQGMENAKIVRPGYAIE
MNMG_SALAR       DRNQHQIFLEPEGLTSNE----IYPNGISTSLPFDVQMQIVRSMQGMENAKIVRPGYAIE
MNMG_ENT38       DRNQHQIFLEPEGLTSNE----IYPNGISTSLPFDVQIQIVRSMQGMENAKIVRPGYAIE
MNMG_KLEP7       DRNQHQIFLEPEGLTSNE----IYPNGISTSLPFDVQMQIVRSMQGMENARIVRPGYAIE
MNMG_CROS8       DRNAHQIFLEPEGLTSNE----IYPNGISTSLPFDVQMQIVRSMKGMENAKIVRPGYAIE
MNMG_PECAS       DRNTHQIFLEPEGLTSNE----IYPNGISTSLPFDVQWQIVRSMAGMENARIVRPGYAIE
MNMG_YERPE       DRNSHQIFLEPEGLTSNE----IYPNGISTSLPFDVQMQIVRSMKGLENARIIRPGYAIE
MNMG_YERPY       DRNSHQIFLEPEGLTSNE----IYPNGISTSLPFDVQMQIVRSMKGLENARIIRPGYAIE
MNMG_YERPA       DRNSHQIFLEPEGLTSNE----IYPNGISTSLPFDVQMQIVRSMKGLENARIIRPGYAIE
MNMG_YERPN       DRNSHQIFLEPEGLTSNE----IYPNGISTSLPFDVQMQIVRSMKGLENARIIRPGYAIE
MNMG_YERPP       DRNSHQIFLEPEGLTSNE----IYPNGISTSLPFDVQMQIVRSMKGLENARIIRPGYAIE
MNMG_YERPS       DRNSHQIFLEPEGLTSNE----IYPNGISTSLPFDVQMQIVRSMKGLENARIIRPGYAIE
MNMG_YERP3       DRNSHQIFLEPEGLTSNE----IYPNGISTSLPFDVQMQIVRSMKGLENARIIRPGYAIE
MNMG_YERE8       DRNSHQIFLEPEGLTSNE----IYPNGISTSLPFDVQMQIVRSMKGLENARIVRPGYAIE
MNMG_SERP5       DRNAHQIFLEPEGLTSNE----IYPNGISTSLPFDVQMQIVRSMEGMQNARIIRPGYAIE
MNMG_PHOLL       DRDAHQIFLEPEGLTSNE----IYPNGISTSLPFDVQMQIVHSMKGMENARIIRPGYAIE
MNMG_SODGM       DRDAHQIFLEPEGLTSNE----IYPNGISTSLPFDVQMKIVHSMQGLENARIVRPGYAIE
MNMG_VIBCH       DKDSHQIFIEPEGLTTTE----LYPNGISTSLPFDVQVQIVRSMKGFENAHIVRPGYAIE
MNMG_VIBC3       DKDSHQIFIEPEGLTTTE----LYPNGISTSLPFDVQVQIVRSMKGFENAHIVRPGYAIE
MNMG_VIBCB       DKNSHQIFIEPEGLTTHE----LYPNGISTSLPFDVQVQIVRSMKGFENAHIVRPGYAIE
MNMG_VIBPA       DKNSHQIFIEPEGLTTHE----LYPNGISTSLPFDVQVQIVRSMKGFENAHIVRPGYAIE
MNMG_VIBVU       DKNSHQIFIEPEGLTTHE----LYPNGISTSLPFDVQVQIVRSMKGFENAHIVRPGYAIE
MNMG_VIBVY       DKNSHQIFIEPEGLTTHE----LYPNGISTSLPFDVQVQIVRSMKGFENAHIVRPGYAIE
MNMG_ALIF1       DKDSHQIFIEPEGLSTHE----LYPNGISTSLPFDVQLQIVRSMKGFENAHIVRPGYAIE
MNMG_PHOPR       DKNSHQIFIEPEGLTTHE----LYPNGISTSLPFDVQIQIVRSMDGFENAAIMRPGYAIE
MNMG_AERHH       DKTAHQIFVEPEGLTTHE----LYPNGISTSLPFDVQVQIVRSVRGFENAHITRPGYAIE
MNMG_AERS4       DKTAHQIFVEPEGLTTHE----LYPNGISTSLPFDVQVQIVRSIRGFENAHITRPGYAIE
MNMG_COLP3       DKSSHQIFVEPEGLTTHE----VYPNGISTSLPFDVQMNLVRSIKGFENAFITRPGYAIE
MNMG_PSEA6       DKDSHQIFVEPEGLNSIE----VYPNGISTSLPFDVQFELVRSIKGFENAHIIRPGYAIE
MNMG_IDILO       DKGSHQIFVEPEGLNTFE----IYPNGISTSLPFDVQQRLVQSIKGFENAHITRPGYAIE
MNMG_PSET1       DKDKHQIFVEPEGLTSYE----LYPNGISTSLPFDVQIEIVQSITGFENAHICRPGYAIE
MNMG_SHEB5       DKSSHQIFIEPEGLNTNE----IYPNGISTSLPFDVQLNLVRSIKGMENAEIMRPGYAIE
MNMG_SHEB8       DKSSHQIFIEPEGLNTNE----IYPNGISTSLPFDVQLNLVRSIKGMENAEIMRPGYAIE
MNMG_SHEB9       DKSSHQIFIEPEGLNTSE----IYPNGISTSLPFDVQLNLVRSIKGMENAEIMRPGYAIE
MNMG_SHEPC       DKSSHQIFIEPEGLNTTE----IYPNGISTSLPFDVQLNLVRSIKGMENAEIVRPGYAIE
MNMG_SHESW       DKSSHQIFIEPEGLNTTE----IYPNGISTSLPFDVQLNLVRSIKGMENAEIVRPGYAIE
MNMG_SHESM       DKSSHQIFIEPEGLNTNE----IYPNGISTSLPFDVQLNLVRSIQGMENAEIVRPGYAIE
MNMG_SHESR       DKSSHQIFIEPEGLNTNE----IYPNGISTSLPFDVQLNLVRSIQGMENAEIVRPGYAIE
MNMG_SHESA       DKSSHQIFIEPEGLNTNE----IYPNGISTSLPFDVQLNLVRSIQGMENAEIVRPGYAIE
MNMG_SHEON       DKSSHQIFIEPEGLTTNE----IYPNGISTSLPFDVQLNLVRSIKGMENAEIVRPGYAIE
MNMG_SHEDO       DKTSHQIFIEPEGLSTNE----IYPNGISTSLPFDVQLNLVRSIKGMENAEIIRPGYAIE
MNMG_SHEFN       DKSSHQIFIEPEGLSTNE----IYPNGISTSLPFDVQLNLVRSIKGMENAEIMRPGYAIE
MNMG_SHEHH       DKTSHQIFIEPEGLNTTE----IYPNGISTSLPFDVQLNLVRSIKGMENAEIMRPGYAIE
MNMG_SHEPA       DKTSHQIFIEPEGLNTTE----IYPNGISTSLPFDVQLNLVRSIKGMENAEIMRPGYAIE
MNMG_SHESH       DKSSHQIFIEPEGLNTNE----IYPNGISTSLPFDVQLNLVRSIKGMENAEIIRPGYAIE
MNMG_SHEWM       DKSSHQIFIEPEGLNTNE----IYPNGISTSLPFDVQLNLVRSIKGMENAEIIRPGYAIE
MNMG_SHELP       DKSSHQIFIEPEGLNTNE----IYPNGISTSLPFDVQLNLVRSIQGMENAEIIRPGYAIE
MNMG_SHEAM       DKNSHQIFIEPEGLTTTE----IYPNGISTSLPFDVQIQLVRSIRGMEQAEIVRPGYAIE
MNMG_PSYIN       DKNSHQIFVEPEGLTTNE----IYPNGISTSLPFDVQIDFIRSMKGFENAFVTRPGYAIE
MNMG_ACTP2       DRNSHQIYLEPEGLSTIE----VYPNGISTSLPFDVQMGIVNSMKGLEKTRIIKPGYAIE
MNMG_ACTPJ       DRNSHQIYLEPEGLSTIE----VYPNGISTSLPFDVQMGIVNSMKGLEKTRIIKPGYAIE
MNMG_HAEDU       DRNGHQIYLEPEGLTTIE----VYPNGISTSLPFDVQMAIVNSMKGLENTRIIKAGYAIE
MNMG_HAEIN       DRNSHQIYLEPEGLTSNE----VYPNGISTSLPFDVQMGIVNSMKGLENARIVKPGYAIE
MNMG_HAEIG       DRNSHQIYLEPEGLTSNE----VYPNGISTSLPFDVQMGIVNSMKGLENARIVKPGYAIE
MNMG_HAEIE       DRNSHQIYLEPEGLTSNE----VYPNGISTSLPFDVQMGIVNSMKGLENARIVKPGYAIE
MNMG_HAEI8       DRNSHQIYLEPEGLTSNE----VYPNGISTSLPFDVQMGIVNSMKGLEKARIIKPGYAIE
MNMG_HAES1       DRNSHQIYLEPEGLTSNE----VYPNGISTSLPFDVQMKIVNSMKGLEKARIVKPGYAIE
MNMG_HISS2       DRNSHQIYLEPEGLTSNE----VYPNGISTSLPFDVQMKIVNSMKGLEKARIVKPGYAIE
MNMG_MANSM       DRNSHQIYLEPEGLTSQE----IYPNGISTSLPFDVQMKIVNSMVGLEKTRIVKPGYAIE
MNMG_PASMU       ERNSHQIYLEPEGLTSNE----IYPNGISTSLPFDVQMKIVNSMKGMEKARIIKPGYAIE
MNMG_ACTSZ       DRTSHQIYLEPEGLTSNE----VYPNGISTSLPFDVQMKIVNSMKGLENTRIVKPGYAIE
MNMG_HYDCU       ERNQHQVFIEPEGLTSNE----LYPNGISTSLPFETQMQIVQSMKGLENARIMRPGYAIE
MNMG_ACIAC       DKDSHQIFLEPEGLTTHE----FYPNGISTSLPFDVQYDLVRSMRGLENAHILRPGYAIE
MNMG_ACISJ       DKESHQIFLEPEGLTTHE----FYPNGISTSLPFDIQYDLVRSMHGLENAHILRPGYAIE
MNMG_VEREI       DKDSHQVFLEPEGLGTHE----VYPNGISTSLPFDIQYQLVRSMAGLENAHILRPGYAIE
MNMG_POLNA       GKDSHQIFLEPEGLTTHE----IYPNGISTSLPFDIQYALVRSMAGMENAHILRPGYAIE
MNMG_POLSJ       DKESHQIFLEPEGLTTHE----IYPNGISTSLPFDIQYELVRSMAGMENAHILRPGYAIE
MNMG_RHOFT       DKDSHQIFLEPEGLTTNE----YYPNGISTSLPFDIQYALVRSMAGLENAHILRPGYAIE
MNMG_LEPCP       DKNSHQIFLEPEGLTTNE----YYPNGISTSLPFDIQLAAVRTMLGMENAYILRPGYAIE
MNMG_METPP       DKTSHQIFLEPEGLSTHE----FYPNGISTSLPFDIQLAALRSMSGLEQAHILRPGYAIE
MNMG_BURCA       SKESHQIFLEPEGLTTHE----FYPNGISTSLPFDVQLELVHSMRGLENAHILRPGYAIE
MNMG_BURCH       SKESHQIFLEPEGLTTHE----FYPNGISTSLPFDVQLELVHSMRGLENAHILRPGYAIE
MNMG_BURCC       SKESHQIFLEPEGLTTHE----FYPNGISTSLPFDVQLELVHSMRGLENAHILRPGYAIE
MNMG_BURCM       SKESHQIFLEPEGLTTNE----FYPNGISTSLPFDVQLELVHSMRGLENAHILRPGYAIE
MNMG_BURA4       SKESHQIFLEPEGLTTNE----FYPNGISTSLPFDVQLELVHSMRGLENAHILRPGYAIE
MNMG_BURL3       SKESHQIFLEPEGLTTNE----FYPNGISTSLPFDVQLELVHSMRGLENAHILRPGYAIE
MNMG_BURVG       SKESHQIFLEPEGLTTNE----FYPNGISTSLPFDVQLELVHSMRGLENAHILRPGYAIE
MNMG_BURMA       SKDSHQIFLEPEGLTTNE----FYPNGISTSLPFDVQLALVHSMRGLEQAHILRPGYAIE
MNMG_BURM9       SKDSHQIFLEPEGLTTNE----FYPNGISTSLPFDVQLALVHSMRGLEQAHILRPGYAIE
MNMG_BURP0       SKDSHQIFLEPEGLTTNE----FYPNGISTSLPFDVQLALVHSMRGLEQAHILRPGYAIE
MNMG_BURM7       SKDSHQIFLEPEGLTTNE----FYPNGISTSLPFDVQLALVHSMRGLEQAHILRPGYAIE
MNMG_BURMS       SKDSHQIFLEPEGLTTNE----FYPNGISTSLPFDVQLALVHSMRGLEQAHILRPGYAIE
MNMG_BURP1       SKDSHQIFLEPEGLTTNE----FYPNGISTSLPFDVQLALVHSMRGLEQAHILRPGYAIE
MNMG_BURPS       SKDSHQIFLEPEGLTTNE----FYPNGISTSLPFDVQLALVHSMRGLEQAHILRPGYAIE
MNMG_BURP6       SKDSHQIFLEPEGLTTNE----FYPNGISTSLPFDVQLALVHSMRGLEQAHILRPGYAIE
MNMG_BURTA       SKDSHQIFLEPEGLTTNE----FYPNGISTSLPFDVQLALVHSMRGLEQAHILRPGYAIE
MNMG_PARXL       SKESHQIFLEPEGLTTNE----FYPNGISTSLPFDVQLELVRSMRGLEHAHILRPGYAIE
MNMG_CUPNH       TKESHQIFLEPEGLTTNE----FYPNGISTSLPFDVQLELVHSIRGMENAHILRPGYAIE
MNMG_CUPPJ       SKDSHQIFLEPEGLTTNE----FYPNGISTSLPFDVQLELVHSIRGLENAHILRPGYAIE
MNMG_CUPMC       SKESHQIFLEPEGLTTNE----FYPNGISTSLPFDVQLELVHSIRGLENAHILRPGYAIE
MNMG_RALSO       SKDSHQIFLEPEGLTTNE----FYPNGVSTSLPFDVQLDLIHSMRGLEHAHILRPGYAIE
MNMG_JANMA       GKDSHQIFLEPEGLTTNE----FYPNGISTSLPFDIQLALVQSMRGLEHAHILRPGYAIE
MNMG_HERAR       GKESHQIFLEPEGLTTNE----YYPNGISTSLPFDVQLALVQSMRGLEHAHILRPGYAIE
MNMG_BORBR       DKASHQVFLEPEGLNTHE----IYPNGVSTSLPFDVQYELIHSLPGLENAHILRPGYAIE
MNMG_BORPA       DKASHQVFLEPEGLNTHE----IYPNGVSTSLPFDVQYELIHSLPGLENAHILRPGYAIE
MNMG_BORPE       DKASHQVFLEPEGLNTHE----IYPNGVSTSLPFDVQYELIHSLPGLENAHILRPGYAIE
MNMG_BORPD       DKASHQVFLEPEGLDTHE----VYPNGVSTSLPFDVQWDLIHSLPGLENAHILRPGYAIE
MNMG_BORA1       DKPSHQIFLEPEGLDTHE----VYPNGVSTSLPFDVQYELIHSLPGLEHAHILRPGYAIE
MNMG_AZOSB       DKDSHNIFLEPEGLTTHE----IYPNGISTSLPFDVQLEIVRSIRGLENAHILRPGYAIE
MNMG_AROAE       DKTSHNIFLEPEGLTTNE----IYPNGISTSLPFDVQLAVVRSIRGLENAFILRPGYAIE
MNMG_DECAR       DKNQHNVFLEPEGLTTHE----IYPNGVSTSLPFDIQLALVRSIRGMENCHILRPGYAIE
MNMG_METFK       DKDSHQVFLEPEGLTTNE----IYPNGISTSLPFDIQYQLVRSIKGLENAHILRPGYAIE
MNMG_THIDA       DKASHQIFLEPEGLTTHE----IYPNGISTSLPFDVQHAIVRSIPGLEHAHILRPGYAIE
MNMG_NITMU       AKESHQIFLEPEGLTTHE----VYPNGISTSLPFDMQVKLVRSIKGLENAHITRPGYAIE
MNMG_NEIG1       DKDSHQIFLEPEGLTTHE----YYPNGISTSLPFDIQIALVRSMKGLENAHILRPGYAIE
MNMG_NEIMA       DKDSHQIFLEPEGLTTYE----YYPNGISTSLPFDIQIALVRSMKGLENAHILRPGYAIE
MNMG_NEIMB       DKDSHQIFLEPEGLTTHE----YYPNGISTSLPFDIQIALVRSMKGLENAHILRPGYAIE
MNMG_NEIM0       DKDSHQIFLEPEGLTTHE----YYPNGISTSLPFDIQIALVRSMKGLENAHILRPGYAIE
MNMG_NEIMF       DKDSHQIFLEPEGLTTHE----YYPNGISTSLPFDIQIALVRSMKGLENAHILRPGYAIE
MNMG_CHRVO       DKDSHQVFLEPEGLTTHE----FYPNGISTSLPFDIQLAAVRSIRGMENAHILRPGYAIE
MNMG_POLAQ       SRNSHQIFLEPEGLTTNE----FYPNGISTSLPFDVQWELVRSIRGLESAVIVRPGYAIE
MNMG_ACIBT       DKDSHQVFLEPEGLDTHE----LYPNGISTSLPFDVQFELVRSIRGMENAHILRPGYAIE
MNMG_ACIBY       DKDSHQVFLEPEGLDTHE----LYPNGISTSLPFDVQFELVRSIRGMENAHILRPGYAIE
MNMG_ACIAD       DKDSHQVFLEPEGLDTHE----LYPNGISTSLPFDVQFELVRSIRGMENAHILRPGYAIE
MNMG_PSYA2       DKDSHQIFIEPEGLTTHE----LYPNGISTSLPFDVQLEFIHSMKGLENAHITRPGYAIE
MNMG_PSYCK       DKDSHQIFIEPEGLTTHE----LYPNGISTSLPFDVQLEFIHSMKGLENAHITRPGYAIE
MNMG_PSYWF       DKNSHQIFIEPEGLTTHE----LYPNGISTSLPFDVQLEFIRTMAGLENAHITRPGYAIE
MNMG_PSEAE       DKESHQVFLEPEGLTTHE----LYPNGISTSLPFDVQLQIVRSIRGMENAHIVRPGYAIE
MNMG_PSEAB       DKESHQVFLEPEGLTTHE----LYPNGISTSLPFDVQLQIVRSIRGMENAHIVRPGYAIE
MNMG_PSEA7       DKESHQVFLEPEGLTTHE----LYPNGISTSLPFDVQLQIVRSIRGMENAHIVRPGYAIE
MNMG_PSEPU       DKESHQVFIEPEGLNTHE----LYPNGISTSLPFDVQLELVRSIRGMENAHIVRPGYAIE
MNMG_PSEPK       DKESHQVFIEPEGLNTHE----LYPNGISTSLPFDVQLELVRSIRGMENAHIVRPGYAIE
MNMG_PSEP1       DKESHQVFIEPEGLNTHE----LYPNGISTSLPFDVQLELVRSIRGMENAHIVRPGYAIE
MNMG_PSEPG       DKDSHQVFIEPEGLTTHE----LYPNGISTSLPFDVQLELVRSIRGMENAHIVRPGYAIE
MNMG_PSEPW       DKESHQVFIEPEGLTTHE----LYPNGISTSLPFDVQLELVRSIRGMENAHIVRPGYAIE
MNMG_PSEE4       DKESHQVFIEPEGLTTHE----LYPNGISTSLPFDVQLEIVRSIRGMENAHIVRPGYAIE
MNMG_PSEF5       DKESHQVFIEPEGLTTHE----LYPNGISTSLPFDVQLQIVQSIRGMENAHIVRPGYAIE
MNMG_PSEPF       DKESHQVFIEPEGLTTHE----LYPNGISTSLPFDVQLQIVQSIRGMENAHIVRPGYAIE
MNMG_PSE14       DKESHQVFIEPEGLTTHE----LYPNGISTSLPFDVQLQIVQSIRGMENAHIVRPGYAIE
MNMG_PSEU2       DKESHQVFIEPEGLTTHE----LYPNGISTSLPFDVQLQIVRSIRGMENAHIVRPGYAIE
MNMG_PSESM       DKESHQVFIEPEGLTTHE----LYPNGISTSLPFDVQLQIVRSIRGMENAHIVRPGYAIE
MNMG_PSEMY       DKDSHQVFIEPEGLTTHE----LYPNGISTSLPFDVQLQIVRSIRGMENAHIVRPGYAIE
MNMG_PSEU5       DKDSHQVFLEPEGLTTHE----LYPNGISTSLPFDVQLQIVQSIRGMENAHIVRPGYAIE
MNMG_ALCBS       DKDSHQIFVEPEGLNTHE----LYPNGISTSLPFDVQLQAVRSIRGFENAHITRPGYAIE
MNMG_HAHCH       DKDSHQVFIEPEGLSTHE----LYPNGISTSLPFDVQLQLVHSIQGMENAHITRPGYAIE
MNMG_MARMS       DKNSHQIFIEPEGLTTHE----LYPNGISTSLPFDVQIELVRSMKGMENAHIIRPGYAIE
MNMG_SACD2       DKDSHQIFIEPEGLKTHE----LYPNGISTSLPFDVQMAFVRSIKGFENAHITRPGYAIE
MNMG_CHRSD       DKSSHQIFVEPEGLDTHE----LYPNGISTSLPFDVQFEVVRSIKGFENAHITRPGYAIE
MNMG_MARHV       DKDSHQIFVEPEGLTTNE----LYPNGISTSLPFDIQLKAVRSIPGFENAHILRPGYAIE
MNMG_ALKEH       DKGSHQIFLEPEGLDTHE----VYPNGISTSLPFDVQYELVRSIPGLEQARIVRPGYAIE
MNMG_NITOC       DKASHQIFIEPEGLETFE----IYPNGISTSLPFDVQVALVRSIQGFEQAHITRPGYAIE
MNMG_METCA       ERDSHQIFVEPEGLDSLE----IYPNGISTSLPFDVQLAVVRSIQGFEDARITRPGYAIE
MNMG_XANAC       EKTSHQIFVEPEGLEVAE----IYPNGISTSLPFDVQLALVRSIHGFANAHITRPGYAIE
MNMG_XANC5       EKTSHQIFVEPEGLEVAE----IYPNGISTSLPFDVQLALVRSIHGFANAHITRPGYAIE
MNMG_XANOR       EKTSHQIFVEPEGLDVAE----IYPNGISTSLPFDVQLALVRSIHGFAQAHITRPGYAIE
MNMG_XANOM       EKTSHQIFVEPEGLDVAE----IYPNGISTSLPFDVQLALVRSIHGFAQAHITRPGYAIE
MNMG_XANCP       DKTSHQIFVEPEGLDVTE----IYPNGISTSLPFDVQLALVRSIRGFAQAHITRPGYAIE
MNMG_XANC8       DKTSHQIFVEPEGLDVTE----IYPNGISTSLPFDVQLALVRSIRGFAQAHITRPGYAIE
MNMG_XANCB       DKTSHQIFVEPEGLDVTE----IYPNGISTSLPFDVQLALVRSIRGFAQAHITRPGYAIE
MNMG_XYLFA       EKNSHQIFVEPEGLNVID----IYPNGISTSLPFDVQLELVRSIRGFEQAHITRPGYAIE
MNMG_XYLFT       EKNSHQIFVEPEGLNVID----IYPNGISTSLPFDVQLELVRSIRGFEQAHITRPGYAIE
MNMG_COXBU       DRNSHQLFLEPEGLNTPE----VYPNGVSTSLSFDVQLDFIHSIKGLEKCHITRPGYAIE
MNMG_COXBN       DRNSHQLFLEPEGLNTPE----VYPNGVSTSLSFDVQLDFIHSIKGLEKCHITRPGYAIE
MNMG_COXBR       DRNSHQLFLEPEGLNTPE----VYPNGVSTSLSFDVQLDFIHSIKGLEKCHITRPGYAIE
MNMG_LEGPC       DKTSHQIFVEPEGLTTEE----IYPNGISTSLPFEVQVQFVRTIKGFENAHITRPGYAIE
MNMG_LEGPA       DKTSHQIFVEPEGLTTEE----IYPNGISTSLPFEVQVQFVRTIKGFENAHITRPGYAIE
MNMG_LEGPL       DKTSHQIFVEPEGLTTEE----IYPNGISTSLPFEVQVQFVRTIKGFENAHITRPGYAIE
MNMG_LEGPH       DKTSHQIFVEPEGLTTEE----IYPNGISTSLPFEVQVQFVRTIKGFENAHITRPGYAIE
MNMG_NITEU       ERDAHTIFLEPEGLETSE----IYPNGISTSLPFDVQVELVRSIAGLENAHITRPGYAIE
MNMG_NITEC       DRDSHTVFLEPEGLETSE----IYPNGISTSLSFEVQVELVRSIAGLENAHITRPGYAIE
MNMG_FRATF       DKERHQIFVEPEGLNSIE----LYPNGLSTSLPFEVQCNYIRSIKGFEKAFIMRPGYAIE
MNMG_FRATH       DKERHQIFVEPEGLNSIE----LYPNGLSTSLPFEVQCNYIRSIKGFEKAFIMRPGYAIE
MNMG_FRATO       DKERHQIFVEPEGLNSIE----LYPNGLSTSLPFEVQCNYIRSIKGFEKAFIMRPGYAIE
MNMG_FRATW       DKERHQIFVEPEGLNSIE----LYPNGLSTSLPFEVQCNYIRSIKGFEKAFIMRPGYAIE
MNMG_FRATT       DKERHQIFVEPEGLNSIE----LYPNGLSTSLPFEVQCNYIRSIKGFEKAFIMRPGYAIE
MNMG_FRAT1       DKERHQIFVEPEGLNSIE----LYPNGLSTSLPFEVQCNYIRSIKGFEKAFIMRPGYAIE
MNMG_FRATN       DKERHQIFVEPEGLNSIE----LYPNGLSTSLPFEVQCNYIRSIKGFEKAFIMRPGYAIE
MNMG_FRAP2       EKDRHQIFVEPEGLNSIE----LYPNGLSTSLPFEVQCEYIRSIKGFENAFIMRPGYAIE
MNMG_VESOH       ERDSHQIFVEPEGLSTNE----VYPNGVSTSLSYKVQLDFINSIKGFENAQIIRPGYAIE
MNMG_RUTMC       ERDSHQIFVEPEGLTTNE----VYPNGVSTSLSYEVQLNFIRSIKGFEKAHIIRPGYAIE
MNMG_DICNV       DKTSHQIFLEPESLTTNE----IYPNGISTSLPFEAQLKYVHTIKGLEQAIITRPGYAIE
MNMG_BLOFL       DRDAHQVFLEPEGLTTSE----IYVNGVSTSLPFNIQTEIIHSIFGLENAHIIRPGYAIE
MNMG_BLOPB       DRNAHQIFLEPEGLTTPE----VYLNGISTSLPFCVQMQMIKSIQGLENACIIRPGYAIE
MNMG_BAUCH       HRDSHQIFLEPEGLMSNI----IYPNGISTSLPVDIQLKIVQSIEGLEKASIIQPGYAIE
MNMG_BUCAI       DRKSHQVFLEPEGLSSIK----VYPNGISTSLPIEVQEQIVASIKGLEKSKIIRPGYAIE
MNMG_BUCAP       DRKSHQIFLEPEGLTSIE----IYPNGISTSLPLDVQKEIVSSVKGLEKSKIITPGYAVE
MNMG_BUCBP       DRNAHQIFLEPEGLHDIE----IYPNGISTSLPEDVQVEMIHSIKGLERAQITRPGYAVE
MNMG_WIGBR       KKESHQIFLEPEGLNNYE----IYPNGISTSLPLNLQIKIIRSIKGLESANITRPGYSIE
MNMG_BUCCC       DKISHQIFLEPEGINSEI----IYPNGISTSLPKDIQVDLIQSISGLENAHIVHSGYAVE
MNMG_HALHL       DRDHHQVFLEPEGLDATE----LYPNGVSTGLPFTVQEALIRSMPGLEAARITRPGYAIE
MNMG_RHIME       ERDGHQIFLEPEGLDDDT----VYPNGISTSLPEDVQDAFIRTIPGLEQVKILQPGYAIE
MNMG_SINMW       ERDGHQIFLEPEGLDDDT----VYPNGISTSLPEDVQDAFIRTIPGLEQVTILQPGYAIE
MNMG_RHIEC       ERDGHQVFLEPEGLDDDT----VYPNGISTSLPAEIQAAFIKTIPGLESARILQPGYAIE
MNMG_RHIL3       ERDGHQVFLEPEGLDDDT----VYPNGISTSLPAEVQADFIKTIPGLEAARILQPGYAIE
MNMG_AGRFC       ERDGHQIFLEPEGLDDYT----IYPNGISTSLPAFVQEQFIRTIPGLEQVTILQPGYAIE
MNMG_BARHE       ERDGHQIFLEPEGLNDDT----IYPNGLSTSLPEDVQVSLLKTIEGLENVTILQSGYAIE
MNMG_BARQU       ERDGHQIFLEPEGLNDDT----IYPNGLSTSLPEDVQVALLRTIEGLESVKILQPGYAIE
MNMG_BART1       ERDGHQIFLEPEGLNDDT----VYPNGLSTSLPEDVQISFLKTIEGLENATVLQPGYAIE
MNMG_BARBK       ERDGHQIFLEPEGLEDDV----IYPNGISTSLPEDVQISLLKTIEGLENVNVLQPGYAIE
MNMG_BRUAB       DRDGHQIFLEPEGLDDDT----VYPNGISTSLPEDVQLEILKTIPGLEKAVLLQPGYAIE
MNMG_BRUA2       DRDGHQIFLEPEGLDDDT----VYPNGISTSLPEDVQLEILKTIPGLEKAVLLQPGYAIE
MNMG_BRUC2       DRDGHQIFLEPEGLDDDT----VYPNGISTSLPEDVQLEILKTIPGLEKAVLLQPGYAIE
MNMG_BRUSU       DRDGHQIFLEPEGLDDDT----VYPNGISTSLPEDVQLEILKTIPGLEKAVLLQPGYAIE
MNMG_BRUSI       DRDGHQIFLEPEGLDDDT----VYPNGISTSLPEDVQLEILKTIPGLEKAVLLQPGYAIE
MNMG_BRUME       NRDGHQIFLEPEGLDDDT----VYPNGISTSLPEDVQLEILKTIPGLEKAVLLQPGYAIE
MNMG_BRUO2       DRDGHQIFLEPEGLDDDT----VYPNGISTSLPEDVQLEILKTIPGLEKAVLLQPGYAIE
MNMG_BRUA4       DRDGHQIFLEPEGLDDDT----VYPNGISTSLPEDVQLDILKTIPGLETAAMLQPGYAIE
MNMG_RHILO       DRDGHQIFLEPEGLDDDT----VYPNGISTSLPQDVQLEILKTIPGLERATMLQPGYAIE
MNMG_CHESB       ERDGHQIFLEPEGLDDHT----VYPNGLSTSLPEEVQHAFLKTIPGLANAHVLQPGYAIE
MNMG_BRASB       DRDGHQIFLEPEGLDDTT----VYPNGISTSLPEEVQLALLPTIPGLERVRMIRPGYAIE
MNMG_BRASO       DRDGHQIFLEPEGLDDST----VYPNGISTSLPEEVQLALLPTIPGLERVRMIRPGYAIE
MNMG_BRADU       DRDGHQIFLEPEGLDDST----VYPNGISTSLPEEVQLAILASIPGLERVKMVRPGYAIE
MNMG_NITHX       DRDGHQIFLEPEGLDDTT----VYPNGISTSLPEEVQLAILATIPGLTKVRMIRPGYAIE
MNMG_NITWN       DRDGHQVFLEPEGLDDAT----VYPNGISTSLPEEVQLAILATIPGLENVKMTRPGYAIE
MNMG_RHOPS       DRDGHQIFLEPEGLDDPT----VYPNGISTSLPEEVQRAILKTIPGLERTELVRPGYAIE
MNMG_RHOP2       DRDGHQIFLEPEGLDDPT----VYPNGISTSLPEEVQRAILATIPGLERTVMLRPGYAIE
MNMG_RHOPA       DRDGHQIFLEPEGLDDPT----VYPNGISTSLPEEVQRAILKTIPGLERTEMLRPGYAIE
MNMG_RHOP5       DRDGHQIFLEPEGLDDAT----VYPNGISTSLPEEVQRGILATIPGLERCNMLRPGYAIE
MNMG_RHOPB       DRDGHQIFLEPEGLDDPT----VYPNGISTSLPEEVQRAILATIPGLQRTTMLRPGYAIE
MNMG_AZOC5       DRDGHQIFLEPEGLDDPT----VYPNGISTSLPEDVQLAVLATIPGLERVVMSRPGYAIE
MNMG_METPB       DREGHQIFLEPEGLDDPT----VYPNGISTALPEVVQAGIIAAIPGLERTRILRPGYAIE
MNMG_METRJ       DREGHQIFLEPEGLDDPT----IYPNGISTALPEAVQRDLVRLIPGLERVEILRPGYAIE
MNMG_METS4       DRDGHQIFLEPEGLDDPT----IYPNGISTALPEEVQRAVLRLIPGCERAAMLRPGYAIE
MNMG_BEII9       DREAHQIFLEPEGLDVPT----IYPNGISTALPESVQERFLRTIPGLEHVAILQHGYAIE
MNMG_PARL1       ERDSHQIFLEPEGLDDDT----IYPNGISTALPEEVQLAFLKTIPGLENVVMRRAGYAIE
MNMG_RHORT       DRDRHQIFLEPEGLDDPT----VYPNGISTSLPIDVQLALLATIPGLEKAEMMRPGYAIE
MNMG_MAGSA       DRERHQIFLEPEGLDDHT----VYPNGISTSLPEDVQLAMIATIPGLEQCRVIRPGYAIE
MNMG_CAUVC       DKTSHQIFLEPEGLDDDT----VYPNGISTSVSEETQLLFLRTIPGLEQVEVIRYGYAIE
MNMG_CAUSK       DKTSHQVFLEPEGLDDDT----VYPNGVSTSVSAETQLLFLRTMPGLENVEVIRYGYAIE
MNMG_MARMM       DRSQHQIFLEPEGLDDDT----VYPNGISTSLPDDVQQAFLETIPGLEQVVVKRYGYAIE
MNMG_HYPNA       DRDRHQVFLEPEGLDDHT----VYPNGISTSLPEEVQEKFIRTIPGLEDAVILQHAYAIE
MNMG_GLUOX       ERTSHQVFLEPEALPGNPGGDLVYPNGISTSLPADVQAAMIATMPGLENARIVTAGYAVE
MNMG_GLUDA       ERDSHQIFLEPEALPGNAGGDLVYPNGISTSLPADIQEQLIHSIPGLERCRIVRPGYAVE
MNMG_GRABC       DKTRHQVFLEPEGLDDFT----VYPNGISTSLPAEVQEALLHSMPGLHNAVIIRPGYAVE
MNMG_ACICJ       ERPRHQVFLEPEGLEDET----VYPNGISTSLPEEVQEAFIRTMPGLSRAVLLRPGYAVE
MNMG_RUEPO       DKDSHQIFLEPEGLEDHT----VYPNGISTSLPVDVQEDYVRSIRGLEQVEILQPGYAIE
MNMG_RUEST       DKTSHQIFLEPEGVNDHT----VYPNGISTSLPEDVQVDYVRSIVGLENAEVLQPGYAIE
MNMG_ROSDO       DKESHQIFLEPEGLNTDA----VYPNGISTSLPQDVQSEYVHSIVGLEKAIILQPGYAIE
MNMG_DINSH       DKTSHQIFLEPEGLDSTT----IYPNGISTSLPEDVQEAYVRSISGLENAKITQPGYAIE
MNMG_RHOS1       DKEEHQVFLEPEGLDDDT----VYPNGISTSLPAEVQEAYVRTIAGLEDVRILQPGYAIE
MNMG_CERS4       DKEAHQVFLEPEGLDDDT----VYPNGISTSLPAEVQEAYVRTIAGLEDVRILQPGYAIE
MNMG_CERS5       DKTGHQVFLEPEGLDDHT----VYPNGISTSLPAEVQESYVRTIAGLEEVKILQPGYAIE
MNMG_PARDP       DKESHQIFLEPEGLDSDL----VYPNGISTSLPEDIQLAYVRSIRGLERAQIAQPGYAVE
MNMG_JANSC       DKVSHQIFLEPEGLTSET----VYPNGISTSLPIDVQLDYVHSIKGLEHADILQPGYAIE
MNMG_NOVAD       DRDGHQVFLEPEGLDDFT----VYPNGVSTSLPTDVQVAMIRSMEGLEQAVITVPGYAVE
MNMG_ERYLH       DRDGHQVFLEPEGLDTHL----VYPNGISTSLPVDVQLGMLRAMDGLFHVELVEPGYAVE
MNMG_SPHAL       DRDGHQVFLEPEGLDTHL----VYPNGISTSLPADVQLAMLRTIEGLEAVEMVVPGYAVE
MNMG_SPHWW       DRDGHQIFLEPEGLDDPT----VYPNGVSTSLPEDVQLAMLRTVPGLERVEILQPGYAVE
MNMG_ZYMMO       DRDGHQIFLEPEGLDTPL----IYPNGISTSLPEDVQQAFINSIEGLENTKIVQFGYAVE
MNMG_ANAMM       EHKSHQVFLEPEGLDSNS----VYPNGVSTSCPIDVQLEMLRSIRGLENVRMLRHGYTVE
MNMG_ANAPZ       DHKSHQIFLEPEGLETNS----VYPNGISTSCPIEVQLEMLRSINGLEQAVMLRHGYTVE
MNMG_EHRCJ       DRNSHQVFLEPEGLNSDI----IYPNGITTSSPLDVQYEMLKTIPGLEKVNIVRSGYSVE
MNMG_EHRCR       ERNSHQVFLEPEGLDSNI----IYPNGITTSSPLDVQYEMLKTIPGLEKVNIIRSGYSVE
MNMG_EHRRG       ERNSHQVFLEPEGLNSEI----IYPNGITTSSPLDVQQTMLKTILGLENVKIVRSGYSVE
MNMG_EHRRW       ERNSHQVFLEPEGLNSEI----IYPNGITTSSPLDVQQTMLKTISGLENVKIVRSGYSVE
MNMG_WOLPM       EKSSHQIFLEPEGLDDDT----VYPNGISNSLPIEVQREMIKSIKGLENAEILRPGYAVE
MNMG_WOLTR       EKNSHQIFLEPEGLDNIT----VYPNGISNSLPIEVQREMINSIKGLENAEILRPGYAVE
MNMG_NEOSM       EKDSHQIFLEPEGLDSEL----VYPNGISNSLPKEIQEEFIRSIAGLEKASVARYAYTIE
MNMG_RICRO       TKSEHRIFLEPEGLDDYT----IYPNGISTSLPEDVQHKLIKTIPGLENVKVLRPGYAIE
MNMG_RICRS       TKSEHRIFLEPEGLDDYT----IYPNGISTSLPEDVQHKLIKTIPGLENVKVLRPGYAIE
MNMG_RICCN       TKSEHRIFLEPEGLDDYT----IYPNGISTSLPEDVQHKLIKTIPGLENVKVLRPGYAIE
MNMG_RICM5       TKSEHRIFLEPEGLDDYT----IYPNGISTSLPEDVQHKLIKTIPGLENVKVLRPGYAIE
MNMG_RICFE       TKSEHRIFLEPEGLDDYT----IYPNGISTSLPEDVQHKLIKTIPGLENVKVLRPGYAIE
MNMG_RICAH       TKSEHRIFLEPEGLDDYT----IYPNGISTSLPEDVQHKLIKTIPGLENVKVLRLGYAIE
MNMG_RICCK       TKSEHRIFLEPEGLDDYT----IYPNGISTSLPEEVQCKLIKTIPGLEKATILRPGYAIE
MNMG_RICB8       TKSEHRIFLEPEGVDDHT----IYPNGISTSLPEEVQHQLIKTIPGLENAIILRPGYAIE
MNMG_RICBR       TKSEHRIFLEPEGVDDHT----IYPNGISTSLPEEVQHQLIKTIPGLENAIILRPGYAIE
MNMG_RICPR       TKLEHRIFLEPEGLEDYT----IYPNGISTSLPEEVQYKLIKTIPGLENAQVLRPGYAIE
MNMG_RICTY       TKLEHRIFLEPEGLEDYT----IYPNGISTSLPKEIQYKLIKTIPGLENAQVLRPGYAIE
MNMG_ORITB       HNASHQIFLEPEGLNSNT----IYPNGISTSLPSDVQENMIRTIEGLENCKIIAYGYAIE
MNMG_PELUB       DKDRHQIYLEPEGLNDHT----IYPNGISTSLPEDVQQEICNNISGLENVKIIRPGYAIE
MNMG_KORVE       DKETHQIFLEPEGLNTYE----VYVNGMSTSLPIDVQLRMVHSIVGLENAEMLRPGYAIE
MNMG_SOLUE       DKVRHQIFLEPEGLDTHE----VYVNGMSTSMPTDVQVAMVASIPGLEQAEMIRPGYAIE
MNMG_MAGMM       EREVHQVFLEPEGENTNE----MYVNGVSTSMPIDVQWQMIRSIVGLENAQIVKPGYAIE
MNMG_CAMJE       DKESHHLFIEPQTIDATE----YYINGFSTSLPYEVQTQMLRSVEGFENAKITRFGYAIE
MNMG_CAMJJ       DKESHHLFIEPQTIDATE----YYINGFSTSLPYEVQTQMLRSVEGFENAKITRFGYAIE
MNMG_CAMJR       DKESHHLFIEPQTIDATE----YYINGFSTSLPYEVQTQMLRSVKGFENAKITRFGYAIE
MNMG_CAMJ8       DKESHHLFIEPQTIDATE----YYINGFSTSLPYEVQIQMLRSVKGFEDAKITRFGYAIE
MNMG_CAMJD       DKESHHLFIEPQTIDATE----YYINGFSTSLPYEVQTQMLHSVKGFENAKITRFGYAIE
MNMG_CAMC1       DRDRHHLFIEPQTLEATE----YYINGFSTSLPYEVQVQMLRSVKGFENAKIVRHGYAIE
MNMG_CAMC5       DRDRHHLFIEPQTREASE----YYINGFSTSLPYDVQVAMLRSVRGFENARIVRHGYAIE
MNMG_CAMFF       DRERHHLFIEPQTREATE----YYINGFSTSLPYDAQVEMLRSVKGFQNAKIVRHGYAIE
MNMG_CAMHC       DRDRHHVFVEPQTAEASE----YYLNGLSTSLPYDVQVEFLHSVKGFENAKIVRHGYAIE
MNMG_NITSB       DKERHHIFVEPQTLEATE----YYINGMSTSLPPDVQLEMIRSVKGLEHAEVVRYGYAIE
MNMG_SULDN       DKERHHLFIEPQTLENTE----CYINGMSTSLPPDVQQLMINSVKGMENAKIVRYGYAIE
MNMG_ARCB4       ERDRHQLFLEPQTAMCTE----YYINGMSSSLPIDVQKAMIHSVKGLENAKIIRYGYAIE
MNMG_SULNB       DRPRHQIFVEPQTIDETE----YYINGMSTSLPIDVQLEMVRSVEGMKNAKIVRYGYAIE
MNMG_HELPY       EKERHQLFLEPQTIHKSE----YYINGLSTSLPLDVQEKVIHSIKGLENALITRYGYAIE
MNMG_HELPH       EKERHQLFLEPQTIHKSE----YYINGLSTSLPLDVQEKVIHSIKGLENALITRYGYAIE
MNMG_HELPJ       EKERHQLFLEPQTIHKSE----YYINGLSTSLPLDVQEKVIHSIKGLENALITRYGYAIE
MNMG_HELAH       EKERHQLFLEPQTIHKSE----YYINGLSTSLPLDVQEETIHSIKGLENALITRYGYAIE
MNMG_HELHP       DKSRHQLFLEPQTQEAVE----YYINGLSTSLPIDVQEAVIHSIKGLENAHITRYGYAIE
MNMG_WOLSU       ERERHQIFVEPQTLEATE----YYLNGLTTSMPFDVQEAMIRSMAGLQNARIVRYGYAIE
MNMG_LEPIN       DRERHQVFLEPEGYETSE----IYLNGVSTSLPEEVQWKLVRSLKGLENAEIVRPGYAIE
MNMG_LEPIC       DRERHQVFLEPEGYETSE----IYLNGVSTSLPEEVQWKLVRSLKGLENAEIVRPGYAIE
MNMG_LEPBJ       DRERHQVFLEPEGYETTE----IYLNGVSTSLPEEVQWKLVRSLKGLENAEIVRPGYAIE
MNMG_LEPBL       DRERHQVFLEPEGYETTE----IYLNGVSTSLPEEVQWKLVRSLKGLENAEIVRPGYAIE
MNMG_LEPBA       ERDRHQIFIEPEGYETNE----MYLNGVSTSLPEEVQWKFLRSIKGLEQVELMRPGYAIE
MNMG_LEPBP       ERDRHQIFIEPEGYETNE----MYLNGVSTSLPEEVQWKFLRSIKGLEQVELMRPGYAIE
MNMG_GEOMG       EKDRHQTFLEPEGRDTVE----YYPSGLSTSLPIDIQWAFYRSIEGLERVEIMRPAYAIE
MNMG_GEOSL       DKDRHQSFLEPEGRDTVE----YYPSGLSTSLPIDIQYRLYRSIEGLENVEIMRPAYAIE
MNMG_GEOUR       EKDRHQTFIEPEGVDTVE----VYPSGLSTSLPIDVQWAFYRSIYGLERVEIMRPAYAIE
MNMG_PELPD       DKDRHQAFIEPEGLDTVE----MYPSGMSTSLPIDIQIAFYRSMEGLERVEIMRPAYGIE
MNMG_PELCD       DKDSHHVFLEPEGLGTRE----VYPNGVSTSLPPDVQLAFLRTIPGLEHVEIMRPGYAIE
MNMG_DESPS       EKDRHQVFLEPEGLDTVE----VYPNGLPTSLPLEVQIEMLQSIKGLENARIIRPGYAIE
MNMG_DESVH       EKERHQVFVEPEGLESPE----CYPNGIPTSLPLEVQKAMIATIPGLENAQIVRPGYAIE
MNMG_DESVV       EKERHQVFVEPEGLESPE----CYPNGIPTSLPLEVQKAMIATIPGLENAQIVRPGYAIE
MNMG_DESAG       DKDRHQIFIEPEGLHSPE----VYPGGIPTSLPLDVQKAMIATIPGLEKAQIVRPGYAIE
MNMG_LAWIP       DRDRHQIFVEPEGLTSQE----CYINGISTSLPLDIQLALIATIPGLENAHMVRPGYAIE
MNMG_SYNFM       DKDFHQIILEPEGLDTEE----VYASGTGNSLPYDIQLRLIHSVPGLEEAEVMRPAYAIE
MNMG_SYNAS       DKGRHPVVLEFEGLETEE----VYAKGLGNSLPLDLQEQIVHSVPGLENSEILRSAYAIE
MNMG_CHLTE       DKSSHHIFLEPEGTDTVE----MYVNGFSTSLPEDIQIAGLRSIPGLEEAKMIRPGYAIE
MNMG_CHLCH       DKNSHHIFLEPEGIDTNE----MYVNGFSTSLPEDIQLEGLHSIPGLEQVKMIRPGYAIE
MNMG_CHLPM       ERDSHHIFLEPEGFHTNE----MYVNGFSTSLPEDIQIAGLQSIPGMEEVKMIRPGYAIE
MNMG_CHLL3       DRPGHHIFLEPEGFETNE----MYVNGFSTSLPEDIQIDGLRSMKGLEEVKLIRAGYAIE
MNMG_CHLPD       DKNSHHIFLEPEGAETNE----MYVNGFSTSLPEDIQLLALRSIPGLEHVKMIRPGYAIE
MNMG_BACFR       DKEQHQLFLEPEGETTQE----LYLNGFSSSLPMEIQIEALKKIPAFKDLVIYRPGYAIE
MNMG_BACFN       DKEQHQLFLEPEGETTQE----LYLNGFSSSLPMEIQIEALKKIPAFKDLVIYRPGYAIE
MNMG_BACTN       DKEQHQLFLEPEGETTQE----LYLNGFSSSLPMDIQIAALKKVPAFKDIVIYRPGYAIE
MNMG_PHOV8       DKPQHQLFLEPEGETTQE----LYLNGFSSSLPMDIQLAALKKVPAFKDLVVYRPGYAIE
MNMG_PARD8       DKTQHQLFLEPEGEATQE----YYLNGFSSSLPLDIQLRALQAIPAFRDVQIYRPGYAIE
MNMG_PORGI       DKEMHQLFLEPEGETSNE----FYLNGFSSSLPLEIQLEALKAIPALRHVHIYRPGYAIE
MNMG_FLAJ1       DKERHQLFVEPEGWNTCE----VYVNGFSTSLPEDIQFKALRSVAGFENVKFFRPGYAIE
MNMG_FLAPJ       DKDRHQLFVEPEGWNTCE----VYVNGFSTSLPEDIQFKALRSVVGFEKVKFFRAGYAIE
MNMG_GRAFK       DKDRHQLFVEPEGWNTVE----VYVNGFSTSLPEDVQFKALRSVAGFENVKFFRPGYAIE
MNMG_CYTH3       EKERHQIFVEPEGWNTVE----VYVNGFSTSLPEDVQYKAIRKIAGFENAKMFRPGYAIE
MNMG_SULMW       NKENHQIFVEPEGVNTIE----VYINGFSTSMPEEVQYKALLTIPGFEHAKMVRPGYAIE
MNMG_SALRD       EKDHHQLFIEPEGRDTHE----VYVNGFSSSLPEEVQFEALRTVPGMEEAHMHRPGYAIE
MNMG_BORAP       DKDRHQIFIEPEGFNTEE----MYLNGLSSSLPENVQQKLINSIEGLEHAVITRPGYAVE
MNMG_BORBP       DKDRHQIFIEPEGFNTEE----MYLNGLSSSLPENIQQKFINSIEGLEHAIITRPGYAVE
MNMG_BORBU       DKDRHQIFIEPEGFNTEE----MYLNGLSSSLPENIQQKLINSIEGLEHAVITRPGYAVE
MNMG_TREDE       ERDRHHVYIEPEGLNTEE----LYINGLSSSLPEDVQDRMIRTIPCFKDVIITRPAYAVD
MNMG_TREPA       DRIRHQLYIEPEGLDTEE----LYINGLSSCLPEDIQDEMIRTIPGMERAVITRPAYAVD
MNMG1_FUSNN      DKEKHQIFLEMESENSDE----IYVNGLTTAMPAFVQEKILKTIKGLENAKIMRYGYAVE
MNMG2_FUSNN      DKNQHHLFLEREGYETNE----IYLGGLSSSLPVDVQEEMLKNIKGFENAKIMRYAYAIE
MNMG_ENDTX       EKTSHHVFVEPEGYNTNE----VYLNGLYTGLPFNLQQQMINSIVGLENAKVIRYGYAIE
MNMG_ONYPE       DKNSHQIFIEPESLSLDE----MYLQGLSTSMPQHVQHEILKTIPGLQNAQITKYAYAIE
MNMG_AYWBP       DKNSHQIFIEPESLYLNE----MYLQGLSTSMPQHVQHEILKTIPGLQNAKITKYAYAIE
MNMG_ACHLI       DKDRHQIFIEPESMDLNE----MYIQGLSTSMPKHIQEQMVRSLPGMENARIVRYAYAIE
MNMG_MYCCT       EKDTHQIFIEPETLNGDT----WYVQGFSTSMPIEVQELMLKSLPGFENVRVKHWAYAIE
MNMG_MYCMS       EKDTHQIFIEPETLNGDT----WYVQGFSTSMPIEVQEMMLKSLPGFENVRVKHWAYAIE
MNMG_MESFL       SKETHQIFIEPESISGDA----WYIQGFSTSMPTDVQLLMIRSLPGFEKAEVKTWAYAIE
MNMG_MYCGE       QKPRHQIFVEPESLSLDT----IYLAGLSTSFTPEIQKEIIQLLPGFQNAEIKKFGYAIE
MNMG_MYCPN       DKERHQIFVEPESLSLET----VYLAGFSTSFPPEVQEHIVRLLPGFKNARFQKYGYAIE
MNMG_MYCGA       NKPRHQIFLEPESLELDT----VYLGGFSTSLDISVQDKIIRLLPGLKKAEVIKYGYAIE
MNMG_UREPA       EKPRHQIFVEPESYELDS----MYLGGFSTSMPIDVQEKMIRSLPGLENCEILKYAYAIE
MNMG_UREP2       EKPRHQIFVEPESYELDS----MYLGGFSTSMPIDVQEKMIRSLPGLENCEILKYAYAIE
MNMG_MYCPE       DKERHQLFVEPESKHLDT----IYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIE
MNMG_MYCH7       EKPRHQIFFEPETKKQDI----MYINGLSTSMPEDVQLEMVKTIPGLENAKIAKFGYAIE
MNMG_MYCHJ       EKPRHQIFFEPETKKQDI----MYINGLSTSMPEDVQLEMVKTIPGLENAKIAKFGYAIE
MNMG_MYCH2       EKPRHQIFFEPETKKQDI----MYINGLSTSMPEDVQLEMVKTIPGLENAKIAKFGYAIE
MNMG_MYCPU       DKERHQIFFEPETSRQDI----MYINGLSTSFPVEVQKQIVKTIPGLENARVKIWGYAIE
MNMG_MYCS5       DRNRHQVFFEPETLDETI----IYLNGLSTSMPEDIQMQFLKTIPGLENLKIQKYGYAIE
MNMG_MYCMO       DKERHQIFFEPETIKADI----MYINGLSTSMPIDVQDQMIKSINGLKNAKVAKYAYAIE
MNMG_MYCAP       DKERHQIFFEPETADGAI----THVNGLSTSMPIDVQELMIKSIPGLRNAKVQKWAYAIE
MNMG_THEM4       -RDSHQVFVEPEGKNSQE----YYLNGLSTSLPYAAQIKMLRTIPGLENVVIVRPAYAIE
MNMG_FERNB       -RESHQIFVEPEGKDTQE----YYLNGLSTSLPYAAQIKMLRTIPGLENVKIVRPAYAVE
MNMG_THEMA       DKESHQVFVEPEGRDTEE----YYLNGLSTSLPYEAQIKMIRSVKGLENAIVTRPAYAIE
MNMG_THESQ       DKESHQVFVEPEGRDTEE----YYLNGLSTSLPYEAQIKMIRSVKGLENAIVTRPAYAIE
MNMG_THEP1       DKESHQVFVEPEGRDTEE----YYLNGLSTSLPYEAQIKMIRSVKGLENAIITRPAYAIE
MNMG_PETMO       -KDTHQFFLEPESKHSKE----IYLNGLSTSLPFEAQIEILKTIPGLENAIIERPAYAVE
MNMG_BDEBA       ERTSHQTFLEPEGLSTDL----IYLQGISTSLPEDVQDRFLKTIPGLENVKVARYGYAVE
MNMG_ALKMQ       DKPSHQIFIEPEGLDTKE----MYVQGMSTSLPEEVQDAMLKTVIGLESAVIMRPAYAIE
MNMG_ALKOO       EKPSHQIFIEPEGAETKE----MYIQGFSTSLPEEVQVQMVRSVIGLENAIIMRPAYAIE
MNMG_CLOD6       DKTSHQLFIEPEGLNTKE----MYIQGISTSLPFEVQLDMYKTIKGLENCKIMRPAYAIE
MNMG_FINM2       DRDEHQVFVEPEGLSTKE----MYIQGVSSTLPEEVQKEMYKTIIGFENVRFMRSAYGIE
MNMG_CALS8       DKPRHQVFIEPMGRDTEE----MYVQGMSSSLPEDVQIKMYRSVIGLENVQIMRPAYAIE
MNMG_ACET2       DKESHQVFVEPMGLNTQE----MYLQGMSTSLPEDVQIEMLRTIPGLENVSIMRNAYAIE
MNMG1_CALS4      HRERHQIFIEPEGRDTYE----MYVQGMSSSLPEDVQLEFLRTVPGLENVRVMRPAYAIE
MNMG2_CALS4      HRDRHQIFVEPEGRDTYE----MYIQGLFSSFPEDLQMEILSTIPGLENAKIMRPAYAIE
MNMG_THEP3       HKERHQIFIEPEGLNTYE----MYVQGMSSSLPEDVQLEFLRTVPGLENVRVMRPAYAIE
MNMG_THEPX       HKERHQIFIEPEGLNTYE----MYVQGMSSSLPEDVQLEFLRTVPGLENVRVMRPAYAIE
MNMG_CLOB1       DKDKHQIFIEPEGENTEE----LYVGGMSSSLPEDVQIKMYRSVPGLENAEILRTAYAIE
MNMG_CLOBH       DKDKHQIFIEPEGENTEE----LYVGGMSSSLPEDVQIKMYRSVPGLENAEILRTAYAIE
MNMG_CLOBL       DKDKHQIFIEPEGENTEE----LYVGGMSSSLPEDVQIKMYRSVPGLENAEILRTAYAIE
MNMG_CLOBK       DKDKHQIFIEPEGENTEE----LYVGGMSSSLPEDVQIKMYRSVPGLENAEILRTAYAIE
MNMG_CLOBM       DKDKHQIFIEPEGENTEE----LYVGGMSSSLPEDVQIKMYRSVPGLENAEILRTAYAIE
MNMG_CLONN       EKDKHQIFIEPEGENTEE----MYVGGMSSSLPEDVQLKMLRSVPGLENAEMMRTAYAIE
MNMG_CLOAB       DKQQHQIFIEPEGENTND----LYVGGMSSSLPEEVQIKMLKTVPGLEDVEILKTAYAIE
MNMG_CLOTE       DKNKHQVFIEPEGEYTNE----MYVSGLSSSLPEEIQVAMYRTVPGLENVEFLRTAYAIE
MNMG_CLOK5       NKENHQIFIEPEGEDTNE----LYVDGASTSMPEDVQIAMYRTIIGLENVEFLRTGYAIE
MNMG_CLOP1       DKDRHQIFIEPEGDDTEE----MYVGGMSSSLPEDVQVQMIKTVPGLENAEIMRTAYAIE
MNMG_CLOPS       DKDRHQIFIEPEGDDTEE----MYVGGMSSSLPEDVQVQMIKTVPGLENAEIMRTAYAIE
MNMG_CLOPE       DKDRHQIFIEPEGDDTEE----MYVGGMSSSLPEDVQVQMIKTVPGLENAEIMRTAYAIE
MNMG_CLOB8       DKPQHQIFIEPEGLDTLE----MYVGGFSSSLPEEVQIKMLKTLPGLENVEMMRTAYAIE
MNMG_LACP7       DKDRHQVFIEPEGNYTNE----MYISGMSSSLPEDVQFKMYRSVSGLENAKIVRNAYAIE
MNMG_NATTJ       DKSRHQLFLEPEGLNTQE----YYVQGMSTSLPLDVQERMLRTIPGLEEVEIMRPGYAIE
MNMG_BACVZ       DKPRHQIFLEPEGRNTQE----VYVQGLSTSLPEDVQQRMLATIPGLEKVQMMRAGYAIE
MNMG_BACSU       DKPRHQIFLEPEGRNTQE----VYVQGLSTSLPEDVQQRMLATIPGLENVQMMRAGYAIE
MNMG_BACLD       DKPRHQIFLEPEGRNTQE----VYVQGLSTSLPEDVQRKMLSTIPGLENVQMMRAGYAIE
MNMG_BACP2       DKPRHQIFLEPEGRNTQE----VYVQGLSTSLPEDVQQRMLSTIPGLENVQMMRAGYAIE
MNMG_BACAH       DKPRHQIFLEPEGRNTQE----VYVQGLSTSLPEDVQRDMLRTIPGLENVEMMRTGYAIE
MNMG_BACHK       DKPRHQIFLEPEGRNTQE----VYVQGLSTSLPEDVQRDMLRTIPGLENVEMMRTGYAIE
MNMG_BACAN       DKPRHQIFLEPEGRNTQE----VYVQGLSTSLPEDVQRDMLRTIPGLENVEMMRTGYAIE
MNMG_BACCZ       DKPRHQIFLEPEGRNTQE----VYVQGLSTSLPEDVQRDMLRTIPGLENVEMMRTGYAIE
MNMG_BACC1       DKPRHQIFLEPEGRNTQE----VYVQGLSTSLPEDVQRDMLRTIPGLENVEMMRTGYAIE
MNMG_BACCR       DKPRHQIFLEPEGRNTQE----VYVQGLSTSLPEDVQRDMLRTIPGLENVEMMRTGYAIE
MNMG_BACMK       DKPRHQIFLEPEGRNTQE----VYVQGLSTSLPEDVQRAMLRTIPGLENVEMMRTGYAIE
MNMG_BACCN       DKPRHQIFLEPEGRNTQE----VYVQGLSTSLPEDVQREMLKTIPGLENVEMMRTGYAIE
MNMG_GEOKA       DKPRHQIFLEPEGRETEE----VYVQGLSTSLPEHIQRKLLETIPGLEKAQLMRAGYAIE
MNMG_GEOTN       DKPRHQIFLEPEGRETEE----VYVQGLSTSLPEHIQRKLLETIPGLEKAQLMRAGYAIE
MNMG_LYSSC       DKPRHQIFLEPEGRNTRE----VYVQGLSTSLPEHVQTRLLKSIPGLENAEMMRAGYAIE
MNMG_STAA2       DKPRHQLFLEPEGRNTNE----VYVQGLSTSLPEHVQRQMLETIPGLEKADMMRAGYAIE
MNMG_STAA9       DKPRHQLFLEPEGRNTNE----VYVQGLSTSLPEHVQRQMLETIPGLEKADMMRAGYAIE
MNMG_STAAR       DKPRHQLFLEPEGRNTNE----VYVQGLSTSLPEHVQRQMLETIPGLEKADMMRAGYAIE
MNMG_STAAS       DKPRHQLFLEPEGRNTNE----VYVQGLSTSLPEHVQRQMLETIPGLEKADMMRAGYAIE
MNMG_STAA1       DKPRHQLFLEPEGRNTNE----VYVQGLSTSLPEHVQRQMLETIPGLEKADMMRAGYAIE
MNMG_STAAM       DKPRHQLFLEPEGRNTNE----VYVQGLSTSLPEHVQRQMLETIPGLEKADMMRAGYAIE
MNMG_STAAW       DKPRHQLFLEPEGRNTNE----VYVQGLSTSLPEHVQRQMLETIPGLEKADMMRAGYAIE
MNMG_STAAN       DKPRHQLFLEPEGRNTNE----VYVQGLSTSLPEHVQRQMLETIPGLEKADMMRAGYAIE
MNMG_STAAB       DKPRHQLFLEPEGRNTNE----VYVQGLSTSLPEHVQRQMLETIPGLEKADMMRAGYAIE
MNMG_STAA8       DKPRHQLFLEPEGRNTNE----VYVQGLSTSLPEHVQRQMLETIPGLEKADMMRAGYAIE
MNMG_STAA3       DKPRHQLFLEPEGRNTNE----VYVQGLSTSLPEHVQRQMLETIPGLEKADMMRAGYAIE
MNMG_STAAC       DKPRHQLFLEPEGRNTNE----VYVQGLSTSLPEHVQRQMLETIPGLEKADMMRAGYAIE
MNMG_STAAE       DKPRHQLFLEPEGRNTNE----VYVQGLSTSLPEHVQRQMLETIPGLEKADMMRAGYAIE
MNMG_STAAT       DKPRHQLFLEPEGRNTNE----VYVQGLSTSLPEHVQRQMLETIPGLEKADMMRAGYAIE
MNMG_STAES       DKPRHQLFLEPEGRNTNE----VYVQGLSTSLPEHVQRQMLETIPGLEKADMMRAGYAIE
MNMG_STAEQ       DKPRHQLFLEPEGRNTNE----VYVQGLSTSLPEHVQRQMLETIPGLEKADMMRAGYAIE
MNMG_STAHJ       DKPRHQLFLEPEGRNTNE----VYVQGLSTSLPEHVQRQMLETIPGLEKADMMRAGYAIE
MNMG_STAS1       DKPRHQLFLEPEGRNTNE----VYVQGLSTSLPEHVQRQMLETIPGLEKADMMRAGYAIE
MNMG_LISMO       DKPRHQIFLEPEGKNTEE----VYVQGLSTSLPEEVQREMLRTIPGLENVEMMRVGYAIE
MNMG_LISMF       DKPRHQIFLEPEGKNTEE----VYVQGLSTSLPEEVQREMLRTIPGLENVEMMRVGYAIE
MNMG_LISIN       DKPRHQIFLEPEGKNTEE----VYVQGLSTSLPEEVQREMLRTIPGLENVEMMRVGYAIE
MNMG_LISW6       DKPRHQIFLEPEGKNTEE----VYVQGLSTSLPEEVQREMLRTIPGLENVEMMRVGYAIE
MNMG_OCEIH       DKPRHQIFLEPEGRDTEE----VYVQGLSTSLPESIQHEMIKSVPGLEKAEIMRAGYAIE
MNMG_BACSK       DKPRHQIFLEPEGRDTSE----VYVQGLSTSLPEDVQLSMLKTIPGLEEVRMMRPGYAIE
MNMG_ALKHC       DKPRHQIFLEPEGRHTSE----VYVQGLSTSLPEDVQLDVLKSIPGLEKARMMRPGYAIE
MNMG_EXIS2       DKPRHQIFLEPEGRDTEE----VYVQGLSTSLPEDVQHDILRSIPGLEKSEMMRPGYAIE
MNMG_LEVBA       DKPRHQLFLEPEGRKTDE----WYVQGLSTSMPEEVQQKILHSIKGLEDAQMMRPGYAIE
MNMG_LACPL       DKKRHQLFLEPEGRNTDE----WYVQGLSTSMPEEVQQRILHSIKGLEDAEMMRPGYAIE
MNMG_PEDPA       DKSRHQLFLEPEGRKTDE----WYVQGLSTSMPEEVQQQILHSIKGLEEAEMMRPGYAIE
MNMG_LACS1       DKPRHQLFLEPEGRNTDE----YYVQGLSTSLPEEVQQEMVRSIDGLEHAEMMRPGYAIE
MNMG_ENTFA       DKPRHQLFLEPEGLNTEE----VYVQGLSTSLPEDVQTEMLHSIEGLEKVEMMRTGYAIE
MNMG_LACSS       DKPRHQIFLEPEGRETEE----YYVGDFSTSMPEEIQHKMIHSIEGLENAQMMRPGYAIE
MNMG_LACP3       DKPRHQLFLEPEGRDTSE----YYVGDFSTSMPEEIQLKMLHSVAGLEHAELMRAGYAIE
MNMG_LACAC       DKDRHQIFLEPEGKTTKE----VYVGDFSTSMPEEVQLKMVHSVAGLEHAEMMRPGYAIE
MNMG_LACH4       DKDRHQIFLEPEGRTTKE----VYVGDFSTSMPEEIQLKMVHSVAGLEHAEMMRPGYAIE
MNMG_LACJO       DKDRHQIFLEPEGRHTKE----IYVGDFSTSMPEEVQLKMLHSVAGLEKAELMRPGYAIE
MNMG_LACGA       DKDRHQIFLEPEGRNTKE----IYVGDFSTSMPEEVQLKMLHSVAGLEKAELMRPGYAIE
MNMG_LACDA       DKDRHQIFLEPEGRKTEE----IYVGDFSTSMPEEVQLEMLHTVAGLEKVEMMRPGYAIE
MNMG_LACDB       DKDRHQIFLEPEGRKTEE----IYVGDFSTSMPEEVQLEMLHTVAGLEKVEMMRPGYAIE
MNMG_LACLM       DKPRHQLFLEPEGRNTEE----VYIGGLSTSMPEDVQFDLVKSIPGLENAKMMRPGYAIE
MNMG_LACLS       DKPRHQLFLEPEGRNTEE----VYIGGLSTSMPEDVQFDLVKSIPGLENAKMMRPGYAIE
MNMG_LACLA       DKPRHQLFLEPEGRNTEE----VYIGGLSTSMPEDVQFDLVKSIPGLENAQMMRPGYAIE
MNMG_STRA3       DKERHQLFLEPEGRYTEE----VYVQGLSTSLPEDVQVDLLRSIKGLENAEMMRTGYAIE
MNMG_STRA5       DKERHQLFLEPEGRYTEE----VYVQGLSTSLPEDVQVDLLRSIKGLENAEMMRTGYAIE
MNMG_STRA1       DKERHQLFLEPEGRHTEE----VYVQGLSTSLPEDVQVDLLRSIKGLENAEMMRTGYAIE
MNMG_STRP1       DKERHQLFLEPEGRDTEE----VYVQGLSTSLPEDVQKDLIHSIKGLEKAEMMRTGYAIE
MNMG_STRPD       DKERHQLFLEPEGRDTEE----VYVQGLSTSLPEDVQKDLIHSIKGLEKAEMMRTGYAIE
MNMG_STRPB       DKERHQLFLEPEGRDTEE----VYVQGLSTSLPEDVQKDLIHSIKGLEKAEMMRTGYAIE
MNMG_STRPC       DKERHQLFLEPEGRDTEE----VYVQGLSTSLPEDVQKDLIHSIKGLEKAEMMRTGYAIE
MNMG_STRPG       DKERHQLFLEPEGRDTEE----VYVQGLSTSLPEDVQKDLIHSIKGLEKAEMMRTGYAIE
MNMG_STRP8       DKERHQLFLEPEGRDTEE----VYVQGLSTSLPEDVQKDLIHSIKGLEKAEMMRTGYAIE
MNMG_STRPF       DKERHQLFLEPEGRDTEE----VYVQGLSTSLPEDVQKDLIHSIKGLEKAEMMRTGYAIE
MNMG_STRPM       DKERHQLFLEPEGRDTEE----VYVQGLSTSLPEDVQKDLIHSIKGLEKAEMMRTGYAIE
MNMG_STRP3       DKERHQLFLEPEGRDTEE----VYVQGLSTSLPEDVQKDLIHSIKGLEKAEMMRTGYAIE
MNMG_STRP6       DKERHQLFLEPEGRDTEE----VYVQGLSTSLPEDVQKDLIHSIKGLEKAEMMRTGYAIE
MNMG_STRT2       DKNRHQLFLEPEGRETEE----VYVQGLSTSLPEDVQKELIHSIKGLEKAEMIRTGYAIE
MNMG_STRT1       DKNRHQLFLEPEGRETEE----VYVQGLSTSLPEDVQKELIHSIKGLEKAEMIRTGYAIE
MNMG_STRTD       DKNRHQLFLEPEGRETEE----VYVQGLSTSLPEDVQKELIHSIKGLEKAEMIRTGYAIE
MNMG_STRMU       DKDRHQLFLEPEGRETEE----VYIQGLSTSLPEDVQKDVVHSIKGLENAEMMRTGYAIE
MNMG_STRGC       DKERHQLFLEPEGRDTEE----VYVQGLSTSLPEDVQKDLVHSIKGLENAEMMRTGYAIE
MNMG_STRSV       DKERHQLFLEPEGRDTEE----VYVQGLSTSLPEDVQKDLVHSIKGLENAEMMRTGYAIE
MNMG_STRR6       DKERHQLFLEPEGRNTEE----VYVQGLSTSLPEDVQRDLVHSIKGLENAEMMRTGYAIE
MNMG_STRP2       DKERHQLFLEPEGRNTEE----VYVQGLSTSLPEDVQRDLVHSIKGLENAEMMRTGYAIE
MNMG_STRPN       DKERHQLFLEPEGRNTEE----VYVQGLSTSLPEDVQRDLVHSIKGLENAEMMRTGYAIE
MNMG_STRPI       DKERHQLFLEPEGRNTEE----VYVQGLSTSLPEDVQRDLVHSIKGLENAEMMRTGYAIE
MNMG_STRSY       DKERHQLFLEPEGRNTDE----IYVQGLSTSLPEDVQQDLIHSIKGLENAQMMRTGYAIE
MNMG_STRS2       DKERHQLFLEPEGRNTDE----IYVQGLSTSLPEDVQQDLIHSIKGLENAQMMRTGYAIE
MNMG_DESRM       DKPQHQIFVEPEGLHTYE----MYVQGMSTSLPPDVQLKMYRTIPGMENVSIMRPAYAIE
MNMG_PELTS       DKPAHQVFIEPEGRNTTE----MYVQGMSTSLPEDVQLAMLRTLPGLERVEMMRPGYAIE
MNMG_CARHZ       DKPRHQVFLEPEGLDTYE----MYVQGMSTSLPEDLQIKMLRTLPGLERVEIMRPAYAIE
MNMG_MOOTA       DKPGHQIFLEPEGMGTEE----WYVQGLSTSLPEDVQLAVLHSVPGLEQAEMMRPGYAIE
MNMG_HELMI       DKKSHQVFIEPEGEGTHE----MYVQGMSTSLPEDVQVTMLRSIIGMKDVKIIRPGYAIE
MNMG_SYNWW       HKDSHQLFIEPEGRDTDE----MYVQGLNTSLPEDVQIEVLKSIPGLENVRIMRTGYAIE
MNMG_DESAP       DRERHQVFVEPEGLHTNE----MYVQGMSTSLPEDVQLLLLRSLPGLEKVEIVRYGYAIE
MNMG_SYMTH       DKESHQVFLEPESRESHE----MYVLGLSTSLPEEVQIELVRTVPGMEEAELMRPGYAIE
MNMG_DESHY       DRPTHQIFLEPEGWNSDE----LYVAGLSTSMPEEIQYDIIHSIPGLEKAELLRPGYAIE
MNMG_ROSCS       DKERHGLFLEPEGWSTHE----VYVQGCNTSLPEDVQWAMLRSIPALRRVELMRAGYAIE
MNMG_ROSS1       DKERHGLFLEPEGWSTHE----VYVQGCNTSLPEDVQWAMLRSIPALRRVELMRAGYAIE
MNMG_CHLAA       DKERHGLFLEPEGWTTSE----VYVQGCNTSLPEDVQWAMLRSIPALRNVELMRIGYAIE
MNMG_DEIRA       HHDRHLLFVEPDGVQTSE----VYLQGFSSSLPPRLQDELVRTLPGFEQAVIQRYAYAVE
MNMG_DEIGD       HHDRHLLFVEPDGVQTSE----VYLQGFSSSLPPALQDRLVRSLPGFEAAVIQRYAYAVE
MNMG_THET2       DKESHLLFVEPDGLSTTE----VYLQGFSSSLPPELQEEMVRSLPGFERAVIQRYAYAVE
MNMG_THET8       DKESHLLFVEPDGLSTTE----VYLQGFSSSLPPELQEEMVRSLPGFERAVIQRYAYAVE
MNMG_MYXXD       SRERHQVFLEPEGPTSPL----VYPAGLSTSLPADVQLTFLHTIRGLEQVEVVRFGYAVE
                  .  *   .*             :  .  .      *      :       .   .* ::

MNMG_NOSS1       YDYLPATQCYPTLMTKKIAGLFCAGQVNGTTGYEEAAAQGIVAGINAARFVRDEE-----
MNMG_TRIV2       YDYLPATQCYPTLMTKKVAGLFCAGQVNGTTGYEEAAAQGIVAGINAARFVRDQE-----
MNMG_TRIEI       YDYLPATQCYPTLMTKKIEGLFCAGQINGTTGYEEAAAQGLVAGINAVKFVKNEE-----
MNMG_SYNY3       YDFLPATQCYPSLMTKKVAGLFCAGQINGTTGYEEAAAQGLVAGINAARHCQGKS-----
MNMG_SYNP2       YDYLPATQCYPTLMTKRVEGLFSAGQINGTTGYEEAAAQGIVAGINAAKFAQGQD-----
MNMG_MICAN       YDYLPATQCYPTLMTKKIEGLFCAGQINGTTGYEEAAAQGLVAGINAARFALGKE-----
MNMG_ACAM1       YDYLPATQCYPTLMTKRIEGLFCAGQINGTTGYEEAAAQGIVAGINAARRVNQQE-----
MNMG_SYNP6       YDYLPATQCLPTLMTRRVEGLFSAGQLNGTTGYEEAAAQGIVAGINAARFVQGQD-----
MNMG_SYNE7       YDYLPATQCLPTLMTRRVEGLFSAGQLNGTTGYEEAAAQGIVAGINAARFVQGQD-----
MNMG_THEEB       YDYLPATQCFPTLMTKKIQGLFCAGQINGTTGYEEAAAQGIVAGINAARFVQRKP-----
MNMG_SYNJB       YDYLPATQLYPTLMTKKVQGLFCAGQINGTTGYEEAAAQGLIAGINAARLVQGKP-----
MNMG_SYNJA       YDYLPATQLYPTLMTKKVQGLFCAGQINGTTGYEEAAAQGLIAGINAARLVQGKP-----
MNMG_PROM1       YDYIPATQLEATLETKRISGLYSAGQLNGTTGYEEAAAQGLVAGLNAARLVNNKE-----
MNMG_PROMT       YDYIPATQLEATLETKRISGLYSAGQLNGTTGYEEAAAQGLVAGLNAARLVNNKE-----
MNMG_PROMA       YDYLPATQLLASLETKKIEGLFSAGQLNGTTGYEEAAAQGLVAGLNAARYVNNQD-----
MNMG_PROM3       YDYLPATQLSPSLQTKRVKGLFTAGQLNGTTGYEEAAAQGLVAGLNAARLVHGQE-----
MNMG_PROMM       YDYLPATQLSPSLQTKRVKGLFTAGQLNGTTGYEEAAAQGLVAGLNAARLVQGQE-----
MNMG_SYNSC       YDYLPATQLKPSLETKRVRGLFSAGQLNGTTGYEEAAAQGLVAGVNAGRLIGGQE-----
MNMG_SYNPX       YDYLPATQLKPSLETKRVRGLFSAGQLNGTTGYEEAAAQGLVAGVNAARHIGGQE-----
MNMG_SYNS9       YDYLPATQLKPSLETKRVSGLFSAGQLNGTTGYEEAAAQGLVAGLNAARLIGEQD-----
MNMG_SYNPW       YDYLPATQLLPSLETKRVQGLFSAGQLNGTTGYEEAAAQGLVAGLNAARRIRAEE-----
MNMG_SYNS3       YDYLPATQLKPSLETKRVRGLFSAGQLNGTTGYEEAAAQGLVAGLNAARLIGGQE-----
MNMG_SYNR3       YDYLPATQLLPSLQTKRVAGLFSAGQLNGTTGYEEAAAQGLVAGLNAVRLIRGQT-----
MNMG_PROMS       YDYIPATQLQTSLETKEIEYLFSAGQINGTTGYEEAAAQGLVAGVNATRKLNKKD-----
MNMG_PROM0       YDYIPATQLQTSLETKEIEYLFSAGQINGTTGYEEAAAQGLVAGVNATRKLSKKD-----
MNMG_PROM9       YDYIPATQLQTSLETKEIEYLFSAGQINGTTGYEEAAAQGLVAGVNATRKLNEKD-----
MNMG_PROM2       YEYIPATQLQTSLETKEIEYLFSAGQINGTTGYEEAAAQGLVAGVNATRKLNKKD-----
MNMG_PROM5       YEYIPATQLKLSLETIEIDNLFSAGQINGTTGYEEAAAQGLVAGINATRKLNMKD-----
MNMG_PROMP       YEYIPATQLKSSLETIEIENLFSAGQINGTTGYEEAAAQGLVAGINATRKLNMKD-----
MNMG_CHLTR       YDYVHGNVIFPSLESKLIEGLFLCGQINGTTGYEEAAAQGLIAGVNAVNKVLRHP-----
MNMG_CHLTA       YDYVHGNVIFPSLESKLIEGLFLCGQINGTTGYEEAAAQGLIAGVNAVNKVLRHP-----
MNMG_CHLT2       YDYVHGNVIFPSLESKLIEGLFLCGQINGTTGYEEAAAQGLIAGVNAVNKVLRRP-----
MNMG_CHLTB       YDYVHGNVIFPSLESKLIEGLFLCGQINGTTGYEEAAAQGLIAGVNAVNKVLRRP-----
MNMG_CHLMU       YDYIQGNVILPSLESKILEGLFLCGQINGTTGYEEAAAQGLIAGVNAVNKVLHRP-----
MNMG_CHLAB       YDYVHGNVIYPTLESKLIEGLFLCGQINGTTGYEEAAAQGLIAGINAVNKVLKKP-----
MNMG_CHLCV       YDYVHGNVIYPTLESKIVEGLFLCGQINGTTGYEEAAAQGLIAGINAVNKVLKKP-----
MNMG_CHLFF       YDYVHGNVIYPTLESKTIEGLFLCGQINGTTGYEEAAAQGLIAGINAVNKVLRKP-----
MNMG_CHLPN       YDYIHGNVIHPTLESKLIEGLFLCGQINGTTGYEEAAAQGLIAGINAVNKVFNRP-----
MNMG_PARUW       YDYVISGQIDFSLECKKIGGLFLAGQINGTSGYEEAAGQGLMAGINAANKVMGKA-----
MNMG_RHOBA       YDYCPPTQLWPHLESKSVSGLFFAGQINGTTGYEEAAGQGLIAGLNAARTAASKT-----
MNMG_OPITP       YDYAPPTQLKMSLESQRVEGLFLAGQINGTSGYEEAAGQGLIAGVNAARKGRGEQ-----
MNMG_AQUAE       YDVVPPTELYPTLETKKIRGLFHAGNFNGTTGYEEAAGQGIVAGINAALRAFGKE-----
MNMG_ECOLI       YDFFDPRDLKPTLESKFIQGLFFAGQINGTTGYEEAAAQGLLAGLNAARLSADK------
MNMG_ECOL6       YDFFDPRDLKPTLESKFIQGLFFAGQINGTTGYEEAAAQGLLAGLNAARLSADK------
MNMG_ECO24       YDFFDPRDLKPTLESKFIQGLFFAGQINGTTGYEEAAAQGLLAGLNAARLSADK------
MNMG_ECODH       YDFFDPRDLKPTLESKFIQGLFFAGQINGTTGYEEAAAQGLLAGLNAARLSADK------
MNMG_ECOL5       YDFFDPRDLKPTLESKFIQGLFFAGQINGTTGYEEAAAQGLLAGLNAARLSADK------
MNMG_ECOHS       YDFFDPRDLKPTLESKFIQGLFFAGQINGTTGYEEAAAQGLLAGLNAARLSADK------
MNMG_ECOLC       YDFFDPRDLKPTLESKFIQGLFFAGQINGTTGYEEAAAQGLLAGLNAARLSADK------
MNMG_SHIBS       YDFFDPRDLKPTLESKFIQGLFFAGQINGTTGYEEAAAQGLLAGLNAARLSADK------
MNMG_SHISS       YDFFDPRDLKPTLESKFIQGLFFAGQINGTTGYEEAAAQGLLVGLNAARLSADK------
MNMG_ECOUT       YDFFDPRDLKPTLESKFIQGLFFAGQINGTTGYEEAAAQGLLAGLNAARLSADK------
MNMG_ECOK1       YDFFDPRDLKPTLESKFIQGLFFAGQINGTTGYEEAAAQGLLAGLNAARLSADK------
MNMG_ECOSM       YDFFDPRDLKPTLESKFIQGLFFAGQINGTTGYEEAAAQGLLAGLNAARLSADK------
MNMG_ECO57       YDFFDPRDLKPTLESKFIQGLFFAGQINGTTGYEEAAAQGLLAGLNAARLSDDK------
MNMG_SHIDS       YDFFDPRDLKPTLESKFLQGLFFAGQINGTTGYEEAAAQGLLAGLNAARLSADK------
MNMG_SHIFL       YDFFDPRDLKPTLESKFIQGLFFAGQINGTTGYEEAAAQGLLAGLNAARLSADK------
MNMG_SHIF8       YDFFDPRDLKPTLESKFIQGLFFAGQINGTTGYEEAAAQGLLAGLNAARLSADK------
MNMG_SALCH       YDFFDPRDLKPTLESKFIHGLFFAGQINGTTGYEEAAAQGLLAGLNAARLSADK------
MNMG_SALTY       YDFFDPRDLKPTLESKFIHGLFFAGQINGTTGYEEAAAQGLLAGLNAARLSADK------
MNMG_SALPB       YDFFDPRDLKPTLESKFIHGLFFAGQINGTTGYEEAAAQGLLAGLNAARLSADK------
MNMG_SALPA       YDFFDPRDLKPTLESKFIHGLFFAGQINGTTGYEEAAAQGLLAGLNAARLSADK------
MNMG_SALTI       YDFFDPRDLKPTLESKFIHGLFFAGQINGTTGYEEAAAQGLLAGLNAARLSADK------
MNMG_CITK8       YDFFDPRDLKPTLESKFIQGLFFAGQINGTTGYEEAAAQGLLAGLNAARLSADK------
MNMG_SALAR       YDFFDPRDLKPTLESKFIQGLFFAGQINGTTGYEEAAAQGLLAGLNAARLSADK------
MNMG_ENT38       YDFFDPRDLKPTLESKFIQGLFFAGQINGTTGYEEAAAQGLLAGLNAARFSAEK------
MNMG_KLEP7       YDFFDPRDLKPTLESKFIQGLFFAGQINGTTGYEEAAAQGLLAGLNAARFSAEK------
MNMG_CROS8       YDFFDPRDLKPTLESKYIHGLFFAGQINGTTGYEEAAAQGLLAGLNAGRYSAEK------
MNMG_PECAS       YDFFDPRDLKPTLENKFVHGLFFAGQINGTTGYEEAAAQGMLAGLNAARLSADK------
MNMG_YERPE       YDFFDPRDLKPTLESKYIQGLFFAGQINGTTGYEEAAAQGLLAGLNAGRFANEE------
MNMG_YERPY       YDFFDPRDLKPTLESKYIQGLFFAGQINGTTGYEEAAAQGLLAGLNAGRFANEE------
MNMG_YERPA       YDFFDPRDLKPTLESKYIQGLFFAGQINGTTGYEEAAAQGLLAGLNAGRFANEE------
MNMG_YERPN       YDFFDPRDLKPTLESKYIQGLFFAGQINGTTGYEEAAAQGLLAGLNAGRFANEE------
MNMG_YERPP       YDFFDPRDLKPTLESKYIQGLFFAGQINGTTGYEEAAAQGLLAGLNAGRFANEE------
MNMG_YERPS       YDFFDPRDLKPTLESKYIQGLFFAGQINGTTGYEEAAAQGLLAGLNAGRFANEE------
MNMG_YERP3       YDFFDPRDLKPTLESKYIQGLFFAGQINGTTGYEEAAAQGLLAGLNAGRFANEE------
MNMG_YERE8       YDFFDPRDLKPTLESKYIQGLFFAGQINGTTGYEEAAAQGLLAGLNAGRFANDE------
MNMG_SERP5       YDFFDPRDLKPTLESKFIQGLFFAGQINGTTGYEEAAAQGLLAGLNAGRYANED------
MNMG_PHOLL       YDFFDPRDLKQTLESKFIHGLFFAGQINGTTGYEEAAAQGLLAGLNAARYASEE------
MNMG_SODGM       YDFFDPRDLKLTLESKLIEGLFFAGQINGTTGYEEAAAQGMLAGLNAARLAMGK------
MNMG_VIBCH       YDFFDPRDLKQTYETKYIHGLFFAGQINGTTGYEEAAAQGLMAGLNASLYSQDK------
MNMG_VIBC3       YDFFDPRDLKQTYETKYIHGLFFAGQINGTTGYEEAAAQGLMAGLNASLYSQDK------
MNMG_VIBCB       YDFFDPRDLKQTYETKFISGLFFAGQINGTTGYEEAAAQGLMAGLNASLHSQGK------
MNMG_VIBPA       YDFFDPRDLKQTYETKFISGLFFAGQINGTTGYEEAAAQGLMAGLNASLYSQGK------
MNMG_VIBVU       YDFFDPRDLKQTYETKFIQGLFFAGQINGTTGYEEAAAQGLMAGLNASLFSQEK------
MNMG_VIBVY       YDFFDPRDLKQTYETKFIQGLFFAGQINGTTGYEEAAAQGLMAGLNASLFSQEK------
MNMG_ALIF1       YDFFDPRDLKSTYETKFIEGLFFAGQINGTTGYEEAAAQGLMAGLNASLFAQGK------
MNMG_PHOPR       YDFFDPRDLKQTFETKFIDGLFFAGQINGTTGYEEAAAQGLLAGMNAALQSQGK------
MNMG_AERHH       YDFFDPRDLKANMESKCIPNLFFAGQINGTTGYEEAAAQGLLAGLNAGLRAQEK------
MNMG_AERS4       YDFFDPRDLKANMESKYIGNLFFAGQINGTTGYEEAAAQGLMAGLNAGLRAQDK------
MNMG_COLP3       YDYFDPRDLKQSLESKFVQNLYFAGQINGTTGYEEAGAQGLIAGANAANRVKER------
MNMG_PSEA6       YDFFDPRDLKQTLETKFIKGLFFAGQINGTTGYEEAGAQGLIAGANASLQCQGK------
MNMG_IDILO       YDYFDPRDLKQSLETKVINGLFFAGQINGTTGYEEAGAQGLIAGLNAALQAQDK------
MNMG_PSET1       YDFFDPRDLKRSLETKFIDGLFFAGQINGTTGYEEAGAQGLIAGMNAALKVQGK------
MNMG_SHEB5       YDYFDPRDLKNSLETKAINGLFFAGQINGTTGYEEAGAQGLLAGMNASLQVQGK------
MNMG_SHEB8       YDYFDPRDLKNSLETKAINGLFFAGQINGTTGYEEAGAQGLLAGMNASLQVQGK------
MNMG_SHEB9       YDYFDPRDLKNSLETKAINGLFFAGQINGTTGYEEAGAQGLLAGMNASLQVQGK------
MNMG_SHEPC       YDYFDPRDLKNSLETKTINGLFFAGQINGTTGYEEAAAQGLLAGMNASLQVQGK------
MNMG_SHESW       YDYFDPRDLKNSLETKTINGLFFAGQINGTTGYEEAAAQGLLAGMNASLQVQGK------
MNMG_SHESM       YDYFDPRDLKNSLETKTINGLFFAGQINGTTGYEEAGAQGLLAGMNAALQVQGK------
MNMG_SHESR       YDYFDPRDLKNSLETKTINGLFFAGQINGTTGYEEAGAQGLLAGMNAALQVQGK------
MNMG_SHESA       YDYFDPRDLKNSLETKTINGLFFAGQINGTTGYEEAGAQGLLAGMNAALQVQGK------
MNMG_SHEON       YDYFDPRDLKNSLETKTINGLFFAGQINGTTGYEEAGAQGLLAGMNASLQVQGK------
MNMG_SHEDO       YDYFDPRDLKNSLETKTINGLFFAGQINGTTGYEEAGAQGLLAGMNASLQVQGK------
MNMG_SHEFN       YDYFDPRDLKNSLETKAIEGLYFAGQINGTTGYEEAGAQGLLAGMNASLQVQGK------
MNMG_SHEHH       YDYFDPRDLKNSLETKAISGLFFAGQINGTTGYEEAGAQGLLAGMNASLQVQGK------
MNMG_SHEPA       YDYFDPRDLKNSLETKTIAGLFFAGQINGTTGYEEAGAQGLLAGMNASLQVQGK------
MNMG_SHESH       YDYFDPRDLKNSLETKSIQGLFFAGQINGTTGYEEAGAQGLLAGMNASLQVQGK------
MNMG_SHEWM       YDYFDPRDLKNSLETKSIDGLFFAGQINGTTGYEEAGAQGLLAGMNASLQVQGK------
MNMG_SHELP       YDYFDPRDLKNSLETKAISGLFFAGQINGTTGYEEAGAQGLLAGMNASLQVQGK------
MNMG_SHEAM       YDYFDPRDLKNSLETKVIDGLFFAGQINGTTGYEEAGAQGLLAGLNAALQVQGK------
MNMG_PSYIN       YDYFDPRDLKSTLESKYIDGLFFAGQINGTTGYEEAAAQGLLAGMNAGLMVQDK------
MNMG_ACTP2       YDYFDPRDLKPTLETKAIEGLFFAGQINGTTGYEEAAAQGLLAGINAALQVQGK------
MNMG_ACTPJ       YDYFDPRDLKPTLETKAIEGLFFAGQINGTTGYEEAAAQGLLAGINAALQVQGK------
MNMG_HAEDU       YDYFDPRDLKPTLETKAIEGLFFAGQINGTTGYEEAAAQGLLAGINAALQVQAK------
MNMG_HAEIN       YDYFDPRDLKPTLETKSISGLFFAGQINGTTGYEEAAAQGLLAGINAGLYVQEK------
MNMG_HAEIG       YDYFDPRDLKPTLETKSISGLFFAGQINGTTGYEEAAAQGLLAGINAGLYVQEK------
MNMG_HAEIE       YDYFDPRDLKPTLETKSISGLFFAGQINGTTGYEEAAAQGLLAGINAGLYVQEK------
MNMG_HAEI8       YDYFDPRDLKPTLETKAISGLFFAGQINGTTGYEEAAAQGLLAGINAGLYVQEK------
MNMG_HAES1       YDYFDPRDLKSTLETKAISGLFFAGQINGTTGYEEAAAQGLLAGINAGLFVQEK------
MNMG_HISS2       YDYFDPRDLKPTLETKAISGLFFAGQINGTTGYEEAAAQGLLAGINAGLFVQEK------
MNMG_MANSM       YDFFDPRDLKPTLETKAIKGLFFAGQINGTTGYEEAASQGLLAGINAGLFVQEK------
MNMG_PASMU       YDYFDPRDLKPTLETKSIRGLFFAGQINGTTGYEEAAGQGLLAGINAGLFVQEK------
MNMG_ACTSZ       YDYFDPRDLKPTLETKAIGGLFFAGQINGTTGYEEAAAQGLLAGINAGLFVREK------
MNMG_HYDCU       YDYFDPRGLRPTLETQAIHGLYFAGQINGTTGYEEAAAQGLLAGMNAARRAQMK------
MNMG_ACIAC       YDYFDPRSLKSNFETRQIQGLFFAGQINGTTGYEEAAAQGLFAGINAALQCRG-------
MNMG_ACISJ       YDYFDPRSLKSSFETRQIQGLFFAGQINGTTGYEEAAAQGLFAGINAALQCRG-------
MNMG_VEREI       YDYFDPRALKSNFETRQIRGLFFAGQINGTTGYEEAAAQGLFAGVNAALQCRG-------
MNMG_POLNA       YDYFDPRALKTNFETRAIGGLFFAGQINGTTGYEEAAAQGMFAGINAALQCQE-------
MNMG_POLSJ       YDYFDPRALKTTFETRAIGGLFFAGQINGTTGYEEAAAQGMFAGINAALQCRALGGLPND
MNMG_RHOFT       YDYFDPQQLKSSFETRAIGGLFFAGQINGTTGYEEAAAQGLFAGVNAALQAGAQTSW---
MNMG_LEPCP       YDYFDPRELKTSFESKAIGGLFFAGQINGTTGYEEAAAQGLYAGANAALQAQG-------
MNMG_METPP       YDYFDPRGLKSSFETKAIGGLFFAGQINGTTGYEEAAAQGLFAGVNAARQVQE-------
MNMG_BURCA       YDYFDPRALKASLETKAINGLFFAGQINGTTGYEEAAAQGLLAGLNAGRYVQE-------
MNMG_BURCH       YDYFDPRALKASLETKAINGLFFAGQINGTTGYEEAAAQGLLAGLNAGRYVQE-------
MNMG_BURCC       YDYFDPRALKASLETKAINGLFFAGQINGTTGYEEAAAQGLLAGLNAGRYVQE-------
MNMG_BURCM       YDYFDPRALKASLETKAINGLFFAGQINGTTGYEEAAAQGLLAGLNAGRYVQE-------
MNMG_BURA4       YDYFDPRALKASLETKAINGLFFAGQINGTTGYEEAAAQGLLAGLNAGRYVQE-------
MNMG_BURL3       YDYFDPRALKASLETKAINGLFFAGQINGTTGYEEAAAQGLLAGLNAGRYVQE-------
MNMG_BURVG       YDYFDPRALKASLETKAINGLFFAGQINGTTGYEEAAAQGLLAGLNAGRYVQE-------
MNMG_BURMA       YDYFDPRALKSSLETKAIGGLFFAGQINGTTGYEEAAAQGLLAGINAGRYAQE-------
MNMG_BURM9       YDYFDPRALKSSLETKAIGGLFFAGQINGTTGYEEAAAQGLLAGINAGRYAQE-------
MNMG_BURP0       YDYFDPRALKSSLETKAIGGLFFAGQINGTTGYEEAAAQGLLAGINAGRYAQE-------
MNMG_BURM7       YDYFDPRALKSSLETKAIGGLFFAGQINGTTGYEEAAAQGLLAGINAGRYAQE-------
MNMG_BURMS       YDYFDPRALKSSLETKAIGGLFFAGQINGTTGYEEAAAQGLLAGINAGRYAQE-------
MNMG_BURP1       YDYFDPRALKSSLETKAIGGLFFAGQINGTTGYEEAAAQGLLAGINAGRYAQE-------
MNMG_BURPS       YDYFDPRALKSSLETKAIGGLFFAGQINGTTGYEEAAAQGLLAGINAGRYAQE-------
MNMG_BURP6       YDYFDPRALKSSLETKAIGGLFFAGQINGTTGYEEAAAQGLLAGINAGRYAQE-------
MNMG_BURTA       YDYFDPRALKSSLETKAINGLFFAGQINGTTGYEEAAAQGLLAGINAGRHALE-------
MNMG_PARXL       YDYFDPRGLKASLETKVISGLFFAGQINGTTGYEEAAAQGLLAGINAGLYVQG-------
MNMG_CUPNH       YDYFDPRGLKASLESKAISGLFFAGQINGTTGYEEAAAQGLLAGINAGCYVRE-------
MNMG_CUPPJ       YDYFDPRALKASLESKAISGLFFAGQINGTTGYEEAAAQGLLAGINAGCYVRE-------
MNMG_CUPMC       YDYFDPRGLKSSLESKAIEGLFFAGQINGTTGYEEAAAQGLLAGINAGCYVRE-------
MNMG_RALSO       YDYFDPRGLKASLESKAIGGLFFAGQINGTTGYEEAAAQGLLAGINAGLQVQG-------
MNMG_JANMA       YDYFDPRGLKSTLETKVIQGLFFAGQINGTTGYEEAAAQGMLAGINAALQTQE-------
MNMG_HERAR       YDYFDPRGLKATLETKVIQGLFFAGQINGTTGYEEAAAQGMLAGINAALQIQE-------
MNMG_BORBR       YDYFDPRALKSTLETKAISGLFFAGQINGTTGYEEAAAQGLLAGANAALQAQG-------
MNMG_BORPA       YDYFDPRALKSTLETKAISGLFFAGQINGTTGYEEAAAQGLLAGANAALQAQG-------
MNMG_BORPE       YDYFDPRALKSTLETKAISGLFFAGQINGTTGYEEAAAQGLLAGANAALQAQG-------
MNMG_BORPD       YDYFDPRALKSTLETKAIGGLYFAGQINGTTGYEEAAAQGLLAGANAALQALD-------
MNMG_BORA1       YDYFDPRGLKSSLETKAISGLFFAGQINGTTGYEEAAAQGLLAGINAARYASD-------
MNMG_AZOSB       YDYFDPRNLKSSLETKSIGGLFFAGQINGTTGYEEAAAQGLLAGANAALQVQG-------
MNMG_AROAE       YDYFDPRNLKSSLETKSFHGLFFAGQINGTTGYEEAAAQGLLAGANAALQVAG-------
MNMG_DECAR       YDFYDPRGLKDTLETKAIHGLFFAGQINGTTGYEEAAAQGLLAGINAVRYVRG-------
MNMG_METFK       YDYYDPRGLKSSLETKAIRGLFFAGQINGTTGYEEAAAQGLLAGANAALYAQE-------
MNMG_THIDA       YDYYDPRNLKASLETKSIAGLFFAGQINGTTGYEEAAAQGLLAGLNAALQTQG-------
MNMG_NITMU       YDYFDPRALKSSLETRMIEGLFFAGQINGTTGYEEAAAQGLLAGINAALKTQD-------
MNMG_NEIG1       YDYFDPRNLKASLETKTIEGLFFAGQINGTTGYEEAAAQGLLAGANAVQYVRG-------
MNMG_NEIMA       YDYFDPRNLKASLETKTIEGLFFAGQINGTTGYEEAAAQGLLAGANAVQYVRG-------
MNMG_NEIMB       YDYFDPRNLKASLETKTIAGLFFAGQINGTTGYEEAAAQGLLAGANAVQYVRG-------
MNMG_NEIM0       YDYFDPRNLKASLETKTIQGLFFAGQINGTTGYEEAAAQGLLAGANAVQYVRE-------
MNMG_NEIMF       YDYFDPRNLKASLETKTIQGLFFAGQINGTTGYEEAAAQGLLAGANAVQYVRE-------
MNMG_CHRVO       YDYFDPRGLKASLETKAIQGLFFAGQINGTTGYEEAAAQGLLAGLNAGLFARE-------
MNMG_POLAQ       YDFFDPRHLRHSLETKAIGGLYFAGQINGTTGYEEAAAQGMLAGINAGLAAQG-------
MNMG_ACIBT       YDYFNPQALKFTLETKAINGLYFAGQINGTTGYEEAGAQGLLAGLNAARRAWEQ------
MNMG_ACIBY       YDYFNPQALKFTLETKAINGLYFAGQINGTTGYEEAGAQGLLAGLNAARRAWEQ------
MNMG_ACIAD       YDYFNPQALKFTLETKAINNLYFAGQINGTTGYEEAGAQGLLAGLNAARRAWDQ------
MNMG_PSYA2       YDYFDPQNLKPTLETKSIDRLYFAGQINGTTGYEEAGVQGLLAGTNAALVTCENSEF---
MNMG_PSYCK       YDYFDPQNLKPTLETKSIDRLYFAGQINGTTGYEEAGVQGLLAGTNAALVTCENNEF---
MNMG_PSYWF       YDYFNPQNLKPTLETKSIDSLYFAGQINGTTGYEEAGVQGLLAGVNAALSTQDNPVM---
MNMG_PSEAE       YDFFDPRDLRYSLETKVIGGLFFAGQINGTTGYEEAGAQGLLAGANAALRSQGK------
MNMG_PSEAB       YDFFDPRDLRYSLETKVIGGLFFAGQINGTTGYEEAGAQGLLAGANAALRSQGK------
MNMG_PSEA7       YDFFDPRDLKYSLETKVIGGLFFAGQINGTTGYEEAGAQGLLAGANAALRAQGK------
MNMG_PSEPU       YDYFDPRDLKYSLETKVIGGLFFAGQINGTTGYEEAGAQGLLAGTNAALRAQGR------
MNMG_PSEPK       YDYFDPRDLKYSLETKVIGGLFFAGQINGTTGYEEAGAQGLLAGTNAALRAQGR------
MNMG_PSEP1       YDYFDPRDLKYSLETKVIGGLFFAGQINGTTGYEEAGAQGLLAGTNAALRAQGR------
MNMG_PSEPG       YDYFDPRDLKYSLETKVIGGLFFAGQINGTTGYEEAGAQGLLAGTNAALRAQGR------
MNMG_PSEPW       YDYFDPRDLKYSLETKVIGGLFFAGQINGTTGYEEAGAQGLLAGTNAALRAQGR------
MNMG_PSEE4       YDYFDPRDLKYSLETKVIGGLFFAGQINGTTGYEEAGAQGLLAGTNAALRAQGR------
MNMG_PSEF5       YDYFDPRDLKYSLETKVIGGLFFAGQINGTTGYEEAGAQGLLAGANAALRAQGK------
MNMG_PSEPF       YDYFDPRDLKYSLETKVIGGLFFAGQINGTTGYEEAGAQGLLAGANAALRAKGK------
MNMG_PSE14       YDYFDPRDLKYSLETKVIGGLFFAGQINGTTGYEEAGAQGLLAGTNAALRAQGR------
MNMG_PSEU2       YDYFDPRDLKYSLETKVIGGLFFAGQINGTTGYEEAGAQGLLAGTNAALRAQGR------
MNMG_PSESM       YDYFDPRDLKYSLETKVIGGLFFAGQINGTTGYEEAGAQGLLAGTNAALRAQGR------
MNMG_PSEMY       YDYFDPRDLKYSLETKVIGGLFFAGQINGTTGYEEAGAQGLLAGCNAALRAQGK------
MNMG_PSEU5       YDYFDPRDLKYSLETKVIGGLFFAGQINGTTGYEEAGAQGLLAGANAALRAQGK------
MNMG_ALCBS       YDYFNPQDLKHSLETQHMPGLFFAGQINGTTGYEEAGAQGLLAGLNAARLSQGK------
MNMG_HAHCH       YDFFNPQDLKHSLETKFVGSLFFAGQINGTTGYEEAAAQGLLAGMNAALRAQEK------
MNMG_MARMS       YDYFNPQDLKYSLETKHMPGLFFAGQINGTTGYEEAGAQGLLAGLNAALLAQEK------
MNMG_SACD2       YDFFDPRDLKYSFETKHIEGLFFAGQINGTTGYEEAGAQGLLAGLNAALKAQGK------
MNMG_CHRSD       YDFFDPRDLKHSLETKFIHNLFFAGQINGTTGYEEAAAQGLLAGLNAARRAQGQ------
MNMG_MARHV       YDYLNPQDLRHTLETKFIQGLYFAGQINGTTGYEEAGAQGLLAGINASLRARDQ------
MNMG_ALKEH       YDFFDPRGLHPTLETRHLEGLWFAGQINGTTGYEEAAAQGLLAGLNAALRVQGR------
MNMG_NITOC       YDFFDPRDLKPSLETSFLQGLYFAGQINGTTGYEEAAAQGLIAGLNAGLQVQEK------
MNMG_METCA       YDFFDPRDLRHSLETRHMENLFFAGQINGTTGYEEAAAQGLLAGLNAARKARDL------
MNMG_XANAC       YDFFDPRGLKASLETKAVGGLFFAGQINGTTGYEEAAAQGLLAGLNAARHVQGL------
MNMG_XANC5       YDFFDPRGLKASLETKAVGGLFFAGQINGTTGYEEAAAQGLLAGLNAARHVQGL------
MNMG_XANOR       YDFFDPRGLKASLETKAVGGLFFAGQINGTTGYEEAAAQGLLAGLNAARHVHGL------
MNMG_XANOM       YDFFDPRGLKASLETKAVGGLFFAGQINGTTGYEEAAAQGLLAGLNAARHVHGL------
MNMG_XANCP       YDFFDPRGLKASLETKAVGGLFFAGQINGTTGYEEAAAQGLLAGLNAARQAQAL------
MNMG_XANC8       YDFFDPRGLKASLETKAVGGLFFAGQINGTTGYEEAAAQGLLAGLNAARQAQAL------
MNMG_XANCB       YDFFDPRGLKASLETKAVGGLFFAGQINGTTGYEEAAAQGLLAGLNAARHVQAL------
MNMG_XYLFA       YDFFDPRGLKASLETKAIAGLFFAGQINGTTGYEEAAAQGLLAGLNAARHVRGL------
MNMG_XYLFT       YDFFDPRGLKASLETKAIAGLFFAGQINGTTGYEEAAAQGLLAGLNAARHVRGL------
MNMG_COXBU       YDYFDPRDLKPSLETKYVPGLYFAGQINGTTGYEEAAAQGLIAGINAALQIQER------
MNMG_COXBN       YDYFDPRDLKPSLETKYVPGLYFAGQINGTTGYEEAAAQGLIAGINAALQIQER------
MNMG_COXBR       YDYFDPRDLKPSLETKYVPGLYFAGQINGTTGYEEAAAQGLIAGINAALQIQER------
MNMG_LEGPC       YDYFDPRGLTSFLQTKAIPNLFFAGQINGTTGYEEAAAQGIIAGMNAALQIKDQ------
MNMG_LEGPA       YDYFDPRGLTSFLQTKAIPNLFFAGQINGTTGYEEAAAQGIIAGMNAALQIKDQ------
MNMG_LEGPL       YDYFDPRGLTSFLQTKAIPNLFFAGQINGTTGYEEAAAQGIIAGMNAALQIKGQ------
MNMG_LEGPH       YDYFDPRGLTSFLQTKAIPNLFFAGQINGTTGYEEAAAQGIIAGMNAALQIKDQ------
MNMG_NITEU       YDYFDPRTLKKSLETKVIDGLFFAGQINGTTGYEEAAAQGLLAGLNASLKIKEQ------
MNMG_NITEC       YDYFDPRALKRSLETKAIDGLFFAGQINGTTGYEEAAAQGLLAGLNASLKIKEQ------
MNMG_FRATF       YDFFDPRDLKPTLETKHIKNLYFAGQINGTTGYEEAGAQGLVASINAAISIDSD------
MNMG_FRATH       YDFFDPRDLKPTLETKHIKNLYFAGQINGTTGYEEAGAQGLVASINAAISIDSD------
MNMG_FRATO       YDFFDPRDLKPTLETKHIKNLYFAGQINGTTGYEEAGAQGLVASINAAISIDSD------
MNMG_FRATW       YDFFDPRDLKPTLETKHIKNLYFAGQINGTTGYEEAGAQGLVASINAAISIDSD------
MNMG_FRATT       YDFFDPRDLKPTLETKHIKNLYFAGQINGTTGYEEAGAQGLVASINAAISIDSD------
MNMG_FRAT1       YDFFDPRDLKPTLETKHIKNLYFAGQINGTTGYEEAGAQGLVASINAAISIDSD------
MNMG_FRATN       YDFFDPRDLKPTLETKHIKNLYFAGQINGTTGYEEAGAQGLVAGINAAISIDSD------
MNMG_FRAP2       YDFFDPRDLKPTLETKHIKNLFFAGQINGTTGYEEAGAQGLVAGINAAISIDSD------
MNMG_VESOH       YDFFDPRGLKQTLEVKKISGLYFAGQINGTTGYEEAAAQGLLAGVNAACAILEK------
MNMG_RUTMC       YDFFDPRGLKQTLEVKKISGLYFAGQINGTTGYEEAAAQGLLAGVNAACAILER------
MNMG_DICNV       YDFFNPQGLRYTLETKAIKNLFFAGQINGTTGYEEAAAQGLLAGINAALRVYDK------
MNMG_BLOFL       YDFFDPRDLKLTLESKFISGLFLSGQINGTTGYEEAAAQGILAGINAARYVQNK------
MNMG_BLOPB       YDFFDPRDLKLTLESKIISGLFFSGQINGTTGYEEAAAQGLLAGINAARFSKNK------
MNMG_BAUCH       YDFFDPRDLKNTLESKIINGLFFAGQINGTTGYEEAAAQGLIAGINAAKKVLEQ------
MNMG_BUCAI       YDFFDPKDLNLTLESKLIKGLFFAGQINGTTGYEEAASQGLLAGLNAALSSKNT------
MNMG_BUCAP       YDFFDPKDLNLTLESKWIKGLFLAGQINGTTGYEEAASQGLLAGLNAALSAKDC------
MNMG_BUCBP       YDYCDPRTLKLTLESKFIEGFFLAGQINGTTGYEEAAAQGLLAGLNASLYASNK------
MNMG_WIGBR       YDFLDPRDLKLTLESKIISGLFFAGQINGTTGYEEAAAQGLLSGINAALMLKNG------
MNMG_BUCCC       YDYFDPRDLKMTLESKKIKNLFMAGQINGTTGYEEAAAQGLIAGLNAALKIQCK------
MNMG_HALHL       YDYLDPRGLTPWLESATIAGLYLAGQINGTTGYEEAAAQGLIAGLNAARVSAGE------
MNMG_RHIME       YDHVDPRELELSLGVRKMPGLFLAGQINGTTGYEEAGAQGLVAGLNAALRSIGRA-----
MNMG_SINMW       YDHVDPRELEPSLGVRRMPGLFLAGQINGTTGYEEAGAQGLVAGLNAALRAAERA-----
MNMG_RHIEC       YDHVDPRELTPSLEVKRLRGLFLAGQINGTTGYEEAAAQGLAAGLNAALLSSDSE-----
MNMG_RHIL3       YDHVDPRELTPSLEVKRLRGLFLAGQINGTTGYEEAAAQGLAAGLNAALRSSDSD-----
MNMG_AGRFC       YDYVDPRELKPSLECRKIPGLFLAGQINGTTGYEEAGAQGLVAGLNASLYAGSAD-----
MNMG_BARHE       YDFVNPQQLTKTLELRSLPGLFLAGQINGTTGYEEAAAQGLLAGLNAARKVGGLD-----
MNMG_BARQU       YDFVNPQQLTKTLELRSLPGLFLAGQINGTTGYEEAAAQGLLAGLNAARKVGGLN-----
MNMG_BART1       YDFVNPQQLTKSLELRSLPGLFLAGQINGTTGYEEAAAQGLLAGLNAARKVGKLD-----
MNMG_BARBK       YDFINPQYLSKTLELRSLPGLFLAGQINGTTGYEEAAAQGLLAGLNAARQVGGLD-----
MNMG_BRUAB       YDFIDPRELKRSLETRKVCGLFLAGQINGTTGYEEAGAQGLLAGLNAARRAAGSE-----
MNMG_BRUA2       YDFIDPRELKRSLETRKVCGLFLAGQINGTTGYEEAGAQGLLAGLNAARRAAGSE-----
MNMG_BRUC2       YDFIDPRELKRSLETRKVCGLFLAGQINGTTGYEEAGAQGLLAGLNAARRAAGSE-----
MNMG_BRUSU       YDFIDPRELKRSLETRKVCGLFLAGQINGTTGYEEAGAQGLLAGLNAARRAAGSE-----
MNMG_BRUSI       YDFIDPRELKRSLETRKVCGLFLAGQINGTTGYEEAGAQGLLAGLNAARRAAGSE-----
MNMG_BRUME       YDFIDPRELKRSLETRKVCGLFLAGQINGTTGYEEAGAQGLLAGLNAARRAAGSE-----
MNMG_BRUO2       YDFIDPRELKRSLETRKVCGLFLAGQINGTTGYEEAGAQGLLAGLNAARRAAGSE-----
MNMG_BRUA4       YDFIDPRELKRSLETRKVTGLFLAGQINGTTGYEEAGAQGLLAGINAARRASGGD-----
MNMG_RHILO       YDHVDPRELHQTLETKRIAGLFLAGQINGTTGYEEAAGQGLLAGLNAARRAAGGE-----
MNMG_CHESB       YDHVDPRELEPSLETRRVRGLFLAGQINGTTGYEEAAAQGVIAGINAASVASGST-----
MNMG_BRASB       YDHVDPRELEPTLQTKRMRGLFLAGQINGTTGYEEAAAQGLVAGLNAALTAGGGE-----
MNMG_BRASO       YDHVDPRELEPTLQTKRMKGLFLAGQINGTTGYEEAAAQGLVAGINAALAAGGGA-----
MNMG_BRADU       YDHIDPRELDPTLQTKRLRGLFLAGQINGTTGYEEAAGQGIVAGLNAALAASGAA-----
MNMG_NITHX       YDHVDPRELDPTLQTRRLPGLFLAGQINGTTGYEEAAAQGLVAGLNAALAAGGGD-----
MNMG_NITWN       YDHVDPRELEPTLQTRRMRGLFLAGQINGTTGYEEAAAQGLVAGLNAALAAGGGD-----
MNMG_RHOPS       YDHVDPRELEPTLQTKRLRGLFLAGQINGTTGYEEAAAQGLVAGLNAVLAAGGGD-----
MNMG_RHOP2       YDHVDPRELEPTLQTKRLRGLYLAGQINGTTGYEEAAAQGLVAGLNAALAAGGGE-----
MNMG_RHOPA       YDHVDPRELEPTLQTKRLRGLFLAGQINGTTGYEEAAAQGLVAGLNAGLSAGGGD-----
MNMG_RHOP5       YDHVDPRELQPTLQAKRMRGLFLAGQINGTTGYEEAAAQGLVAGLNAARCAGGGE-----
MNMG_RHOPB       YDHVDPRELEPTLQAKRLRGLFLAGQINGTTGYEEAAAQGLVAGLNAALLASGGG-----
MNMG_AZOC5       YDHVDPRELEPTLEAKRAPGLFLAGQINGTTGYEEAAAQGLLAGLNAARRAGGGE-----
MNMG_METPB       YDYVDPRELDATLQTKRLPGLFLAGQINGTTGYEEAAGQGLVAGLNAARLAGASE-----
MNMG_METRJ       YDYVDPRELDLGLQVKRLPGLFLAGQINGTTGYEEAAGQGLVAGLNAARHAGGLG-----
MNMG_METS4       YDYVDPRELDPTLQTRRVAGLFLAGQINGTTGYEEAAGQGILAGINAARLAAGSA-----
MNMG_BEII9       YDYVDPRELTAGLEVKRVPGLFLAGQINGTTGYEEAGAQGLIAGLNAAARAGGLA-----
MNMG_PARL1       YDYIDPRELRPTLETKRLGGLYLAGQINGTTGYEEAAAQGLIAGLNAALAERGAE-----
MNMG_RHORT       YDFVDPRCLGPTLETDRLPGLFLAGQINGTTGYEEAAAQGLIAGLNAARVAGAGERA---
MNMG_MAGSA       YDFVDPRALHRSLETKGVGGLFLAGQINGTTGYEEAAGQGLMAGLNAARRCAGSA-----
MNMG_CAUVC       YDYVDPRELYPTLETKRLPGLYLAGQINGTTGYEEAGAQGLVAGLNAALAVQGRE-----
MNMG_CAUSK       YDYVDPRELYPTLETKRLPGLYLAGQINGTTGYEEAGAQGLMAGLNAALAVQGRE-----
MNMG_MARMM       YDYVDPRELDATLQLRKRAGLWLAGQINGTTGYEEAAAQGLVAGANAALFATGRE-----
MNMG_HYPNA       YDYVDPRALSPALEVKLMPGLYLAGQINGTTGYEEAGAQGLMAGLNAARAASGKD-----
MNMG_GLUOX       YDYVDPRELLPSLQLRRLPGLYLAGQINGTTGYEEAGAQGLLAGLNAARATAGNE-----
MNMG_GLUDA       YDYVDPRALAPTLELTALPRLFLAGQINGTTGYEEAGAQGLLAGLNAARRAGGGE-----
MNMG_GRABC       YDFVDPRSLRPSLELKELPGLFLAGQINGTTGYEEAGAQGLMAGLNAARKAQGLD-----
MNMG_ACICJ       YDYVDPRELTHALALKKVPGLFLAGQINGTTGYEEAGAQGLLAGVNAALVAAGRS-----
MNMG_RUEPO       YDYVDPRALTSQLSLPNVPGLYLAGQINGTTGYEEAAAQGMVAGLNAATAILGHE-----
MNMG_RUEST       YDYVDPRALRSTLELRDVEGLYLAGQINGTTGYEEAAAQGLVAGLNAASHRLKQQ-----
MNMG_ROSDO       YDYVDPRALDSSLSVLSVPGLYLAGQINGTTGYEEAAAQGLVAGLNASLEARGSD-----
MNMG_DINSH       YDYVDPRALDAALRVKGFDGLYLAGQINGTTGYEEAAAQGLVAGLNAALEGKGK------
MNMG_RHOS1       YDYFDPRELRPTLEVKALGGLYFAGQINGTTGYEEAAAQGLAAGLNAALSIRERE-----
MNMG_CERS4       YDYFDPRELRPTLEVKALGGLYFAGQINGTTGYEEAAAQGLAAGLNAALSIRERE-----
MNMG_CERS5       YDYFDPRELRPTLEVKAMCGLYFAGQINGTTGYEEAAAQGLAAGLNAALAVRGRE-----
MNMG_PARDP       YDYVDPRALAASLEVKNLSGLFLAGQINGTTGYEEAAAQGLVAGLNAALKAQGRE-----
MNMG_JANSC       YDYIDPTCLNNRLELQDHPGLFLAGQINGTTGYEEAAAQGLVAGLNAAFHAQDRD-----
MNMG_NOVAD       YDHIDPRALRRSLEVKAIPGLYCAGQINGTTGYEEAAAQGLIAGMHAAAHVLGRA-----
MNMG_ERYLH       YDHIEPRALTSGLRLKDVEGLYCAGQINGTTGYEEAAAQGLIAGLNAACVVLDRE-----
MNMG_SPHAL       YDHIDPRALDRTLQVRAMPGVWCAGQINGTTGYEEAAAQGLVAGANAALAVQGRE-----
MNMG_SPHWW       YDYIDPRALTAGLALRALPGLFCAGQINGTTGYEEAAAQGLAAGMNAAAFAAGRP-----
MNMG_ZYMMO       YEFIDPRSLTHQLELKALKSVFCAGQINGTTGYEEAAAQGLVAGISAACAVAGKA-----
MNMG_ANAMM       YNFVDPRELHHTLETKKIKGLYFAGQINGTTGYEEAAGQGIVAGANAALSLSQNHA----
MNMG_ANAPZ       YNFIDPRELYHTLETKKIKGLFCAGQINGTTGYEEAAGQGIVAGANAALSLVQNQE----
MNMG_EHRCJ       YNFIDPRELYHTLETKKISGLYFAGQINGTTGYEEAAGQGIIAGINAALSLSSNYE----
MNMG_EHRCR       YNFIDPRELYHTLETKKISGLYFAGQINGTTGYEEAAGQGIIAGINAALSLNSKYE----
MNMG_EHRRG       YNFIDPRELYHTLETKKIRGLYCAGQINGTTGYEEAAGQGIIAGINAALSLNSNYE----
MNMG_EHRRW       YNFIDPRELYHTLETKKIRGLYCAGQINGTTGYEEAAGQGIIAGINAALSLNSNYE----
MNMG_WOLPM       YDYIDPRELFHTLETKKIKGLYFAGQINGTTGYEEAAGQGIIAGINAALSASEKKE----
MNMG_WOLTR       YDYIDPRELFHTLETKKVKGLYFAGQINGTTGYEEAAGQGIIAGINAALSASQKKE----
MNMG_NEOSM       YDYIDPRELRSTLESKRVKNLYFAGQINGTTGYEEAAGQGIVAGSNAAGAG---------
MNMG_RICRO       YDYVDPREISVTLETKKIAGLYLAGQINGTTGYEEAAGQGIIAGINAALAVK-DQA----
MNMG_RICRS       YDYVDPREISVTLETKKIAGLYLAGQINGTTGYEEAAGQGIIAGINAALAVK-DQA----
MNMG_RICCN       YDYVDPREISVTLETKKIAGLYLAGQINGTTGYEEAAGQGIIAGINAALAVK-DQA----
MNMG_RICM5       YDYVDPREISVTLETKKIAGLYFAGQINGTTGYEEAAGQGIIAGINAALAVK-DQA----
MNMG_RICFE       YDYVDPREISVTLETKKIAGLYFAGQINGTTGYEEAAGQGIIAGINAALAVK-DQA----
MNMG_RICAH       YDYVDPREISVTLETKKIAGLYFAGQINGTTGYEEAAGQGIIAGINAALAVK-DQA----
MNMG_RICCK       YDYVDPREISITLETKKIMGLYFAGQINGTTGYEEAAGQGIVAGINAALAVK-NQP----
MNMG_RICB8       YDYIDPREISSTLETKKITGLYFAGQINGTTGYEEAAGQGIVAGINAALAVK-NQP----
MNMG_RICBR       YDYIDPREISSTLETKKITGLYFAGQINGTTGYEEAAGQGIVAGINAALAVK-NQP----
MNMG_RICPR       YDYVDPREINVTLETKKITGLYFAGQINGTTGYEEAAGQGIIAGINAALSVK-DQA----
MNMG_RICTY       YDYVDPREINITLETKKITGLYFAGQINGTTGYEEAAGQGIIAGINAALSVK-DQE----
MNMG_ORITB       YDYVDPRQLKHSLEVKSVGGLYLAGQINGTTGYEEAAGQGIMAGINAALAVK-KQD----
MNMG_PELUB       YDYIDPRELFLTLETKKIQNLYLAGQINGTTGYEEAAAQGLIAGINAALSFK-KQE----
MNMG_KORVE       YDSIDPTELQRTLETKKIGSLYLGGQINGTSGYEEAACQGLMAGINAALAVKHEP-----
MNMG_SOLUE       YDAIDPRELNHTLEVKSIPGLYLAGQINGTSGYEEAGIQGLIAGLNAAMSLGGSD-----
MNMG_MAGMM       YDMVMPTELDHTLKTKKYDGLYLAGQINGTTGYEEAAAQGMIAGLNAARFAKKES-----
MNMG_CAMJE       YDYIEPTELKHTLELKKIKNLYCAGQINGTTGYEEAAAQGFMAGINASLSIDMKEP----
MNMG_CAMJJ       YDYIEPTELKHTLELKKIKNLYCAGQINGTTGYEEAAAQGFMAGINASLSIDMKEP----
MNMG_CAMJR       YDYIEPTELKHTLELKKIKNLYCAGQINGTTGYEEAAAQGFMAGINASLSIDMKEP----
MNMG_CAMJ8       YDYIEPTELKHTLELKKIKNLYCAGQINGTTGYEEAAAQGFMAGINASLSIDMKEP----
MNMG_CAMJD       YDYIEPTELKHTLELKKIKNLYCAGQINGTTGYEEAAVQGFMAGINASLSIDMKEP----
MNMG_CAMC1       YDYVEPTQLKHSLETKKVKGLYLAGQINGTTGYEEAGAQGLMAGINAALSLDNKEP----
MNMG_CAMC5       YDYVVPTELKHSLETKKVRGLYLAGQINGTTGYEEAAAQGLMAGINAALNLDAKDP----
MNMG_CAMFF       YDYVSPTELKHTLETKKINGLYLAGQINGTTGYEEAAAQGLMAGINAALNLKTREP----
MNMG_CAMHC       YDFVEPTELKHSLETKKINGLYLAGQINGTTGYEEAAAQGLIAGINAALDIQNKAP----
MNMG_NITSB       YDFVDPTQLKHTLETKSIKNLYCAGQINGTTGYEEAAAQGLMAGINAALAIKEQEP----
MNMG_SULDN       YDFVDPRELKHTLETKKIKGLYLAGQINGTTGYEEAAAQGLMAGINASLSLQGKEP----
MNMG_ARCB4       YDYVDPTELKHTLETKKIKNLYHAGQINATTGYEEAAAQGLIAGINACLSIDEKEP----
MNMG_SULNB       YDYVDPTELKHTLETKKIKGLYTAGQINGTTGYEEAAAQGLMAGINAALSIQGKEA----
MNMG_HELPY       YDFIQPTELTHTLETKKIKGLYLAGQINGTTGYEEAAAQGLMAGINAVLALKNQAP----
MNMG_HELPH       YDFIQPTELTHTLETKKIKGLYLAGQINGTTGYEEAAAQGLMAGINAVLALKNQAP----
MNMG_HELPJ       YDFIQPTELTHALETKKIKGLYLAGQINGTTGYEEAAAQGLMAGINAVLALKNQAP----
MNMG_HELAH       YDFIQPTELTHTLETKKIKGLYLAGQINGTTGYEEAAAQGLMAGINAVLALKNQAP----
MNMG_HELHP       YDYVEPTELYHTLETKKCANLFLAGQINGTTGYEEAAAQGIMAGINATLSLQNKS-----
MNMG_WOLSU       YDYVNPVELKHTLETKKIKNLYLAGQINGTTGYEEAGAQGLAAGINAALSVKGEEP----
MNMG_LEPIN       YDYVDPTELKPTLETKKIKGLYHAGQINGTTGYEEAAAQGLVAAYSVLHSLRNLTP----
MNMG_LEPIC       YDYVDPTELKPTLETKKIKGLYHAGQINGTTGYEEAAAQGLVAAYSVLHSLRNLTP----
MNMG_LEPBJ       YDYVDPTELKPTLETKKIKGLYHAGQINGTTGYEEAAAQGLVAAYSVLHSLKNLDP----
MNMG_LEPBL       YDYVDPTELKPTLETKKIKGLYHAGQINGTTGYEEAAAQGLVAAYSVLHSLKNLDP----
MNMG_LEPBA       YDYVDPTELHPTLETKKVKGLYHAGQINGTTGYEEAAAQGLVAAYNVIRSVRKEEP----
MNMG_LEPBP       YDYVDPTELHPTLETKKVKGLYHAGQINGTTGYEEAAAQGLVAAYNVIRSVRKEEP----
MNMG_GEOMG       YDYVDPIQLHASLETKLVRNLYHAGQINGTSGYEEAAGQGLMAGINAALRVRDKE-----
MNMG_GEOSL       YDYVDPIQLHTSLETKLIRNLYHAGQINGTSGYEEAAGQGLMAGINAALRVQGEE-----
MNMG_GEOUR       YDYVDPIQLHASLETKVVGNLYHAGQINGTSGYEEAAAQGLIAGINAALRVQGKE-----
MNMG_PELPD       YDYVDPIQLHTSLETKAITNLYHAGQINGTSGYEEAAGQGIVAGINAALRTRGEE-----
MNMG_PELCD       YDFVDPIQLKPSLETKKIRNLFLAGQINGTSGYEEAAAQGLMAGINAVHALRDCP-----
MNMG_DESPS       YDYIDPLGLRPSLATKKIENLYLAGQINGTSGYEEAAAQGLMAGINATRYLEERE-----
MNMG_DESVH       YDYADPVQLRSTLETKALRGLWLAGQINGTSGYEEAAAQGLWAALNVSCTLRSMP-----
MNMG_DESVV       YDYADPVQLRSTLETKALRGLWLAGQINGTSGYEEAAAQGLWAALNVSCTLRSMP-----
MNMG_DESAG       YDYANPTQLKPTLETKVLPGLWMAGQVNGTSGYEEAAAQGLWAALNIFCGLRGLP-----
MNMG_LAWIP       YDYVDPMQLHPTLETKVLPGLWLAGQINGTSGYEEAAGQGLWAALNVFCKITRQE-----
MNMG_SYNFM       YDFVQPTQLKATLGSKLVEGLYMAGQINGTSGYEEAAGQGLWAGINAALKAQGRP-----
MNMG_SYNAS       YDFVQPTQLNHTLETKRVRGLYLAGQINGTSGYEEAAAQGMWAGINAALAVQGRP-----
MNMG_CHLTE       YDFFHPWQIRSTMETRPVENLFFAGQINGTSGYEEAAAQGLMAGINAVRKILGKE-----
MNMG_CHLCH       YDYFYPHQIQATLETRLIENLYFAGQINGTSGYEEAAAQGLMAGINAVLKMRKHE-----
MNMG_CHLPM       YDYFHPSQIRRSLETKAVENLYFAGQINGTSGYEEAAAQGLMAGINASRKLKELP-----
MNMG_CHLL3       YDYFPPYQIHSTLETKRIRNLYFAGQINGTSGYEEAAAQGLLAGINAAADILKRP-----
MNMG_CHLPD       YDFFFPYQIKNTLETKIIENLYFAGQINGTSGYEEAAAQGLMAGINASLKIQNRK-----
MNMG_BACFR       YDYFDPTQLKHTLESKKIKNLFFAGQVNGTTGYEEAGGQGIIAGINAHINCHGGE-----
MNMG_BACFN       YDYFDPTQLKHTLESKKIKNLFFAGQVNGTTGYEEAGGQGIIAGINAHINCHGGE-----
MNMG_BACTN       YDYFDPTQLKHSLESKIIKNLFFAGQVNGTTGYEEAGGQGLIAGINAHINCHGGE-----
MNMG_PHOV8       YDYFDPTQLKHTLESKIIKNLFLAGQVNGTTGYEEAGGQGIIAGINAHINCHGGE-----
MNMG_PARD8       YDFFDPTQLRHNLETKQIRNLFFAGQINGTTGYEEAGGQGLVAGINAHINCHGGQ-----
MNMG_PORGI       YDFFDPTQLRHTLETKPVKGLFFAGQINGTTGYEEAAGQGLIAGINAHLHCHGAG-----
MNMG_FLAJ1       YDYFPPTQLKHTLETKLVEGLYFAGQINGTTGYEEAASQGLMAGINAHLKVHEKA-----
MNMG_FLAPJ       YDYFPPTQLKHTLETKLISGLYFAGQINGTTGYEEAASQGLMAGINAALKVKEKE-----
MNMG_GRAFK       YDYFPPTQLKHTLETKLVEGLYFAGQINGTTGYEEAACQGMMAGINAALKVQEKD-----
MNMG_CYTH3       YDFFPPTQLQLSLETRLVKNLFFAGQINGTTGYEEAACQGLMAGINAHKAAKDHE-----
MNMG_SULMW       YDYFPPTQLKNNLETKLIENLFFAGQINGTTGYEEAAAQGLIAGINANLKINEKD-----
MNMG_SALRD       YDFFPPYQIEYSLETKYVDGLFFAGQINGTTGYEEAAAQGIMAGINAVQKLRQAD-----
MNMG_BORAP       YDYINPIELYPSLESKRVKGLFIAGQTNGSSGYEEAAAQGLMAGINAALRLQNKK-----
MNMG_BORBP       YDYINPIELYPNLESKRVKGLFVAGQTNGSSGYEEAAAQGLMAGINAALRLQNKK-----
MNMG_BORBU       YDYINPIELYPNLESKRVKGLFIAGQTNGSSGYEEAAAQGLMAGINAALRLQNKK-----
MNMG_TREDE       YAYVSPIQLSSDLQTRRIEGLFLAGQINGTSGYEEAGGQGIIAGINAALFSRSLKFKDEK
MNMG_TREPA       YAVLFPVQLGIDLQTKRVSGLFSAGQINGTSGYEEAGGQGIIAGINAALYARSTKTKEE-
MNMG1_FUSNN      YDYAPASQLYPSLENKKISGLFFAGQINGTSGYEEAAAQGFIAGVNAAKKIKGEK-----
MNMG2_FUSNN      YDYVPPEEIKYTLESRTVENLFLAGQINGTSGYEEAGAQGLMAGINAVRKLRNEE-----
MNMG_ENDTX       YDYSSPLQIKKTLETKTVKNLFLGGQINGTTGYEEAAAQGFVAGVNAGLKVLGKT-----
MNMG_ONYPE       YDAFNPNQLKHSLETKKIQNLFLAGQMNGTSGYEEAACQGLMAGINASLKLQNKP-----
MNMG_AYWBP       YDAFNPNQLKHSLETKKIQNLFLAGQMNGTSGYEEAACQGLMAGINASLKLQNKP-----
MNMG_ACHLI       YDAINPRQLYQSLETKVIHNLFCAGQINGTSGYEEAAGQGLMAGINAGLKVQGKK-----
MNMG_MYCCT       YDCIDPMQLSPSLELKDVRNLFTAGQINGTSGYEEAAGQGLIAGINASRKIDGLD-----
MNMG_MYCMS       YDCIDPMQLSPSLELKDVKNLFTAGQINGTSGYEEAAGQGLIAGINASRKIDGLD-----
MNMG_MESFL       YDCVNPMQLNPSLEIKNINNLFTAGQINGTSGYEEAAGQGLIAGINASRKIDGLD-----
MNMG_MYCGE       YDAFLSNQLKPTLETKLIENLYFAGQINGTSGYEEAAGQGLMAGINAALKLLKKP-----
MNMG_MYCPN       YDAFSSIQLKSTLETKLIQNLYFAGQINGTSGYEEAAGQGLIAGINAALKLQRKP-----
MNMG_MYCGA       YDAINPIQLYPSLESKLIKNLFFAGQINGTSGYEEAAGQGLIAGINANQKIKNKE-----
MNMG_UREPA       YDAIDPTQLYPSLESKLVNNLFFAGQINGTSGYEEAAAQGLMAAINVNQKYQNKE-----
MNMG_UREP2       YDAIDPTQLYPSLESKLVNNLFFAGQINGTSGYEEAAAQGLMAAINVNQKYQNKE-----
MNMG_MYCPE       YDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENRE-----
MNMG_MYCH7       YDALNPLELKKSLETKKVKGLFMAGQINGTSGYEEAAAQGLVAGINAGQFVLGKK-----
MNMG_MYCHJ       YDALNPLELKKSLETKKVKGLFMAGQINGTSGYEEAAAQGLVAGINAGQFVLGKK-----
MNMG_MYCH2       YDALNPLELKKSLETKRVKGLFMAGQINGTSGYEEAAAQGLVAGINAGQFVLGKK-----
MNMG_MYCPU       YDAINPLQLKKSLESKKIKGLFLAGQINGTSGYEEAAAQGLIAGINAGLKFKGED-----
MNMG_MYCS5       YDALNSLDLKHSLETKVIKNFFAAGQINGTSGYEEAAAQGLIAGINAALKLKNKK-----
MNMG_MYCMO       YDAIDPLQLKKSLESKEIENLFFAGQINGTSGYEEAAGQGLLAGINASLKLENRE-----
MNMG_MYCAP       YDALDPLQLKESLETKLVHNLFTAGQINGTSGYEEAAAQGLIAGINAALKLEDKD-----
MNMG_THEM4       YDYIDPLQLYQTLESKLIEGLYFAGQINGTSGYEEAAGQGLVAGINAAMKILGEK-----
MNMG_FERNB       YDYIDPTQLYPTLESKIIENLYFAGQINGTSGYEEAAAQGLIAGINAGLKLRGEK-----
MNMG_THEMA       YDYIDPRQLYPTLESKLVENLYFAGQVNGTSGYEEAAGQGIIAGINAALKLRGEP-----
MNMG_THESQ       YDYIDPRQLYPTLESKLVENLYFAGQVNGTSGYEEAAGQGIIAGINAALKLRGEP-----
MNMG_THEP1       YDYIDPRQLYPTLESKLVENLYFAGQVNGTSGYEEAAGQGIIAGINAALKLRGES-----
MNMG_PETMO       YDFVNPIQLKHNLETKKIEGLFLAGQINGTSGYEEAAGQGLLAGINAALKIRGEE-----
MNMG_BDEBA       YDYIEPTQIWHRLETRTIRQLFLAGQINGTSGYEEAAAQGLIAGINAAHSILGRE-----
MNMG_ALKMQ       YDCIDPTQLKPTLEVKHIENLFSGGQFNGTSGYEEAAAQGLMAGINAVLKTKGEE-----
MNMG_ALKOO       YDCIDPTQLKASLEVKHINNLFSAGQFNGSSGYEEAAAQGLMAGINAVLKIRGED-----
MNMG_CLOD6       YDCVDPTQLKISLEIKGVENLFSAGQFNGTSGYEEAAAQGLMAGINAVRKIEGKE-----
MNMG_FINM2       YDCIDPTILKRTLEHLEINNLFFAGQINGSSGYEEAAGQGIIAGINAAMNLLGKE-----
MNMG_CALS8       YDCINPLQLEATLQFKKIKGLFSAGQINGTSGYEEAAAQGIIAGINAAMYVKGKE-----
MNMG_ACET2       YDCINPTQLKLSLELRDVEGLFTAGQINGTSGYEEAAAQGIIAGINAARKIKGLE-----
MNMG1_CALS4      YDCIDPTQLKATLESKWIEGLYFAGQVNGTSGYEEAAAQGLMAGINAAMKILNKP-----
MNMG2_CALS4      YDCIDPTQLKATLETKLVEGLYFAGQVNGTSGYEEAAAQGLMAGINAALKILGKP-----
MNMG_THEP3       YDCIDPTQLKATLESKKIEGLYFAGQVNGTSGYEEAAAQGLMAGINAAMKLLNKP-----
MNMG_THEPX       YDCIDPTQLKATLESKKIEGLYFAGQVNGTSGYEEAAAQGLMAGINAAMKLLNKP-----
MNMG_CLOB1       YDCIDPQQLDLTLEFKNINGLYGAGQFNGSSGYEEAAAQGLIAGINAVLKIKEKN-----
MNMG_CLOBH       YDCIDPQQLDLTLEFKNINGLYGAGQFNGSSGYEEAAAQGLIAGINAVLKIKEKN-----
MNMG_CLOBL       YDCIDPQQLDLTLEFKNINGLYGAGQFNGSSGYEEAAAQGLIAGINAVLKIKEKN-----
MNMG_CLOBK       YDCIDPQQLDLTLEFKNINGLYGAGQFNGSSGYEEAAAQGLIAGINAVLKIKEKN-----
MNMG_CLOBM       YDCIDPQQLDLTLEFKNINGLYGAGQFNGSSGYEEAAAQGLVAGINAVLKIKGKD-----
MNMG_CLONN       YDCIDPTQLELSLEFKDIDGLFSAGQMNGSSGYEEAGCQGLIAGINAALKLQGKE-----
MNMG_CLOAB       YDCIDPTQLKLSLEFKDVKGLFGAGQFNGSSGYEEAASQGIIAGINAALMVKNKE-----
MNMG_CLOTE       YDCIDPQELKLSLESKNIEGLFSGGQINGSSGYEEAAAQGLIAGINAAMKVKEKD-----
MNMG_CLOK5       YDCINPLQLRPTLEFKKVEGLFGAGQLNGSSGYEEAASQGIIAGINAALKVKGKE-----
MNMG_CLOP1       YDCIDPTQLKASLEFKNIDGFFSAGQINGSSGYEEAGAQGIVAGINAALKVQGKD-----
MNMG_CLOPS       YDCIDPTQLKASLEFKNIDGFFSAGQINGSSGYEEAGAQGIVAGINAALKVQGKD-----
MNMG_CLOPE       YDCIDPTQLKASLEFKNIDGFFSAGQINGSSGYEEAGAQGIVAGINAALKVQGKD-----
MNMG_CLOB8       YDSIDPTQLKPTLEFKDIEGLYGAGQLNGSSGYEEAGAQGLIAGINAALKIKEKE-----
MNMG_LACP7       YDCINPMQLKSSLEFMSINGLFSGGQFNGSSGYEEAAAQGLMAGINAARKLSGKE-----
MNMG_NATTJ       YDCIDPTQLELTLEHKQISGLFFAGQINGTSGYEEAAGQGILAGINAAQKIQGKE-----
MNMG_BACVZ       YDAIVPTQLWPTLETKKIPNLYTAGQINGTSGYEEAAGQGIMAGINAGRKALGKE-----
MNMG_BACSU       YDAIVPTQLWPTLETKKITNLYTAGQINGTSGYEEAAGQGIMAGINAGRKALGKE-----
MNMG_BACLD       YDAIVPTQLWPTLETKKIPGLFTAGQINGTSGYEEAAGQGIMAGINAGRKALGKE-----
MNMG_BACP2       YDAIVPTQLWPTLETKKISGLYTAGQINGTSGYEEAAGQGIMAGINAGRKALGKE-----
MNMG_BACAH       YDAIVPTQLWPTLETKKIKNLYTAGQINGTSGYEEAAGQGLMAGINAACRSLGKK-----
MNMG_BACHK       YDAIVPTQLWPTLETKKIKNLYTAGQINGTSGYEEAAGQGLMAGINAACRSLGKK-----
MNMG_BACAN       YDAIVPTQLWPTLETKKIKNLYTAGQINGTSGYEEAAGQGLMAGINAACRSLGKK-----
MNMG_BACCZ       YDAIVPTQLWPTLETKKIKNLYTAGQINGTSGYEEAAGQGLMAGINAACRSLGKK-----
MNMG_BACC1       YDAIVPTQLWPTLETKKIKNLYTAGQINGTSGYEEAAGQGLMAGINAACRSLGKK-----
MNMG_BACCR       YDAIVPTQLWPTLETKKIKNLYTAGQINGTSGYEEAAGQGLMAGINAACRSLGKK-----
MNMG_BACMK       YDAIVPTQLWPTLETKKIKNLYTAGQINGTSGYEEAAGQGLMAGINAACRSLGKK-----
MNMG_BACCN       YDAIVPTQLWPTLETKKIKNLYTAGQINGTSGYEEAAGQGIMAGINAACRSLGKK-----
MNMG_GEOKA       YDAIVPTQLWPTLETKLVKNLYTAGQINGTSGYEEAAGQGIMAGINAAHRALGRE-----
MNMG_GEOTN       YDAIVPTQLWPTLETKLVKNLYTAGQINGTSGYEEAAGQGIMAGINAAHRALGRE-----
MNMG_LYSSC       YDSIVPTQLWPTLETKRIKGLYTAGQINGTSGYEEAAAQGLMAGMNAAANVLGKE-----
MNMG_STAA2       YDAIVPTQLWPTLETKMIKNLYTAGQINGTSGYEEAAGQGLMAGINAAGKVLNTG-----
MNMG_STAA9       YDAIVPTQLWPTLETKMIKNLYTAGQINGTSGYEEAAGQGLMAGINAAGKVLNTG-----
MNMG_STAAR       YDAIVPTQLWPTLETKMIKNLYTAGQINGTSGYEEAAGQGLMAGINAAGKVLNTG-----
MNMG_STAAS       YDAIVPTQLWPTLETKMIKNLYTAGQINGTSGYEEAAGQGLMAGINAAGKVLNTG-----
MNMG_STAA1       YDAIVPTQLWPTLETKMIKNLYTAGQINGTSGYEEAAGQGLMAGINAAGKVLNTG-----
MNMG_STAAM       YDAIVPTQLWPTLETKMIKNLYTAGQINGTSGYEEAAGQGLMAGINAAGKVLNTG-----
MNMG_STAAW       YDAIVPTQLWPTLETKMIKNLYTAGQINGTSGYEEAAGQGLMAGINAAGKVLNTG-----
MNMG_STAAN       YDAIVPTQLWPTLETKMIKNLYTAGQINGTSGYEEAAGQGLMAGINAAGKVLNTG-----
MNMG_STAAB       YDAIVPTQLWPTLETKMIKNLYTAGQINGTSGYEEAAGQGLMAGINAAGKVLNTG-----
MNMG_STAA8       YDAIVPTQLWPTLETKMIKNLYTAGQINGTSGYEEAAGQGLMAGINAAGKVLNTG-----
MNMG_STAA3       YDAIVPTQLWPTLETKMIKNLYTAGQINGTSGYEEAAGQGLMAGINAAGKVLNTG-----
MNMG_STAAC       YDAIVPTQLWPTLETKMIKNLYTAGQINGTSGYEEAAGQGLMAGINAAGKVLNTG-----
MNMG_STAAE       YDAIVPTQLWPTLETKMIKNLYTAGQINGTSGYEEAAGQGLMAGINAAGKVLNTG-----
MNMG_STAAT       YDAIVPTQLWPTLETKMIKNLYTAGQINGTSGYEEAAGQGLMAGINAAGKVLNTG-----
MNMG_STAES       YDAIVPTQLWPTLETKAIKNLYTAGQINGTSGYEEAAGQGIMAGINAAGNVLGTG-----
MNMG_STAEQ       YDAIVPTQLWPTLETKAIKNLYTAGQINGTSGYEEAAGQGIMAGINAAGNVLGTG-----
MNMG_STAHJ       YDAIVPTQLWPTLETKMIKNLYTAGQINGTSGYEEAAGQGIMAGINAAGKVLGTG-----
MNMG_STAS1       YDALVPTQLWPTLETKKIKNLYTAGQINGTSGYEEAAGQGIMAGINAAARVQGKD-----
MNMG_LISMO       YDAVMPDQLWPSLETKLVEGLFTAGQINGTSGYEEAAGQGLMAGINAARKVFEKE-----
MNMG_LISMF       YDAVMPDQLWPSLETKLVEGLFTAGQINGTSGYEEAAGQGLMAGINAARKVFAKE-----
MNMG_LISIN       YDAVMPDQLWPSLETKLVEGLFTAGQINGTSGYEEAAGQGLMAGINAARKVFEKE-----
MNMG_LISW6       YDAVMPDQLWPSLETKLVEGLFTAGQINGTSGYEEAAGQGLMAGINAARKVFDKE-----
MNMG_OCEIH       YDAVVPTQLWPTLETKRLPGLFTAGQINGTSGYEEAAGQGLMAGMNAAAKSLNKE-----
MNMG_BACSK       YDAIVPTQLWPTLETKKISGLFTAGQINGTSGYEEAAGQGIMAGINAAQKAFGKE-----
MNMG_ALKHC       YDAIVPTQLWPTLETKKVPGLFTAGQINGTSGYEEAAGQGIMAGINAALRVQGKD-----
MNMG_EXIS2       YDAVVPTQLWPTLETKRIAGLFTAGQINGTSGYEEAAGQGIMAGINAALKVQERD-----
MNMG_LEVBA       YDVVSPYQLRPTLETKPLKNLFTAGQTNGTSGYEEAAGQGLLAGINAGLRALGKP-----
MNMG_LACPL       YDVVAPYQLKATLETKLVKNLYTAGQTNGTSGYEEAAGQGLIAGINAGLRALDRG-----
MNMG_PEDPA       YDVVAPYQLKNTLETKLVKNLYTAGQTNGTSGYEEAAGQGLIAGINAGRRALGKE-----
MNMG_LACS1       YDVVSPYQLRPTLETKLIKGLYTAGQTNGTSGYEEAAGQGFIAGVNAGRRAKGLE-----
MNMG_ENTFA       YDVVVPHQLRPTLETKVIENLYTAGQTNGTSGYEEAAGQGLMAGINAALKIQGKE-----
MNMG_LACSS       YDVVEPWQLKPTLETKVVENLYTAGQMNGTSGYEEAAGQGLMAGINAALKQTGRD-----
MNMG_LACP3       YDVIEPWQLKATLETKVVDNLFTAGQMNGTSGYEEAAGQGIMAGINAALRAQGKG-----
MNMG_LACAC       YDVVEPWQLKHTLETKNVKHLFTAGQMNGTSGYEEAAGQGLIAGINAALSAQGKS-----
MNMG_LACH4       YDVVEPWQLKHTLETKNIKHLFTAGQMNGTSGYEEAAGQGLIAGINAALSAQDKP-----
MNMG_LACJO       YDVIEPWQLKHTLETKNIKHLFTAGQMNGTSGYEEAAGQGLIAGINAALSAQNKP-----
MNMG_LACGA       YDVIEPWQLKHTLETKNIKHLFTAGQMNGTSGYEEAAGQGLIAGINAALSAQNKP-----
MNMG_LACDA       YDVVDPWQLTHTLETKRIKHLYMAGQMNGTSGYEEAAGQGLIAGINAALSAEGKP-----
MNMG_LACDB       YDVVDPWQLTHTLETKRIKHLYTAGQMNGTSGYEEAAGQGLIAGINAALSAEGKP-----
MNMG_LACLM       YDVVMPHQLRPTLETKLISGLFTAGQTNGTSGYEEAAGQGLVAGINAALKIQGKP-----
MNMG_LACLS       YDVVMPHQLRPTLETKLISGLFTAGQTNGTSGYEEAAGQGLVAGINAALKIQGKP-----
MNMG_LACLA       YDVVMPHQLRPTLETKLVSGLFTAGQTNGTSGYEEAAGQGLVAGINAALKVQGKS-----
MNMG_STRA3       YDIVLPHQLRATLETKVIAGLFTAGQTNGTSGYEEAAGQGLVAGINAALKVQGKP-----
MNMG_STRA5       YDIVLPHQLRATLETKVIAGLFTAGQTNGTSGYEEAAGQGLVAGINAALKVQGKP-----
MNMG_STRA1       YDIVLPHQLRATLETKVIAGLFTAGQTNGTSGYEEAAGQGLVAGINAALKVQGKP-----
MNMG_STRP1       YDIVLPHQLRATLETKLISGLFTAGQTNGTSGYEEAAGQGLIAGINAALKVQGKP-----
MNMG_STRPD       YDIVLPHQLRATLETKLISGLFTAGQTNGTSGYEEAAGQGLIAGINAALKVQGKP-----
MNMG_STRPB       YDIVLPHQLRATLETKLISGLFTAGQTNGTSGYEEAAGQGLIAGINAALKVQGKP-----
MNMG_STRPC       YDIVLPHQLRATLETKLISGLFTAGQTNGTSGYEEAAGQGLIAGINAALKVQGKP-----
MNMG_STRPG       YDIVLPHQLRATLETKLISGLFTAGQTNGTSGYEEAAGQGLIAGINAALKVQGKP-----
MNMG_STRP8       YDIVLPHQLRATLETKLISGLFTAGQTNGTSGYEEAAGQGLIAGINAALKVQGKP-----
MNMG_STRPF       YDIVLPHQLRATLETKLISGLFTAGQTNGTSGYEEAAGQGLIAGINAALKVQGKP-----
MNMG_STRPM       YDIVLPHQLRATLETKLISGLFTAGQTNGTSGYEEAAGQGLIAGINAALKVQGKP-----
MNMG_STRP3       YDIVLPHQLRATLETKLISGLFTAGQTNGTSGYEEAAGQGLIAGINAALKVQGKS-----
MNMG_STRP6       YDIVLPHQLRATLETKLISGLFTAGQTNGTSGYEEAAGQGLIAGINAALKVQGKS-----
MNMG_STRT2       YDIVLPHQLRATLETKLISGLFTAGQTNGTSGYEEAAGQGLVAGINAALKVQGKP-----
MNMG_STRT1       YDIVLPHQLRATLETKLISGLFTAGQTNGTSGYEEAAGQGLVAGINAALKVQGKP-----
MNMG_STRTD       YDIVLPHQLRATLETKLISGLFTAGQTNGTSGYEEAAGQGLVAGINAALKVQGKP-----
MNMG_STRMU       YDIVLPHQLRATLETKKISGLFTAGQTNGTSGYEEAAGQGIVAGINAALKIQGKP-----
MNMG_STRGC       YDMIMPHQLRATLETKKISGLFTAGQTNGTSGYEEAAGQGIIAGINAALKIQGRP-----
MNMG_STRSV       YDMIMPHQLRATLETKKISGLFTAGQTNGTSGYEEAAGQGIIAGINAALKIQGKQ-----
MNMG_STRR6       YDMVLPHQLRATLETKKISGLFTAGQTNGTSGYEEAAGQGIIAGINAALKIQGKP-----
MNMG_STRP2       YDMVLPHQLRATLETKKISGLFTAGQTNGTSGYEEAAGQGIIAGINAALKIQGKP-----
MNMG_STRPN       YDMVLPHQLRATLETKKISGLFTAGQTNGTSGYEEAAGQGIIAGINAALKIQGKP-----
MNMG_STRPI       YDMVLPHQLRATLETKKISGLFTAGQTNGTSGYEEAAGQGIIAGINAALKIQGKP-----
MNMG_STRSY       YDMVMPHQLRATLETKKISGLFTAGQTNGTSGYEEAAGQGIVAGINAALKVQGKP-----
MNMG_STRS2       YDMVMPHQLRATLETKKISGLFTAGQTNGTSGYEEAAGQGIVAGINAALKVQGKP-----
MNMG_DESRM       YDYIVPTQLRTTLETKEIIGLYAAGQINGTSGYEEAAAQGIMAGINAALQVQEKD-----
MNMG_PELTS       YDYVVATQLKPSLETKAIPGLFTAGQINGTSGYEEAAAQGIMAGINAALYVKNRE-----
MNMG_CARHZ       YDYIDPTQLKLTLEAKHIQGLFFAGQINGTSGYEEAAGQGIVAGINAALYVKEKE-----
MNMG_MOOTA       YDYIDPTQLKASLECKHIAGLFTAGQINGTSGYEEAAAQGLVAGINAARLVREQE-----
MNMG_HELMI       YDYVDPTQLRLSLEHQEIGGLFTAGQINGTSGYEEAAAQGLMAGINAARFVKGEE-----
MNMG_SYNWW       YDIIYPSQLKLSLECKTVEGLFTAGQINGTSGYEEAAAQGLIAGINAALQVKEKE-----
MNMG_DESAP       YDYVVPTQLAPTLETKAVSGLFLAGQINGTSGYEEAAAQGIVAGINAAQSVKNGE-----
MNMG_SYMTH       YDYIVSTQLKPSLETKLVRGLFCGGQINGTSGYEEAAAQGLIAGINAACYVEGRE-----
MNMG_DESHY       YDYVKPYQLSLSLEVRRIPGLFTAGQLNGTSGYEEAAAQGLLAGINAALRVQGKE-----
MNMG_ROSCS       YDALATGEIAADMSSRRIPGLFFAGQINGTTGYEEAAAQGLMAGINAARFIQGKP-----
MNMG_ROSS1       YDALATGEIAADMSSRRAPGLFFAGQINGTTGYEEAAAQGLMAGINAARFVQGKP-----
MNMG_CHLAA       YDAVATGEITADMQTRRLRGLFFAGQINGTTGYEEAAAQGLMAGINAAHYVQGKP-----
MNMG_DEIRA       YDVVDSTELTLNLESKKLPGLFTAGQLNGTSGYEEAAAQGLVAGTAAARRSLGLD-----
MNMG_DEIGD       YDVVDSTELTLNLESRLLPGIFTAGQINGTSGYEEAAAQGLVAGTAAARRALELE-----
MNMG_THET2       YDSLDPTELTRGLQSRFLPGLFSAGQVNGTSGYEEAAAQGLLAGLNAARFALGLP-----
MNMG_THET8       YDSLDPTELTRGLQSRLLPGLFSAGQVNGTSGYEEAAAQGLLAGLNAARFALGLP-----
MNMG_MYXXD       YDYAPPTQLKATLETKAIAGLYFAGQLNGTSGYEEAAFQGLWAGINAALQLKGEP-----
                 *                   .:  *: *.::*****. **.  .                

MNMG_NOSS1       ---MIVFPREHSYLGTLVDDLCTKDLR-EPYRMLTSRSEYRLLLRSDNADQRLTPLGREI
MNMG_TRIV2       ---MIVFPREQSYLGTLVDDLCTKDLR-EPYRMLTSRSEYRLLLRSDNSDQRLTPLGREI
MNMG_TRIEI       ---MIIFPREQSYIGTLIDDLCTKDLR-EPYRMLTSRSEYRLILRSDNADQRLTPLGREI
MNMG_SYNY3       ---LIIFSREGSYLGTLIDDLCTKDLR-EPYRMLTSRSEYRLILRSDNADQRLTPLGREI
MNMG_SYNP2       ---MVVFPREQSYLGTLIDDLCTKDLR-EPYRMLTSRSEYRLILRSDNADQRLTPLGREI
MNMG_MICAN       ---LIVFPREESYLGTLVDDLCTKDLR-EPYRMLTSRSEYRLVLRSDNADQRLTPLGREI
MNMG_ACAM1       ---MLIFPRAESYIGTLIDDLCTKDLR-EPYRMLTGRSEYRLLLRSDNADQRLTPLGREV
MNMG_SYNP6       ---AIVFPREGSYIGTLIDDLCTKDLR-EPYRVLTSRSEYRLLLRADNADQRMTPLGREI
MNMG_SYNE7       ---AIVFPREGSYIGTLIDDLCTKDLR-EPYRVLTSRSEYRLLLRADNADQRMTPLGREI
MNMG_THEEB       ---MITFPRQESYIGTLIDDLCTKELR-EPYRMLTSRSEYRLVLRSDNADQRLTPLGYEI
MNMG_SYNJB       ---LVTLPRESSYIGTLIDDLCTKELR-EPYRMLTSRSEYRLILRSDNADQRLTPLGREW
MNMG_SYNJA       ---LVTLPRESSYIGTLIDDLCTKELR-EPYRMLTSRSEYRLILRADNADQRLTPLGREW
MNMG_PROM1       ---GIIFERESSYIGTMIDDLVTKDLK-EPYRVLTSRSEYRLILRGDNADRRLTPLGYQL
MNMG_PROMT       ---GIIFERESSYIGTMIDDLVTKDLK-EPYRVLTSRSEYRLILRGDNADRRLTPLGYQL
MNMG_PROMA       ---AIIFPREESYIGTMIDDLIKKDLR-EPYRVLTSRSEYRLILRGDNADRRLTPLGYKV
MNMG_PROM3       ---QVHFPREGSYIGTMIDDLVSKDLH-EPYRVLTSRSEYRLILRGDNADRRLTPLGYQL
MNMG_PROMM       ---QVQFPREGSYIGTMIDDLVSKDLH-EPYRVLTSRSEYRLILRGDNADRRLTPLGYQL
MNMG_SYNSC       ---PVHFPREGSYIGTMIDDLVSKDLR-EPYRVLTSRSEYRLILRGDNADRRLTPLGHEL
MNMG_SYNPX       ---PVHFPREGSYIGTMIDDLVSKDLR-EPYRVLTSRSEYRLILRGDNADRRLTPLGRDL
MNMG_SYNS9       ---PVYFPREGSYIGTMIDDLVSQDLR-EPYRVLTSRSEYRLILRGDNADRRLTPLGRDL
MNMG_SYNPW       ---AVHFPREGSYIGTMIDDLVSKDLR-EPYRVLTSRSEYRLVLRGDNADRRLTPLGREL
MNMG_SYNS3       ---PVHFPRENSYIGTMIDDLVSQDLR-EPYRVLTSRSEYRLVLRGDNADRRLTPLGREL
MNMG_SYNR3       ---PVHFPREGSYIGTLIDDLVTKDLR-EPYRVLTSRSEYRLVLRGDNADRRLTPLAREL
MNMG_PROMS       ---PIIFSRESSYIGTMINDLITKDLK-EPYRVLTSRSEYRLTLRGDNADRRLTPLGYQI
MNMG_PROM0       ---PIIFTRESSYIGTMINDLITKDLK-EPYRVLTSRSEYRLTLRGDNADRRLTQLGYQI
MNMG_PROM9       ---PIIFTRESSYIGTMINDLITKDLK-EPYRVLTSRSEYRLTLRGDNADRRLTPLGYQI
MNMG_PROM2       ---PIIFTRESSYIGTMINDLITKDLK-EPYRVLTSRSEYRLTLRGDNADRRLTPLGYQI
MNMG_PROM5       ---PIIFSRESSYIGTMINDLITRDLK-EPYRVLTSRSEYRLTLRGDNADRRLTPLGFEI
MNMG_PROMP       ---PIIFSRESSYIGTMINDLITRDLK-EPYRVLTSRSEYRLTLRGDNADRRLTPLGFEI
MNMG_CHLTR       ---PFVPSRQESYIGVMLDDLTTQVLD-EPYRMFTSRAEHRLLLRQDNAGMRLSHYGHSL
MNMG_CHLTA       ---PFVPSRQESYIGVMLDDLTTQVLD-EPYRMFTSRAEHRLLLRQDNAGMRLSHYGHSL
MNMG_CHLT2       ---PFVPSRQESYIGVMLDDLTTQVLD-EPYRMFTSRAEHRLLLRQDNAGMRLSHYGHSL
MNMG_CHLTB       ---PFVPSRQESYIGVMLDDLTTQVLD-EPYRMFTSRAEHRLLLRQDNAGMRLSHYGHSL
MNMG_CHLMU       ---AFIPSRQESYIGVMLDDLTTQVLD-EPYRMFTSRAEHRLLLRQDNAGMRLSHYGHAL
MNMG_CHLAB       ---AFIPSRQESYIGVMLDDLTTQILD-EPYRMFTGRAEHRLLLRQDNACLRLSHYGRDL
MNMG_CHLCV       ---AFIPSRQESYIGVMLDDLTTQVLD-EPYRMFTGRAEHRLLLRQDNACLRLSHYGRDL
MNMG_CHLFF       ---DFIPSRQESYIGVMLDDLTTQVLD-EPYRMFTGRAEHRLLLRQDNACLRLSHYGRDL
MNMG_CHLPN       ---PFIPSRQESYIGVMLDDLTTQILD-EPYRMFTGRAEHRLLLRQDNACARLSHYGYEL
MNMG_PARUW       ---PLILKRSEAYIGVMIDDLVTKGLD-EPYRMFTSRAEHRLLLRQDNADLRLRRYGYEV
MNMG_RHOBA       ---PWVPSRQDAYIGVLVDDLVTSGTD-EPYRMFTSRAEYRLLLRQDNADRRLTAQADEL
MNMG_OPITP       ---PLVLGRHEAYIGVLIDDLVTKGTE-EPYRMFTSRAEHRLLLNHGSAELRLLHHASGC
MNMG_AQUAE       ---PIYLRRDESYIGVMIDDLTTKGVT-EPYRLFTSRSEYRLYIRQDNAILRLAKLGREL
MNMG_ECOLI       --EGWAPARSQAYLGVLVDDLCTLGTK-EPYRMFTSRAEYRLMLREDNADLRLTEIGREL
MNMG_ECOL6       --EGWAPARSQAYLGVLVDDLCTLGTK-EPYRMFTSRAEYRLMLREDNADLRLTEIGREL
MNMG_ECO24       --EGWAPARSQAYLGVLVDDLCTLGTK-EPYRMFTSRAEYRLMLREDNADLRLTEIGREL
MNMG_ECODH       --EGWAPARSQAYLGVLVDDLCTLGTK-EPYRMFTSRAEYRLMLREDNADLRLTEIGREL
MNMG_ECOL5       --EGWAPARSQAYLGVLVDDLCTLGTK-EPYRMFTSRAEYRLMLREDNADLRLTEIGREL
MNMG_ECOHS       --EGWAPARSQAYLGVLVDDLCTLGTK-EPYRMFTSRAEYRLMLREDNADLRLTEIGREL
MNMG_ECOLC       --EGWAPARSQAYLGVLVDDLCTLGTK-EPYRMFTSRAEYRLMLREDNADLRLTEIGREL
MNMG_SHIBS       --EGWAPARSQAYLGVLVDDLCTLGTK-EPYRMFTSRAEYRLMLREDNADLRLTEIGREL
MNMG_SHISS       --EGWAPARSQAYLGVLVDDLCTLGTK-EPYRMFTSRAEYRLMLREDNADLRLTEIGREL
MNMG_ECOUT       --EGWAPARSQAYLGVLVDDLCTLGTK-EPYRMFTSRAEYRLMLREDNADLRLTEIGREL
MNMG_ECOK1       --EGWAPARSQAYLGVLVDDLCTLGTK-EPYRMFTSRAEYRLMLREDNADLRLTEIGREL
MNMG_ECOSM       --EGWAPARSQAYLGVLVDDLCTLGTK-EPYRMFTSRAEYRLMLREDNADLRLTEIGREL
MNMG_ECO57       --EGWAPARSQAYLGVLVDDLCTLGTK-EPYRMFTSRAEYRLMLREDNADLRLTEIGREL
MNMG_SHIDS       --EGWAPARSQAYLGVLVDDLCTLGTK-EPYRMFTSRAEYRLMLREDNADLRLTEIGREL
MNMG_SHIFL       --EGWAPARSQAYLGVLVDDLCTLGTK-EPYRMFTSRAEYRLMLREDNADLRLTEIGREL
MNMG_SHIF8       --EGWAPARSQAYLGVLVDDLCTLGTK-EPYRMFTSRAEYRLMLREDNADLRLTEIGREL
MNMG_SALCH       --EGWAPARSQAYLGVLVDDLCTLGTK-EPYRMFTSRAEYRLMLREDNADLRLTEMGREL
MNMG_SALTY       --EGWAPARSQAYLGVLVDDLCTLGTK-EPYRMFTSRAEYRLMLREDNADLRLTEMGREL
MNMG_SALPB       --EGWAPARSQAYLGVLVDDLCTLGTK-EPYRMFTSRAEYRLMLREDNADLRLTEMGREL
MNMG_SALPA       --ERWAPARSQAYLGVLVDDLCTLGTK-EPYRMFTSRAEYRLMLREDNADLRLTEMGREL
MNMG_SALTI       --EGWAPARSQAYLGVLVDDLCTLGTK-EPYRMFTSRAEYRLMLREDNADLRLTEMGREL
MNMG_CITK8       --EGWAPARSQAYLGVLVDDLCTLGTK-EPYRMFTSRAEYRLMLREDNADLRLTEMGREL
MNMG_SALAR       --EGWAPARSQAYLGVLVDDLCTLGTK-EPYRMFTSRAEYRLMLREDNADLRLTEIGRDL
MNMG_ENT38       --EGWAPRRDQAYLGVLVDDLSTMGTK-EPYRMFTSRAEYRLMLREDNADLRLTEMGREL
MNMG_KLEP7       --EGWAPRRDQAYLGVLVDDLCTLGTK-EPYRMFTSRAEYRLMLREDNADLRLTEQGREL
MNMG_CROS8       --EGWAPGRSQAYLGVLVDDLCTLGTK-EPYRMFTSRAEYRLMLREDNADLRLTEVGREM
MNMG_PECAS       --EGWSPRRDQAYLGVLVDDLCTLGTK-EPYRMFTSRAEYRLMLREDNADLRLTEMGREL
MNMG_YERPE       --DGWSPRRDEAYLGVLVDDLSTLGTK-EPYRMFTSRAEYRLMLREDNADLRLTETGRKL
MNMG_YERPY       --DGWSPRRDEAYLGVLVDDLSTLGTK-EPYRMFTSRAEYRLMLREDNADLRLTETGRKL
MNMG_YERPA       --DGWSPRRDEAYLGVLVDDLSTLGTK-EPYRMFTSRAEYRLMLREDNADLRLTETGRKL
MNMG_YERPN       --DGWSPRRDEAYLGVLVDDLSTLGTK-EPYRMFTSRAEYRLMLREDNADLRLTETGRKL
MNMG_YERPP       --DGWSPRRDEAYLGVLVDDLSTLGTK-EPYRMFTSRAEYRLMLREDNADLRLTETGRKL
MNMG_YERPS       --DGWSPRRDEAYLGVLVDDLSTLGTK-EPYRMFTSRAEYRLMLREDNADLRLTETGRKL
MNMG_YERP3       --DGWSPRRDEAYLGVLVDDLSTLGTK-EPYRMFTSRAEYRLMLREDNADLRLTETGRKL
MNMG_YERE8       --DGWSPRRDEAYLGVLVDDLSTLGTK-EPYRMFTSRAEYRLMLREDNADLRLTEMGRKL
MNMG_SERP5       --EGWSPRRDQAYLGVLVDDLSTLGTK-EPYRMFTSRAEYRLMLREDNADLRLTEKGREL
MNMG_PHOLL       --ESWFPRRDQAYIGVLVDDLCTLGTK-EPYRMFTSRAEYRLMLREDNADLRLTEKGREL
MNMG_SODGM       --DGWSPRRDQAYLGVLVDDLCTLGTK-EPYRMFTSRAEYRLLLREDNADLRLTETGRQL
MNMG_VIBCH       --EGWSPRRDQAYMGVLIDDLSTMGTK-EPYRMFTSRAEYRLLLREDNADLRLTEKAREL
MNMG_VIBC3       --EGWSPRRDQAYMGVLIDDLSTMGTK-EPYRMFTSRAEYRLLLREDNADLRLTEKAREL
MNMG_VIBCB       --EGWSPRRDQAYMGVLIDDLSTMGTK-EPYRMFTSRAEYRLLLREDNADLRLTEKAREL
MNMG_VIBPA       --EGWSPRRDQAYMGVLIDDLSTMGTK-EPYRMFTSRAEYRLLLREDNADLRLTEKAREL
MNMG_VIBVU       --EGWSPRRDQAYMGVLIDDLSTMGTK-EPYRMFTSRAEHRLLLREDNADLRLTEKAREL
MNMG_VIBVY       --EGWSPRRDQAYMGVLIDDLSTMGTK-EPYRMFTSRAEHRLLLREDNADLRLTEKAREL
MNMG_ALIF1       --EGWSPRRDEAYMGVLIDDLSTLGTK-EPYRMFTSRAEYRLLLREDNADLRLTEQGRTL
MNMG_PHOPR       --EGWCPRRDQAYMGVLIDDLSTMGTK-EPYRMFTSRAEYRLLLREDNADLRLTEIGREF
MNMG_AERHH       --DAWHPRRDQAYIGVMMDDLSTLGTR-EPYRMFTSRAEYRLLLREDNADLRLTGIGREL
MNMG_AERS4       --DPWHPRRDQAYMGVMIDDLSTLGTR-EPYRMFTSRAEYRLLLREDNADLRLTAIGREL
MNMG_COLP3       --DEFTLGRDQAYMGVLIDDLATLGTK-EPYRMFTSRAEYRLLLREDNADIRLTEQGRKI
MNMG_PSEA6       --DPLILRRDEAYMGVLIDDLATMGTK-EPYRMFTSRAEYRLLLREDNADIRLTAKGHEL
MNMG_IDILO       --ESWAPRRDQAYMGVLIDDLSTLGTQ-EPYRMFTSRAEYRLLLREDNADMRLTEIGRNL
MNMG_PSET1       --ESWTPRRDEAYVGVLIDDLTTLGTK-EPYRMFTSRAEYRLLLREDNADIRLTEKGREL
MNMG_SHEB5       --EAWCPRRDEAYLGVLVDDLSTLGTK-EPYRMFTSRAEYRLLLREDNADIRLTAKGREL
MNMG_SHEB8       --EAWCPRRDEAYLGVLVDDLSTLGTK-EPYRMFTSRAEYRLLLREDNADIRLTAKGREL
MNMG_SHEB9       --EAWCPRRDEAYLGVLVDDLSTLGTK-EPYRMFTSRAEYRLLLREDNADIRLTAKGREL
MNMG_SHEPC       --DAWCPRRDEAYLGVLVDDLSTLGTK-EPYRMFTSRAEYRLLLREDNADIRLTAKGREL
MNMG_SHESW       --DAWCPRRDEAYLGVLVDDLSTLGTK-EPYRMFTSRAEYRLLLREDNADIRLTAKGREL
MNMG_SHESM       --EAWCPRRDEAYIGVLVDDLSTLGTK-EPYRMFTSRAEYRLLLREDNADLRLTAKGREL
MNMG_SHESR       --EAWCPRRDEAYIGVLVDDLSTLGTK-EPYRMFTSRAEYRLLLREDNADLRLTAKGREL
MNMG_SHESA       --EAWCPRRDEAYIGVLVDDLSTLGTK-EPYRMFTSRAEYRLLLREDNADLRLTAKGREL
MNMG_SHEON       --EAWCPRRDEAYIGVLVDDLSTLGTK-EPYRMFTSRAEYRLLLREDNADLRLTAKGREL
MNMG_SHEDO       --ETWCPRRDQAYLGVLVDDLSTLGTK-EPYRMFTSRAEYRLLLREDNADLRLTEKGREL
MNMG_SHEFN       --TAWCPRRDEAYLGVLVDDLSTLGTK-EPYRMFTSRAEYRLLLREDNADLRLTEKGREL
MNMG_SHEHH       --EAWAPRRDQAYLGVLVDDLSTLGTK-EPYRMFTSRAEYRLLLREDNADLRLTEKGREL
MNMG_SHEPA       --EAWCPRRDQAYLGVLVDDLSTLGTK-EPYRMFTSRAEYRLLLREDNADLRLTEKGREL
MNMG_SHESH       --ESWCPRRDEAYLGVLVDDLSTLGTK-EPYRMFTSRAEYRLLLREDNADLRLTEKGHQI
MNMG_SHEWM       --EIWCPRRDEAYLGVLVDDLSTLGTK-EPYRMFTSRAEYRLLLREDNADLRLTEKGREI
MNMG_SHELP       --EAWCPRRDEAYLGVLVDDLSTLGTK-EPYRMFTSRAEYRLLLREDNADLRLTEKGREL
MNMG_SHEAM       --EAWAPRRDQAYLGVLVDDLSTLGTK-EPYRMFTSRAEYRLLLREDNADLRLTEKGREL
MNMG_PSYIN       --EGWCPGRDQAYAGVLVDDLSTLGTK-EPYRMFTSRAEYRLLLREDNADTRLTEKGREL
MNMG_ACTP2       --EAWFPTRDLAYTGVLVDDLCTLGTK-EPYRVFTSRAEYRLLLREDNADIRLTPIAHEL
MNMG_ACTPJ       --EAWFPTRDLAYTGVLVDDLCTLGTK-EPYRVFTSRAEYRLLLREDNADIRLTPIAHEL
MNMG_HAEDU       --PSWFPTRDVAYTGVLVDDLCTLGTK-EPYRVFTSRAEYRLLLREDNADIRLTPIAHQL
MNMG_HAEIN       --DAWYPRRDQSYTGVLVDDLCTLGTK-EPYRVFTSRAEYRLLLREDNADIRLTPIAHEL
MNMG_HAEIG       --DAWYPRRDQSYTGVLVDDLCTLGTK-EPYRVFTSRAEYRLLLREDNADIRLTPIAHEL
MNMG_HAEIE       --DAWYPRRDQSYTGVLVDDLCTLGTK-EPYRVFTSRAEYRLLLREDNADIRLTPIAHEL
MNMG_HAEI8       --EAWYPRRDQSYTGVLVDDLCTLGTK-EPYRVFTSRAEYRLLLREDNADIRLTPIAHEL
MNMG_HAES1       --ESWFPRRDQAYIGVLVDDLCTVGTK-EPYRVFTSRAEYRLLLREDNADIRLTSIARKL
MNMG_HISS2       --ESWFPRRDQAYIGVLVDDLCTVGTK-EPYRVFTSRAEYRLLLREDNADIRLTSIAREL
MNMG_MANSM       --ESWFPRRDQAYMGVLVDDLCTLGTK-EPYRVFTSRAEYRLLLREDNADSRLTPIAHEL
MNMG_PASMU       --EAWFPRRDQAYIGVLVDDLCTLGTK-EPYRVFTSRAEYRLLLREDNADSRLTPIAHQL
MNMG_ACTSZ       --DAWFPRRDQAYVGVLVDDLCTLGTK-EPYRVFTSRAEYRLLLREDNADSRLTPIAHEL
MNMG_HYDCU       --EQWYPRRDEAYIGVLVDDLITLGTS-EPYRMFTSRAEYRLMLREDNADQRLTAIGREF
MNMG_ACIAC       -ESAWLPRRDEAYLGVLVNDLITKGVT-EPYRMFTSRAEFRLQLREDNADMRLTEAGRRM
MNMG_ACISJ       -VGAWVPARDEAYLGVLVDDLITKGVT-EPYRMFTSRAEFRLQLREDNADMRLTEAGRRM
MNMG_VEREI       -DAPWLPGRDQAYLGVLVDDLITKGVT-EPYRMFTSRAEFRLQLREDNADMRLTEVGRRM
MNMG_POLNA       -KEAWLPKRDEAYLGVLVDDLITKGVT-EPYRMFTSRAEFRLMLREDNADMRLTEKGREL
MNMG_POLSJ       HGGAWLPRRDEAYLGVLVDDLITKGVT-EPYRMFTSRAEYRLMLREDNADMRLTEKGREL
MNMG_RHOFT       QQETWVPGRDEAYLGVLVDDLITKGVT-EPYRMFTSRAEFRLQLREDNADMRLTETGRRL
MNMG_LEPCP       -NPPLSFGRDQAYLGVLVDDLITKGVT-EPYRMFTSRAEFRLQLREDNADMRLTEIGRSV
MNMG_METPP       -LDAWLPRRDQAYLGVLVDDLITKGVT-EPYRMFTSRAEFRLQLREDNADLRLTDAGREM
MNMG_BURCA       -KDAWCPRRDQAYLGVLVDDLVTRGVA-EPYRMFTSRAEYRLSLREDNADMRLTEIGREL
MNMG_BURCH       -KDAWCPRRDQAYLGVLVDDLVTRGVA-EPYRMFTSRAEYRLSLREDNADMRLTEIGREL
MNMG_BURCC       -KDAWCPRRDQAYLGVLVDDLVTRGVA-EPYRMFTSRAEYRLSLREDNADMRLTEIGREL
MNMG_BURCM       -KDAWCPRRDQAYLGVLVDDLVTRGVA-EPYRMFTSRAEYRLSLREDNADMRLTEIGREL
MNMG_BURA4       -KDAWCPRRDQAYLGVLVDDLVTRGVA-EPYRMFTSRAEYRLSLREDNADMRLTEIGREL
MNMG_BURL3       -KDAWCPRRDQAYLGVLVDDLVTRGVA-EPYRMFTSRAEYRLSLREDNADMRLTEIGREL
MNMG_BURVG       -KDAWCPRRDQAYLGVLVDDLVTRGVA-EPYRMFTSRAEYRLSLREDNADMRLTEIGREL
MNMG_BURMA       -KDAWCPRRDQAYLGVLVDDLVTRGVS-EPYRMFTSRAEYRLSLREDNADMRLTEIGREL
MNMG_BURM9       -KDAWCPRRDQAYLGVLVDDLVTRGVS-EPYRMFTSRAEYRLSLREDNADMRLTEIGREL
MNMG_BURP0       -KDAWCPRRDQAYLGVLVDDLVTRGVS-EPYRMFTSRAEYRLSLREDNADMRLTEIGREL
MNMG_BURM7       -KDAWCPRRDQAYLGVLVDDLVTRGVS-EPYRMFTSRAEYRLSLREDNADMRLTEIGREL
MNMG_BURMS       -KDAWCPRRDQAYLGVLVDDLVTRGVS-EPYRMFTSRAEYRLSLREDNADMRLTEIGREL
MNMG_BURP1       -KDAWCPRRDQAYLGVLVDDLVTRGVS-EPYRMFTSRAEYRLSLREDNADMRLTEVGREL
MNMG_BURPS       -KDAWCPRRDQAYLGVLVDDLVTRGIS-EPYRMFTSRAEYRLSLREDNADMRLTEIGREL
MNMG_BURP6       -KDAWCPRRDQAYLGVLVDDLVTRGVS-EPYRMFTSRAEYRLSLREDNADMRLTEIGREL
MNMG_BURTA       -KEAWCPRRDQAYLGVLVDDLVTRGVS-EPYRMFTSRAEYRLSLREDNADMRLTEIGREL
MNMG_PARXL       -KEAWCPRRDQAYLGVLVDDLVTRGVS-EPYRMFTSRAEYRLSLREDNADMRLTEIGREL
MNMG_CUPNH       -RDAWTPRRDQAYLGVLVDDLITRGVT-EPYRMFTSRAEFRLSLREDNADMRLTEVGREL
MNMG_CUPPJ       -RDAWTPRRDQAYLGVLVDDLITRGVT-EPYRMFTSRAEFRLSLREDNADMRLTEVGREL
MNMG_CUPMC       -RDAWTPRRDQAYLGVLVDDLITRGVT-EPYRMFTSRAEFRLSLREDNADMRLTEIGREL
MNMG_RALSO       -KAAWTPRRDQAYLGVLVDDLITRGVT-EPYRMFTSRAEFRLSLREDNADMRLTEAGRDL
MNMG_JANMA       -RDAWTPRRDEAYLGVMVDDLITKGVL-EPYRMFTSRAEYRLSLREDNADMRLTEIGRQL
MNMG_HERAR       -RDAWTPRRDEAYLGVLVDDLITQGVL-EPYRMFTSRAEYRLSLREDNADMRLTDVGRQL
MNMG_BORBR       -KEPWVPRRDEAYLGVLVDDLVTRGVT-EPYRMFTSRAEYRLSLREDNADLRLTEIGRRL
MNMG_BORPA       -KEPWVPRRDEAYLGVLVDDLVTRGVT-EPYRMFTSRAEYRLSLREDNADLRLTEIGRRL
MNMG_BORPE       -KEPWVPRRDEAYLGVLVDDLVTRGVT-EPYRMFTSRAEYRLSLREDNADLRLTEIGRRL
MNMG_BORPD       -RDTWTPRRDEAYLGVLVDDLVTRGVT-EPYRMFTSRAEYRLSLREDNADLRLTEIGRKL
MNMG_BORA1       -REAWVPRRDEAYLGVLVDDLVTRGVT-EPYRMFTSRAEYRLSLREDNADLRLTEIGREL
MNMG_AZOSB       -REAWCPRRDEAYLGVLVDDLITRGVS-EPYRMFTSRAEYRLQLREDNADLRLTEKGREL
MNMG_AROAE       -REAWCPRRDEAYLGVLVDDLITRGVS-EPYRMFTSRAEYRLSLREDNADLRLTEKGREL
MNMG_DECAR       -QSGWCPKRNEAYLGVLVDDLITRGVS-DPYRMFTSRAEYRLSLREDNADLRLTEQGREL
MNMG_METFK       -KDAWWPTRDQAYLGVLVDDLITRGVS-EPYRMFTSRAEYRLMLREDNADMRLTEAGRKL
MNMG_THIDA       -KDAWSPGRHEAYLGVLVDDLITRGVS-EPYRMFTSRAEYRLQLREDNADMRLTETGRAL
MNMG_NITMU       -REPWCPRRDEAYLGVLVDDLITRGVT-EPYRMFTSRAEYRLQLREDNADLRLTEVGRRL
MNMG_NEIG1       -QDPLLLRREQAYLGVLVDDLITKGLN-EPYRMFTSRAEYRLQLREDNADMRLTEDGYKI
MNMG_NEIMA       -QDPLLLRREQAYLGVLVDDLITKGVN-EPYRMFTSRAEYRLQLREDNADMRLTEDGYKI
MNMG_NEIMB       -QDPLLLRREQAYLGVLVDDLITKGVN-EPYRMFTSRAEYRLQLREDNADMRLTEDGYKI
MNMG_NEIM0       -QDPLLLRREQAYLGVLVDDLITKGVN-EPYRMFTSRAEYRLQLREDNADMRLTEDGYKI
MNMG_NEIMF       -QDPLLLRREQAYLGVLVDDLITKGVN-EPYRMFTSRAEYRLQLREDNADMRLTEDGYKI
MNMG_CHRVO       -QEAWCPRRDEAYLGVLVDDLITKGVS-EPYRMFTSRAEFRLQLREDNADLRLTEMGRKL
MNMG_POLAQ       -KEAWLPKRSESYIGVLVDDLITRGVQ-EPYRMFTSRAEYRLSLREDNADMRLTAIGRDL
MNMG_ACIBT       --EEWTPKRDQAYMGVLVDDLITLGTK-EPYRMFTSRAEYRLMLREDNADQRLTTIGREL
MNMG_ACIBY       --EEWTPKRDQAYMGVLVDDLITLGTK-EPYRMFTSRAEYRLMLREDNADQRLTTIGREL
MNMG_ACIAD       --EQWTPKRDQAYMGVLVDDLITLGTK-EPYRMFTSRAEYRLMLREDNADQRLTPVGREM
MNMG_PSYA2       --DVWTPRRDEAYLGVLVDDLITHGTT-EPYRMFTSRAEYRLLLREDNADQRLTETGRKL
MNMG_PSYCK       --DVWTPRRDEAYLGVLVDDLITHGTT-EPYRMFTSRAEYRLLLREDNADQRLTETGRKL
MNMG_PSYWF       --DSWTPRRDQAYLGVLVDDLITHGTK-EPYRMFTSRAEYRLLLREDNADQRLTEIGRKL
MNMG_PSEAE       --DSWCPRRDEAYIGVLVDDLITLGTQ-EPYRMFTSRAEYRLILREDNADLRLTEKGREL
MNMG_PSEAB       --DSWCPRRDEAYIGVLVDDLITLGTQ-EPYRMFTSRAEYRLILREDNADLRLTEKGREL
MNMG_PSEA7       --DSWCPRRDEAYIGVLVDDLITLGTQ-EPYRMFTSRAEYRLILREDNADLRLTEKGREL
MNMG_PSEPU       --DSWCPRRDEAYIGVLVDDLITLGTQ-EPYRMFTSRAEYRLILREDNADLRLTEKGREL
MNMG_PSEPK       --DSWCPRRDEAYIGVLVDDLITLGTQ-EPYRMFTSRAEYRLILREDNADLRLTEKGREL
MNMG_PSEP1       --DSWCPRRDEAYIGVLVDDLITLGTQ-EPYRMFTSRAEYRLILREDNADLRLTEKGREL
MNMG_PSEPG       --DSWCPRRDEAYIGVLVDDLITLGTQ-EPYRMFTSRAEYRLILREDNADLRLTEKGREL
MNMG_PSEPW       --ESWCPRRDEAYIGVLVDDLITLGTQ-EPYRMFTSRAEYRLILREDNADLRLTEKGREL
MNMG_PSEE4       --ESWCPRRDEAYIGVLVDDLITLGTQ-EPYRMFTSRAEYRLILREDNADLRLTEKGREL
MNMG_PSEF5       --DSWCPRRDEAYIGVLVDDLITLGTQ-EPYRMFTSRAEYRLILREDNADLRLTEKGREL
MNMG_PSEPF       --EAWCPRRDEAYIGVLVDDLITLGTQ-EPYRMFTSRAEYRLILREDNADLRLTEKGREL
MNMG_PSE14       --DSWCPRRDEAYIGVLVDDLITLGTQ-EPYRMFTSRAEYRLILREDNADLRLTEKGREL
MNMG_PSEU2       --DSWCPRRDEAYIGVLVDDLITLGTQ-EPYRMFTSRAEYRLILREDNADLRLTEKGREL
MNMG_PSESM       --DSWCPRRDEAYIGVLVDDLITLGTQ-EPYRMFTSRAEYRLILREDNADLRLTEKGREL
MNMG_PSEMY       --EAWCPRRDEAYIGVLVDDLITLGTQ-EPYRMFTSRAEYRLILREDNADLRLTEKGREL
MNMG_PSEU5       --DSWCPRRDEAYLGVLVDDLITLGTQ-EPYRMFTSRAEYRLILREDNADLRLTEKGREL
MNMG_ALCBS       --DAWTPRRDEAYIGVLVDDLITMGTQ-EPYRMFTSRAEYRLLLREDNADLRLTEKGREL
MNMG_HAHCH       --EAWSPRRDEAYIGVLVDDLITMGTR-EPYRMFTSRAEYRLLLREDNADLRLTEKGREL
MNMG_MARMS       --DAWTPRRDEAYLGVLVDDLISMGTK-EPYRMFTSRAEYRLILREDNADMRLTEKGREL
MNMG_SACD2       --EAWCPRRDEAYIGVLADDLISMGTR-EPYRMFTSRAEYRLLLREDNADMRLTEKGREL
MNMG_CHRSD       --DAWSPRRDEAYLGVLVDDLITMGTQ-EPYRMFTSRAEHRLLLREDNADLRLTEIGREL
MNMG_MARHV       --EEWYPRRDEAYLGVLVDDLITMGTQ-EPYRMFTSRAEYRLILREDNADLRLTETGRKL
MNMG_ALKEH       --EPWYPRRDQAYLGVLVDDLITRGTR-EPYRMFTSRAEYRLMLREDNADLRLTPIGRDL
MNMG_NITOC       --EPWYPRRDEAYIGVLIDDLITCGTS-EPYRMFTSRAEYRLLLREDNADLRLTPIGREL
MNMG_METCA       --EPWWPGRDEAYLGVLVDDLITRGTS-EPYRMFTSRAEYRLVLREDNADLRLTETGRAL
MNMG_XANAC       --PAWSPRRDEAYLGVLVDDLITHGTT-EPYRMFTSRAEYRLQLREDNADARLTGVGRAM
MNMG_XANC5       --PAWSPRRDEAYLGVLVDDLITHGTT-EPYRMFTSRAEYRLQLREDNADARLTGVGRAM
MNMG_XANOR       --PAWSPRRDEAYLGVLVDDLITHGTT-EPYRMFTSRAEYRLQLREDNADARLTGAGREM
MNMG_XANOM       --PAWSPRRDEAYLGVLVDDLITHGTT-EPYRMFTSRAEYRLQLREDNADARLTGAGREM
MNMG_XANCP       --PAWSPRRDEAYLGVLVDDLITHGTT-EPYRMFTSRAEYRLQLREDNADLRLTGVGRAM
MNMG_XANC8       --PAWSPRRDEAYLGVLVDDLITHGTT-EPYRMFTSRAEYRLQLREDNADLRLTGVGRAM
MNMG_XANCB       --PAWSPRRDEAYLGVLVDDLITHGTT-EPYRMFTSRAEYRLQLREDNADLRLTGVGRAM
MNMG_XYLFA       --SSWTPRRDQAYLGVLVDDLITHGTN-EPYRMFTSRAEYRLQLREDNADARLTAIGRDL
MNMG_XYLFT       --SSWTPRRDQAYLGVLVDDLITHGTN-EPYRMFTSRAEYRLQLREDNADARLTAIGRDL
MNMG_COXBU       --APWTPARDEAYIGVLIDDLTTRGTN-EPYRMFTSRAEYRLLLRQDNADLRLTEKGRDL
MNMG_COXBN       --APWTPARDEAYIGVLIDDLTTRGTN-EPYRMFTSRAEYRLLLRQDNADLRLTEKGRDL
MNMG_COXBR       --APWTPARDEAYIGVLIDDLTTRGTN-EPYRMFTSRAEYRLLLRQDNADLRLTEKGRDL
MNMG_LEGPC       --ELWCPRRDEAYIGVLIDDLITCGTQ-EPYRMFTSRAEYRLLLREDNADLRLTEKGRQL
MNMG_LEGPA       --ELWCPRRDEAYIGVLIDDLITCGTQ-EPYRMFTSRAEYRLLLREDNADLRLTEKGRQL
MNMG_LEGPL       --DLWCPRRDEAYIGVLIDDLITCGTQ-EPYRMFTSRAEYRLLLREDNADLRLTEKGRQL
MNMG_LEGPH       --ELWCPRRDEAYIGVLIDDLITCGTQ-EPYRMFTSRAEYRLLLREDNADLRLTEKGRQL
MNMG_NITEU       --EPWCPSRDEAYIGVLVDDLVTRGVT-EPYRMFTSRAEFRLQLREDNADMRLTETGYRL
MNMG_NITEC       --ESWCPSRDEAYLGVLVDDLVTRGVT-EPYRMFTSRAEFRLQLREDNADMRLTEAGHQF
MNMG_FRATF       --KSWYPTRADSYIGVLIDDLITKGTK-EPYRMFTSRAEYRLILREDNADLRLSDKACEL
MNMG_FRATH       --KSWYPTRADSYIGVLIDDLITKGTK-EPYRMFTSRAEYRLILREDNADLRLSDKACEL
MNMG_FRATO       --KSWYPTRADSYIGVLIDDLITKGTK-EPYRMFTSRAEYRLILREDNADLRLSDKACEL
MNMG_FRATW       --KSWYPTRADSYIGVLIDDLITKGTK-EPYRMFTSRAEYRLILREDNADLRLSDKACEL
MNMG_FRATT       --KSWYPTRADSYIGVLIDDLITKGTK-EPYRMFTSRAEYRLILREDNADLRLSNKACEL
MNMG_FRAT1       --KSWYPTRADSYIGVLIDDLITKGTK-EPYRMFTSRAEYRLILREDNADLRLSNKACEL
MNMG_FRATN       --KSWYPTRADSYIGVLIDDLITKGTK-EPYRMFTSRAEYRLILREDNADLRLSDKACEL
MNMG_FRAP2       --KSWYPTRSNSYMGVLIDDLITKGTK-EPYRMFTSRAEYRLILREDNADLRLSDKACEL
MNMG_VESOH       --DAWLPKRDESYIGVMVDDLITKGTN-EPYRMFTSRAEYRLLLREDNADERLTPKAKEL
MNMG_RUTMC       --DAWLPKRNESYIGVMVDDLITKGAN-EPYRMFTSRAEYRLLLREDNADERLTPKARDL
MNMG_DICNV       --EGWYPRRDQAYLGVLIDDLITQGTR-EPYRMFTSRAEHRLLLREDNADQRLTAIGYQL
MNMG_BLOFL       --PGWYPRRDQAYLGVLVDDLCTYGTK-EPYRMFTSRSEYRLSLREDNADLRLTTVAREF
MNMG_BLOPB       --EGWYPRRDQAYLGVLVDDLCTHGTE-EPYRMFTSRAEYRLSLREDNADLRLTEIARQL
MNMG_BAUCH       --DSWYPNRSQAYIGVLIDDLCLQGIE-EPYRMFTSRAEYRLSLREDNADLRLTEIARKL
MNMG_BUCAI       --EGWFPRRDQAYLGVLIDDLTTQGTE-EPYRMFTSRAEYRLSLREDNADLRLTEIGRKL
MNMG_BUCAP       --KQWFPRRDQAYLGVLIDDLTTQGAN-EPYRMFTSRSEYRLTLREDNADLRLTEIAYKL
MNMG_BUCBP       --CGWFPNRGQAYLGVLIDDLCTKGTK-EPYRMFTARAEHRLILREDNADLRLTNIAKSM
MNMG_WIGBR       --SFWFPKRSQAYLGVLIDDLCTLGTK-EPYRMFTSRSEHRLIIREDNADLRLTEIGRKL
MNMG_BUCCC       --DTWYPKRNEAYIGVLIDDLCSKGTS-EPYRMFTSRAEYRLLLRENNADERLTTIGYKL
MNMG_HALHL       --DPWFPTREEAYIGVLIDDLVTTGVT-EPYRMFTSRAEHRLRLRDDNAEDRLTEVGRRL
MNMG_RHIME       ---PHFFSRTDSYIGVMIDDLTSRGIT-EPYRMFTSRAEYRLSLRADNADMRLTPAGITL
MNMG_SINMW       ---PFFFSRTDSYIGVMIDDLTSRGIA-EPYRMFTSRAEYRLSLRADNADMRLTPVGIEL
MNMG_RHIEC       ---PFHFSRTSSYIGVMIDDLTSRGVT-EPYRMFTSRAEYRLTLRADNADMRLTPLAMAL
MNMG_RHIL3       ---PFHFSRTSSYIGVMIDDLTSRGVT-EPYRMFTSRAEYRLSLRADNADMRLTPLAMRV
MNMG_AGRFC       ---PLHFSRTESYIGVMIDDLTSKGVS-EPYRMFTSRAEYRLSLRVDNADLRLTPVAQKA
MNMG_BARHE       ---EILISRSTAYIGVMVDDLVSRGVC-EPYRMFTSRAEFRLSLRSDNADARLTPLAQQL
MNMG_BARQU       ---EIIISRSTAYIGVMVDDLVSRGVS-EPYRMFTSRAEFRLSLRSDNADARLTPLAQQW
MNMG_BART1       ---EIFISRSTAYIGVMVDDLVSRGVC-EPYRMFTSRAEFRLSLRSDNADTRLTPLAQEW
MNMG_BARBK       ---EIILSRSTAYIGVMIDDLISRGVC-EPYRMFTSRAEFRLSLRADNADARLTPLAQEW
MNMG_BRUAB       ---PVILQRTEAYIGVMVDDLTSRGVS-EPYRMFTSRAEFRLSLRADNADQRLTPLADEV
MNMG_BRUA2       ---PVILQRTEAYIGVMVDDLTSRGVS-EPYRMFTSRAEFRLSLRADNADQRLTPLADEV
MNMG_BRUC2       ---PVILQRTEAYIGVMVDDLTSRGVS-EPYRMFTSRAEFRLSLRADNADQRLTPLADEV
MNMG_BRUSU       ---PVILQRTEAYIGVMVDDLTSRGVS-EPYRMFTSRAEFRLSLRADNADQRLTPLADEV
MNMG_BRUSI       ---PVILQRTEAYIGVMVDDLTSRGVS-EPYRMFTSRAEFRLSLRADNADQRLTPLADEV
MNMG_BRUME       ---PVILQRTEAYIGVMVDDLTSRGVS-EPYRMFTSRAEFRLSLRADNADQRLTPLADEV
MNMG_BRUO2       ---PVILQRTEAYIGVMVDDLTSRGVS-EPYRMFTSRAEFRLSLRADNADQRLTPLADEV
MNMG_BRUA4       ---PVIIQRTEAYIGVMVDDLTSRGVS-EPYRMFTSRAEFRLSLRADNADQRLTPLADKL
MNMG_RHILO       ---QIVLSRTEAYIGVMVDDLTSRGIS-EPYRMFTSRAEFRLSLRADNADERLTPLAAKL
MNMG_CHESB       ---TVVPSRTDAYIGVMIDDLVTRGVT-EPYRMFTSRAEFRLSLRADNADERLTPRAIEW
MNMG_BRASB       ---PIVFDRADGYVGVMIDDLVTRGIT-EPYRMFTSRAEYRLTLRADNADQRLTDKGIAL
MNMG_BRASO       ---PIVFDRADGYLGVMIDDLVTRGIT-EPYRMFTSRAEYRLTLRADNADQRLTDKGIAL
MNMG_BRADU       ---LTVFDRADGYLGVMIDDLVTRGIS-EPYRMFTSRAEYRLTLRADNADQRLTEKGIAL
MNMG_NITHX       ---PVVFDRADGYLGVMIDDLVTRGIT-EPYRMFTSRAEYRLTLRADNADQRLTDKGIAM
MNMG_NITWN       ---PVVFDRADGYLGVMIDDLVTRGIT-EPYRMFTSRAEYRLTLRADNADQRLTDRGIAL
MNMG_RHOPS       ---PAVFDRADGYLGVMIDDLVTRGIN-EPYRMFTSRAEYRLTLRADNADQRLTDKGLAL
MNMG_RHOP2       ---GVVFDRADGYLGVMIDDLVTRGIS-EPYRMFTSRAEYRLTLRADNADQRLTDKGLAL
MNMG_RHOPA       ---LVVFDRADGYLGVMIDDLVTRGIT-EPYRMFTSRAEYRLTLRADNADQRLTDKGLAL
MNMG_RHOP5       ---GVVFDRADGYLGVMIDDLVTRGIT-EPYRMFTSRAEYRLTLRADNADQRLTDQGIAH
MNMG_RHOPB       ---EIAFDRADGYLGVMIDDLVTRGIT-EPYRMFTSRAEYRLTLRADNADQRLTGQGIAL
MNMG_AZOC5       ---GVVIDRAEGYIGVMVDDLVTRGVS-EPYRMFTSRAEYRLTLRADNADQRLTQRGLDL
MNMG_METPB       ---LAVFDRAESYLGVMIDDLVTHGVS-EPYRMFTSRSEYRLSLRVDNADERLTPRGAAL
MNMG_METRJ       ---IAGFDRAESYLGVMIDDLVTQGVS-EPYRMFTSRSEYRLSLRVDNADARLTPRGIAL
MNMG_METS4       ---LAVLDRAESYIGVMIDDLVTHGVS-EPYRMFTSRSEYRLSLRVDNADERLTGRGIAL
MNMG_BEII9       ---PITFDRSEAYLGVMIDDLINRGVS-EPYRMFTSRAEYRLTLRADNADQRLTGKGMIL
MNMG_PARL1       ---PFILDRAQAYMGVMVDDLITRGVS-EPYRMFTSRAEYRLTLRADNADQRLTAAGIGA
MNMG_RHORT       --APITFDRAEGYLGVLVDDLITLGTT-EPYRMFTSRAEYRLLLRADNADLRLTAKGIAL
MNMG_MAGSA       ---PLVLDRADAYLGVMIDDLVSLGTS-EPYRMFTSRAEYRLLLRADNADSRLTPKGREA
MNMG_CAUVC       ---PAIFARDEAYIGVMIDDLVTRGVT-EPYRMFTSRAEFRLTLRADNADQRLSDRGISL
MNMG_CAUSK       ---PAVFARDEAYIGVMIDDLVTRGVT-EPYRMFTSRAEFRLILRADNADQRLTDRGLAL
MNMG_MARMM       ---PFVLSRSDAYIGVMIDDLITRGVS-EPYRMFTSRAEYRLSLRADNADQRLTPKAMEL
MNMG_HYPNA       ---PVIFDRAEAYIGVLIDDLVTRGVT-EPYRMFTSRAEYRLALRADNADQRLTQRGIDA
MNMG_GLUOX       ---PLTLDRSDAYLGVMIDDLTLHGIS-EPYRMFTSRAEYRLTLRADNADLRLTPKGIAA
MNMG_GLUDA       ---GIAIDRGAAYLGVMIDDLATQGVS-EPYRMFTSRAEYRLSLRADNADLRLTGQGIGW
MNMG_GRABC       ---SVTLDRSQAYIGVLIDDLTTHGVT-EPYRMFTSRSEFRLTLRADNADRRLTRWGRQA
MNMG_ACICJ       ---MVTVRRHEGYIGVLVDDLVTRGVS-EPYRMFTSRAEHRLSLRADNADLRLTPRGLDW
MNMG_RUEPO       ---PVPFSRANSYIGVMIDDLTTRGVA-EPYRMFTSRAEFRLSLRADNADQRLTPLGLEL
MNMG_RUEST       ---EIVFGRSNSYIGVMIDDLITNGVT-EPYRMFTSRAEFRLSLRADNADQRLTPIGYDL
MNMG_ROSDO       ---PITFSRSDSYIGVMIDDLTTRGVM-EPYRMFTSRAEFRLSLRADNADQRLTPIGLAL
MNMG_DINSH       ----FLPSRMTSYIGVMIDDLITQGVA-EPYRMFTSRAEYRLSLRCDNADQRLTPEGLVL
MNMG_RHOS1       ---PLHFSRSGSYLGVMIDDLTSRGVT-EPYRMFTSRAEFRLSLRADNADQRLTPIGLDL
MNMG_CERS4       ---PLHFSRSGSYLGVMIDDLTSRGVT-EPYRMFTSRAEFRLSLRADNADQRLTPIGLDL
MNMG_CERS5       ---PLHFSRSDSYIGVMIDDLTSRGVT-EPYRMFTSRAEFRLSLRADNADQRLTQTGIDL
MNMG_PARDP       ---ALHFSRSQSYIGVMIDDLTTRGVS-EPYRMFTSRAEFRLSLRADNADQRLTPFGIDI
MNMG_JANSC       ---PLTFSRRESYIGVLVDDLVTRGVS-EPYRMFTSRAEYRLSLRADNADQRLTPIAADL
MNMG_NOVAD       ---MPELDRANSYMAVMIDDLTLHGVS-EPYRMLTARAEYRLRLRANNAASRLTPIGLAI
MNMG_ERYLH       ---APALDRATSYMAVMVDDLTLHGVS-EPYRMLTARAEYRLRLRANNATARLTPLAIEL
MNMG_SPHAL       ---PLILDRSESYIGVMVDDLVLQGVT-EPYRMLTARAEYRLRLRADNAATRLTPKGIAL
MNMG_SPHWW       ---EIHFDRATSYIGVMIDDLTLQGVS-EPYRMLTARAEYRLRLRADNAGTRLTSWADAH
MNMG_ZYMMO       ---PPVFDRRNSYIGVMIDDLVLQGVT-EPYRMLTARAEYRLGLRADNAVTRLSGQAKAF
MNMG_ANAMM       ---PFVLKRSEAYIGVMIDDLVTLGTS-EPYRLFTSRAEYRLRLRSDNADMRLTEMGYNA
MNMG_ANAPZ       ---PLVLKRSDSYIGVMIDDLVTLGTS-EPYRLFTSRAEYRLTLRSDNADMRLTEIGRAY
MNMG_EHRCJ       ---PFILKRSDAYIGVMIDDLVTLGTS-EPYRLFTSRAEYRLRLRSDNADLRLTELGYKV
MNMG_EHRCR       ---PFILKRSDAYIGVMIDDLVTLGTS-EPYRLFTSRAEYRLRLRSDNADLRLTELGYQI
MNMG_EHRRG       ---PFILKRNDAYIGVMIDDLVTLGTS-EPYRLFTSRAEYRLRLRSDNADLRLTELGYKI
MNMG_EHRRW       ---PFILKRNDAYIGVMIDDLVTLGTS-EPYRLFTSRAEYRLRLRSDNADLRLTELGYKV
MNMG_WOLPM       ---SFVLHRTDSYIGVMIDDLVIKGVI-EPYRLFTSRAEYRLAIRSDNADRRLTQKGYDI
MNMG_WOLTR       ---SFVLHRTDSYIGVMIDDLVTKGVT-EPYRLFTSRAEYRLAIRSDNADRRLTQKGYNI
MNMG_NEOSM       ----LIISRSEGYIGVMIDDLITLGTNGEPYRLFTSRAEYRLNLRSDNADFRLTEKAYRV
MNMG_RICRO       ---PFMLTRANSYIGVMIDDLTTFGTI-EPYRMFTSRSEYRLSLRADNSDLRLTELGMNI
MNMG_RICRS       ---PFMLTRANSYIGVMIDDLTTFGTI-EPYRMFTSRSEYRLSLRADNSDLRLTELGMNI
MNMG_RICCN       ---PFMLTRANSYIGVMIDDLTTFGTI-EPYRMFTSRSEYRLSLRADNSDLRLTELGMNI
MNMG_RICM5       ---PFMLTRANSYIGVMIDDLTTFGTI-EPYRMFTSRSEYRLSLRADNSDLRLTELGMNI
MNMG_RICFE       ---PFMLTRANSYIGVMIDDLTTFGTI-EPYRMFTSRSEYRLSLRADNADLRLTELGINI
MNMG_RICAH       ---QFILTRANSYIGVMIDDLTTFGTI-EPYRMFTSRSEYRLSLRADNADLRLTELGINI
MNMG_RICCK       ---PFILTRANSYIGVMIDDLTIFGTK-EPYRMFTSRAEYRLSLRADNADLRLTELGINI
MNMG_RICB8       ---PFILTRANSYIGVMIDDLTSFGTL-EPYRMFTSRSEYRLSIRADNADLRLTEMGISI
MNMG_RICBR       ---PFILTRANSYIGVMIDDLTSFGTL-EPYRMFTSRSEYRLSIRADNADLRLTEMGISI
MNMG_RICPR       ---PFILTRATSYIGVMIDDLTTFGTV-EPYRMFTSRSEYRLSLRADNADLRLTELGIKI
MNMG_RICTY       ---PFILTRATSYIGVMIDDLTTSGTV-EPYRMFTSRSEYRLSLRADNADLRLTELGINI
MNMG_ORITB       ---PFILDRTDAYIGVMIDDLTN-GID-EPYRMFTSRSEYRLSIRADNADQRLTPKAIDL
MNMG_PELUB       ---PFILDRSDAYIGVMIDDLVTKGVA-EPYRMFTSRAEYRLSLRADNADQRLTNKGIEI
MNMG_KORVE       ---PLVLDRTEAYTAILIDDLISKGTN-EPYRMFTSRAEFRLHLRIDNADRRLTPHGRRV
MNMG_SOLUE       ---PVIIGRTEGYAGILVDDLITKGAD-EPYRMFTSRAEFRLHLRIDNADARLTPLGRRA
MNMG_MAGMM       ---SYRFERYDGYFGVMVDDLVTRGVD-EPYRMFTSRSELRIVHREDNADMRLTPLGHEL
MNMG_CAMJE       ----LILRRDEAYIGVLIDDLVVKGTK-EPYRMFTSRAEFRLLLREENAILRLGKYGYDL
MNMG_CAMJJ       ----LILRRDEAYIGVLIDDLVVKGTK-EPYRMFTSRAEFRLLLREENAILRLGKYGYDL
MNMG_CAMJR       ----LILRRDEAYIGVLIDDLVVKGTK-EPYRMFTSRAEFRLLLREENAILRLGKYGYDL
MNMG_CAMJ8       ----LILRRDEAYIGVLIDDLVVKGTK-EPYRMFTSRAEFRLLLREENAILRLGKYGYDL
MNMG_CAMJD       ----LILRRDEAYIGVLIDDLVVKGTK-EPYRMFTSRAEFRLLLREENAILRLGKYGYVL
MNMG_CAMC1       ----LILRRDEAYIGVLIDDLVTKGTK-EPYRMFTSRAEYRLLLREENAILRLGGYGHEL
MNMG_CAMC5       ----LVLRRDEAYIGVLIDDLVTKGTK-EPYRMFTSRAEYRLLLREDNAILRLGGYGREL
MNMG_CAMFF       ----LILRRDESYIGVLIDDLVTKGTK-EPYRMFTSRAEYRLLLREDNANLRLSKYGYNV
MNMG_CAMHC       ----LILRRDEAYIGVLIDDLVTKGTK-EPYRMFTSRAEFRLLLREDNAIFRLSGYGHDI
MNMG_NITSB       ----LILGRDEAYIGVLIDDLVTKGTK-EPYRMFTSRAEFRLLLREDNADLRLMPYGHKL
MNMG_SULDN       ----FILRRDEAYIGVLIDDLVTKGTK-EPYRMFTSRAEYRLLLREESADTRLSHYGHTF
MNMG_ARCB4       ----FILRRDEAYIGVLIDDLVTKGTN-EPYRMFTSRAEYRLLLREENADLRLSQYGHKF
MNMG_SULNB       ----LILRRDEAYIGVLIDDLVTKGTK-EPYRMFTSRAEYRLLLREDNADMRLSKYGKEL
MNMG_HELPY       ----FILKRNEAYIGVLIDDLITKGTN-EPYRMFTSRAEYRLLLREDNTLFRLGEHAYRL
MNMG_HELPH       ----FILKRNEAYIGVLIDDLVTKGTN-EPYRMFTSRAEYRLLLREDNTLFRLGEHAYRL
MNMG_HELPJ       ----FILKRNEAYIGVLIDDLVTKGTN-EPYRMFTSRAEYRLLLREDNTLFRLGEHAYRL
MNMG_HELAH       ----FILKRNEAYIGVLIDDLVTKGTN-EPYRMFTSRAEYRLLLREDNTLFRLGEHAYHL
MNMG_HELHP       ----FTLARNEAYIGVMIDDLVTKGTK-EPYRVFTSRAEYRLLLREDNAYLRLGTYAYKF
MNMG_WOLSU       ----FVLRRDEAYLGVLIDDLVTKGTK-EPYRMFTSRAEYRLLLREDNAEFRLLRHGARF
MNMG_LEPIN       ----LLFKRSESYIGVLIDDLVHKGVE-DPYRMFTSRAEHRLLLRQDNADQRLMKYGYDL
MNMG_LEPIC       ----LLFKRSESYIGVLIDDLVHKGVE-DPYRMFTSRAEHRLLLRQDNADQRLMKYGYDL
MNMG_LEPBJ       ----LLFKRSESYIGVLIDDLVYKGVE-DPYRMFTSRAEHRLLLRQDNADQRLMKYGYEL
MNMG_LEPBL       ----LLFKRSESYIGVLIDDLVYKGVE-DPYRMFTSRAEHRLLLRQDNADQRLMKYGYEL
MNMG_LEPBA       ----ILFKRSESYIGVLVDDLVYKGVE-DPYRMFTSRAEYRLLLRQDNADQRLMQYGYEM
MNMG_LEPBP       ----ILFKRSESYIGVLVDDLVYKGVE-DPYRMFTSRAEYRLLLRQDNADQRLMQYGYEM
MNMG_GEOMG       ---PLILGRSEAYIGVMIDDLVTLGTR-EPYRMFTSRAEYRLLLREDNADLRLRERGHAV
MNMG_GEOSL       ---PLVLGRDEAYIGVMIDDLVTLGTR-EPYRMFTSRAEYRLLLREDNADLRLRERGHAV
MNMG_GEOUR       ---PLILGRNDAYIGVMIDDLVTLGSK-EPYRMFTSRAEYRLLLREDNADLRLCEKGYAI
MNMG_PELPD       ---PLILSRSESYIGVMIDDLITLGTK-EPYRMFTSRAEYRLLLREDNADQRLREIGYRV
MNMG_PELCD       ---PVVLGRDQAYIGVMIDDLVTCGTS-EPYRMFTSRAEYRLLLREDNADQRLTPLGHQV
MNMG_DESPS       ---PLILDRSQAYIGVLIDDLVTCGTK-EPYRLFTSRAEYRLLLREDNADSRLCQIGKDI
MNMG_DESVH       ---PFLPGRDTAYMAVLVDDLVTKGTR-EPYRMFTSRAEHRLLLRENNADARLTETGRAL
MNMG_DESVV       ---PFLPGRDTAYMAVLVDDLVTKGTR-EPYRMFTSRAEHRLLLRENNADARLTETGRAL
MNMG_DESAG       ---AFIPGRDEAYMAVLVDDLVTKGTL-EPYRMFTSRAEHRLLLRENNADSRLTPAGRSL
MNMG_LAWIP       ---PFILGRDNAYLAVLVDDLVTQGTK-EPYRMFTSRAEYRLLLREANADIRLTPLGRKI
MNMG_SYNFM       ---PFILDRSEAYLAVMVDDLVTRGTN-EPYRIFTSRAEYRLLLREDNADLRLLEKGCEL
MNMG_SYNAS       ---PFVLDRSEAYMGVLIDDLVTQGVD-EPYRMFTSRAEYRLILREDNAALRLTPRGFDL
MNMG_CHLTE       ---LIVLGRDQAYIGVLIDDLITKETK-EPYRMFTSSAEHRLILRHDNADLRLRKIGYDC
MNMG_CHLCH       ---PLILTRSDAYIGVLIDDLITKETN-EPYRMFTSSAEHRLLLRHDNADIRLHEFGYRV
MNMG_CHLPM       ---PIHLQRSDAYIGVLIDDLVTKETN-EPYRMFTSSAEHRLILRHDNADLRLRKFGHTA
MNMG_CHLL3       ---ALRLKRSDAYIGVLVDDLVTKEMK-EPYRMFTSSAEHRLMLRHDNADIRLMHFGHQS
MNMG_CHLPD       ---PFVLDRSQAYIGVLIDDLVTKDII-EPYRMFTSSAEHRISLRHDNADIRLCRMGHEA
MNMG_BACFR       ---PFTLARDEAYIGVLIDDLVTKGVD-EPYRMFTSRAEYRILLRMDDADMRLTERAYKL
MNMG_BACFN       ---PFTLARDEAYIGVLIDDLVTKGVD-EPYRMFTSRAEYRILLRMDDADMRLTERAYKL
MNMG_BACTN       ---AFTLARDEAYIGVLIDDLVTKGVD-EPYRMFTSRAEYRILLRMDDADMRLTERAYHL
MNMG_PHOV8       ---PFTLGRDEAYIGVLIDDLVTKGVD-EPYRMFTSRAEYRILLRQDDADMRLTERAYKL
MNMG_PARD8       ---PFILGRDEAYIGVLIDDLVTKGVD-EPYRMFTSRAEYRILLRQDDADMRLTEKSYQM
MNMG_PORGI       ---EFTLGRDEAYIGVLIDDLVSKGVD-EPYRMFTSRAEYRILLRQDDADMRLTPKAEAI
MNMG_FLAJ1       ---PLILKRDEAYIGVLIDDLITKGTE-EPYRMFTSRAEYRTLLRQDNADFRLTPMSFEI
MNMG_FLAPJ       ---PLILKRDEAYIGVLIDDLITKGTE-EPYRMFTSRAEFRTLLRQDNADFRLTPMSNTL
MNMG_GRAFK       ---EFILKRNEAYIGVLIDDLITKGTE-EPYRMFTSRAEYRTLLRQDNADFRLTERSYNL
MNMG_CYTH3       ---ALILKRSEAYIGVLIDDLVNKGTE-EPYRMFTSRAEYRILLRQDNADLRLTPIGYEI
MNMG_SULMW       ---PFILKRNEAYIGVLIDDLIYKGTE-EPYRMFTSRAEYRILLRQDNADERLTHMGINL
MNMG_SALRD       ---PIVLKRSEAYIGVLIDDLVAKGTD-EPYRMFTSRAEHRILLRQDNADQRLTELGHKL
MNMG_BORAP       ---PMILTRTSSYIGVLIDDLVTKGTK-EPYRMFTSRAEHRLNLRHDTSDKRLIKIGYDL
MNMG_BORBP       ---PMILTRTSSYIGVLIDDLVTKGTK-EPYRMFTSRAEHRLNLRHDTSDKRLIKIGYDL
MNMG_BORBU       ---PMILTRTSSYIGVLIDDLVTKGTK-EPYRMFTSRAEHRLNLRHDTSDKRLIKIGYDL
MNMG_TREDE       -YVPFVLKRDEAYIGVMIDDLVTQGVD-EPYRMFTARAEYRLNLRHDTADERLTERAYQI
MNMG_TREPA       -YHPFVLKRDEAYIGVMIDDLVTQGID-EPYRMFTARAEYRLKLRHDTADERLTEKAYAI
MNMG1_FUSNN      ---PVIIDRSEAYIGVLIDDLIHKKTP-EPYRVLPSRAEYRLTLRYDNAFMRLFDKIKEV
MNMG2_FUSNN      ---PVILDRADSYIGTLIDDLVSKGTN-EPYRMFTARSEYRLYLREDNADLRLTKLGYEL
MNMG_ENDTX       ---PFILERNESYIGILVDDITTKGMD-EPYRMFTSRAEYRLSIRNDNADLRLMDAGHSI
MNMG_ONYPE       ---PFVLKRNEAYIGVLIDDLITKGAK-EPYRLLTSRAEFRLLLRHDNADLRLKDYGYQL
MNMG_AYWBP       ---PFVLKRNEAYIGVLIDDLITKGAK-EPYRLLTSRAEFRLLLRHDNADLRLKDYGYQL
MNMG_ACHLI       ---PLVLKRDEAYIGVLIDDLITKGTS-EPYRLLTSRAEHRLLLRNDNADIRLRDYGYQI
MNMG_MYCCT       ---PIILRRDEAYIGVMIDDLINKGVW-EPYRLLTSRAEHRLLLRNDNAETRLKQYGREI
MNMG_MYCMS       ---PIILRRDEAYIGVMIDDLINKGVW-EPYRLLTSRAEHRLLLRNDNAETRLKQYGKEI
MNMG_MESFL       ---PLILRRDEAYIGVMIDDLINKGVW-EPYRLLTSRAEHRLLLRNDNAEHRLKEKGYEI
MNMG_MYCGE       ---PFILQRNEAYIGVMINDLVTKTIS-DPYRLLTSRAEYRLWLRNDNVQERLIKKSFEL
MNMG_MYCPN       ---EFVLQRNEAYLGVMINDLVTKEIS-DPYRLLTSRAEHRLWLRNDNLQERLIEKSRAL
MNMG_MYCGA       ---PLILSRDEAYIGVMIDDIVNKGVT-DPYRLLTSRAEYRLLLRNDNVLDRLIQKGYEI
MNMG_UREPA       ---PVILGRDQAYIGVMIDDIVTKGVV-EPYRLLTSRAEHRLALRNDNADDRLMKIGFEI
MNMG_UREP2       ---PVILGRDQAYIGVMIDDIVTKGVV-EPYRLLTSRAEHRLALRNDNADDRLMKIGFEI
MNMG_MYCPE       ---PLVLKRNEAYIGVLIEDLINKEIT-DPYRLLTSRAEYRLELRNDNADQRLLKYGYEL
MNMG_MYCH7       ---PVEILRNDGYIGVLIDDLVTKGTK-EPYRMLTSRAEYRLILRNDNADIRMAKYALKS
MNMG_MYCHJ       ---PVEILRNDGYIGVLIDDLVTKGTK-EPYRMLTSRAEYRLILRNDNADIRMAKYALKS
MNMG_MYCH2       ---PVEILRNDGYIGVLIDDLVTKGTK-EPYRMLTSRAEYRLILRNDNADIRMAKYALKS
MNMG_MYCPU       ---EIVIQRNHGYIGVLIDDLVTKGTQ-EPYRMLTSRAEYRLLLRNDNVDIRLAHYGLKA
MNMG_MYCS5       ---PLVLKRSDAYIGVLIDDLVIKGTK-EPYRMLTSRAEYRLLLRHDNSDYRLSKYGYKL
MNMG_MYCMO       ---ALNLKRSDSYIGVLIDDLTTKGTK-EPYRMLTSRAEYRLLLRNDNADIRLLKYAKYA
MNMG_MYCAP       ---PIVILRNHGYIGVLIDDLVTKGTK-EPYRMLTSRAEYRLLLRNDNADDRLSEYAYNS
MNMG_THEM4       ---PLILKRSESYIGILIDDLTTKGVD-EPYRLLTSRAEYRLLLRHDNAHIRLAKYGYRV
MNMG_FERNB       ---PIVLKRSESYIGVMIDDLVTKGVD-EPYRLLSSRAEYRLLLRHDNAHLRLAKYGYQV
MNMG_THEMA       ---PLILKRSEAYIGVLIDDLVTKGVD-EPYRLLTSRAEYRLLLRHDNAHLRLAKYGYRV
MNMG_THESQ       ---PLILKRSEAYIGVLIDDLVTKGVD-EPYRLLTSRAEYRLLLRHDNAHLRLAKYGYRV
MNMG_THEP1       ---PLILKRSEAYIGVLIDDLVTRGVD-EPYRLLTSRAEYRLLLRHDNAHLRLAKYGYRV
MNMG_PETMO       ---PFVLDRSEAYLGVLIDDLITKGVD-EPYRLLTSRAEYRLLLRHDNAHLRLYKYGYKY
MNMG_BDEBA       ---EFILGRDQAYMGVMIDDLVTKGTR-EPYRMFTSRAEHRLVLREDNTIDRLSDLGRKL
MNMG_ALKMQ       ---PFVLDRSEAYIGVLIDDLVTKGTN-EPYRMMTSRAEYRLILRQDNADMRLTEKSYKI
MNMG_ALKOO       ---PFILDRSEAYIGVLIDDLVTKGTN-EPYRMMTSRSEYRLVLRQDNADLRLTEKGYAL
MNMG_CLOD6       ---PFVLDRSEAYIGVLLDDLVTKGTN-EPYRMMTSRAEYRLYLRQDNADMRLTQKGYDI
MNMG_FINM2       ---PFVLDRSDAYIGVLIDDLVTKGTN-EPYRMMTSRCEYRLTLRQDNADLRLTERAHEI
MNMG_CALS8       ---MLVLDRSQAYIGVLIDDLVTKGTN-EPYRIMTSRAEYRLILRQDNADLRLTEIGYRI
MNMG_ACET2       ---PLILDRSQAYIGVLIDDIVTKGTN-EPYRMMTSRAEYRLLLRQDNADLRLTPIGYEV
MNMG1_CALS4      ---PVVLDRSQAYIGILIDDLVTKGTN-EPYRMLTSRAEYRLLLRQDNADFRLTEIGKEI
MNMG2_CALS4      ---PLILDRSQAYIGILIDDLVTKGTN-EPYRMLTSRAEYRLILRQDNADFRLTEIGKEI
MNMG_THEP3       ---SVILDRSQAYIGVLIDDLVTKGTN-EPYRMLTSRAEYRLLLRQDNADFRLTELGYKI
MNMG_THEPX       ---SVILDRSQAYIGVLIDDLVTKGTN-EPYRMLTSRAEYRLLLRQDNADFRLTELGYKI
MNMG_CLOB1       ---PLILKRSDAYIGVLIDDLVTKGTN-EPYRMMTSRAEYRLLLRQDNADLRLTELGYKV
MNMG_CLOBH       ---PLILKRSDAYIGVLIDDLVTKGTN-EPYRMMTSRAEYRLLLRQDNADLRLTELGYKV
MNMG_CLOBL       ---PLILKRSDAYIGVLIDDLVTKGTN-EPYRMMTSRAEYRLLLRQDNADLRLTELGYKV
MNMG_CLOBK       ---PLILKRSDAYIGVLIDDLVTKGTN-EPYRMMTSRAEYRLLLRQDNADLRLTELGYKV
MNMG_CLOBM       ---PLILKRSDAYIGVLIDDLVTKGTN-EPYRMMTSRAEYRLLLRQDNADLRLTEMGYRI
MNMG_CLONN       ---PLILKRSDAYIGVLIDDLVTKGTQ-EPYRMMTSRAEYRLLLRQDNADLRLTEMGHKI
MNMG_CLOAB       ---PLILGRSDGYIGVLIDDLVTKGTN-EPYRMMTSRAEYRLLLRQDNADLRLTELGHKI
MNMG_CLOTE       ---PLLLTRSDGYIGVLIDDLVTKGTN-EPYRMMTSRSEYRLLLRQGNADLRLTQKGYDV
MNMG_CLOK5       ---PFILKRSDAYIGVLIDDLVTKGTE-EPYRMMTSRSEYRLILRQDNADLRLTEMGYKI
MNMG_CLOP1       ---PMILTRSDGYVGVLIDDLITKGTN-EPYRMMTSRAEYRLLLRQDNADFRLTEIGHNV
MNMG_CLOPS       ---PMILTRSDGYVGVLIDDLITKGTN-EPYRMMTSRAEYRLLLRQDNADFRLTEIGHNV
MNMG_CLOPE       ---PMILTRSDGYVGVLIDDLITKGTN-EPYRMMTSRAEYRLLLRQDNADFRLTEIGHNV
MNMG_CLOB8       ---PLILTRSDAYIGVLIDDLVTKGTN-EPYRMMTSRAEYRLLLRQDNADFRLTNLGYRV
MNMG_LACP7       ---PIVLDRSQAYIGVLIDDLVTKETH-EPYRMMTSRAEYRLILRQDNADQRLTRIGHEI
MNMG_NATTJ       ---PVIIKRSQGYIGVLIDDLVTKGTQ-EPYRMLTSRAEYRLILRQDNADLRLTELGYQV
MNMG_BACVZ       ---EVILSRSDAYIGVLIDDLVTKGTN-EPYRLLTSRAEYRLLLRHDNADLRLTEIGHDI
MNMG_BACSU       ---EVILSRSDAYIGVLIDDLVTKGTN-EPYRLLTSRAEYRLLLRHDNADLRLTEIGHRI
MNMG_BACLD       ---EVILSRSDAYIGVLIDDLVTKGTN-EPYRLLTSRAEYRLLLRHDNADLRLTEIGYQI
MNMG_BACP2       ---EVILSRSDAYIGVLIDDLVTKGTN-EPYRLLTSRAEYRLLLRHDNADLRLTELGYHI
MNMG_BACAH       ---EVILGREDAYIGVLIDDLVTKGTN-EPYRLLTSRAEYRLLLRHDNADLRLTEVGHEI
MNMG_BACHK       ---EVILGREDAYIGVLIDDLVTKGTN-EPYRLLTSRAEYRLLLRHDNADLRLTEVGHEI
MNMG_BACAN       ---EVILGREDAYIGVLIDDLVTKGTN-EPYRLLTSRAEYRLLLRHDNADLRLTEVGHEI
MNMG_BACCZ       ---EVILGREDAYIGVLIDDLVTKGTN-EPYRLLTSRAEYRLLLRHDNADLRLTEIGREI
MNMG_BACC1       ---EVILGREDAYIGVLIDDLVTKGTN-EPYRLLTSRAEYRLLLRHDNADLRLTEIGHEI
MNMG_BACCR       ---EVVLGREDAYIGVLIDDLVTKGTN-EPYRLLTSRAEYRLLLRHDNADLRLTEVGREI
MNMG_BACMK       ---EVILGRADAYIGVLIDDLVTKGTN-EPYRLLTSRAEYRLLLRHDNADLRLTEVGREI
MNMG_BACCN       ---EVILGRSDAYIGVLIDDLVTKGTN-EPYRLLTSRAEYRLLLRHDNADLRLTEIGHEI
MNMG_GEOKA       ---EIILSRSDAYIGVLIDDLVTKGTN-EPYRLLTSRAEYRLLLRHDNADLRLTELGYRI
MNMG_GEOTN       ---EIILSRSDAYIGVLIDDLVTKGTN-EPYRLLTSRAEYRLLLRHDNADLRLTELGYRI
MNMG_LYSSC       ---ELILSRSDAYIGVLIDDLVTKGTN-EPYRLLTSRAEYRLLLRHDNADLRLLELAYKI
MNMG_STAA2       ---EKILSRSDAYIGVLIDDLVTKGTN-EPYRLLTSRAEYRLLLRHDNADLRLTDMGYEL
MNMG_STAA9       ---EKILSRSDAYIGVLIDDLVTKGTN-EPYRLLTSRAEYRLLLRHDNADLRLTDMGYEL
MNMG_STAAR       ---EKILSRSDAYIGVLIDDLVTKGTN-EPYRLLTSRAEYRLLLRHDNADLRLTDMGYEL
MNMG_STAAS       ---EKILSRSDAYIGVLIDDLVTKGTN-EPYRLLTSRAEYRLLLRHDNADLRLTDMGYEL
MNMG_STAA1       ---EKILSRSDAYIGVLIDDLVTKGTN-EPYRLLTSRAEYRLLLRHDNADLRLTDMGYEL
MNMG_STAAM       ---EKILSRSDAYIGVLIDDLVTKGTN-EPYRLLTSRAEYRLLLRHDNADLRLTDMGYEL
MNMG_STAAW       ---EKILSRSDAYIGVLIDDLVTKGTN-EPYRLLTSRAEYRLLLRHDNADLRLTDMGYEL
MNMG_STAAN       ---EKILSRSDAYIGVLIDDLVTKGTN-EPYRLLTSRAEYRLLLRHDNADLRLTDMGYEL
MNMG_STAAB       ---EKILSRSDAYIGVLIDDLVTKGTN-EPYRLLTSRAEYRLLLRHDNADLRLTDMGYEL
MNMG_STAA8       ---EKILSRSDAYIGVLIDDLVTKGTN-EPYRLLTSRAEYRLLLRHDNADLRLTDMGYEL
MNMG_STAA3       ---EKILSRSDAYIGVLIDDLVTKGTN-EPYRLLTSRAEYRLLLRHDNADLRLTDMGYEL
MNMG_STAAC       ---EKILSRSDAYIGVLIDDLVTKGTN-EPYRLLTSRAEYRLLLRHDNADLRLTDMGYEL
MNMG_STAAE       ---EKILSRSDAYIGVLIDDLVTKGTN-EPYRLLTSRAEYRLLLRHDNADLRLTDMGYEL
MNMG_STAAT       ---EKILSRSDAYIGVLIDDLVTKGTN-EPYRLLTSRAEYRLLLRHDNADLRLTDMGYEL
MNMG_STAES       ---EKILSRSDAYIGVLIDDLVTKGTN-EPYRLLTSRAEYRLLLRHDNADLRLTDMGYEL
MNMG_STAEQ       ---EKILSRSDAYIGVLIDDLVTKGTN-EPYRLLTSRAEYRLLLRHDNADLRLTDMGYEL
MNMG_STAHJ       ---EKILSRSDAYIGVLIDDLVTKGTN-EPYRLLTSRAEYRLLLRHDNADLRLTDVGYEL
MNMG_STAS1       ---EVILSRSDAYIGVLIDDLITKGTN-EPYRLLTSRAEYRLLLRHDNADLRLTDLGYEL
MNMG_LISMO       ---PVILGRDQAYIGVLIDDLVTKGTE-EPYRLLTSRAEYRLLLRHDNADLRLTEIGHEI
MNMG_LISMF       ---PVILGRDQAYIGVLIDDLVTKGTE-EPYRLLTSRAEYRLLLRHDNADLRLTEIGHEI
MNMG_LISIN       ---PVILGRDQAYIGVLIDDLVTKGTE-EPYRLLTSRAEYRLLLRHDNADLRLTEIGHEI
MNMG_LISW6       ---PIILGRDQAYIGVLIDDLVTKGTE-EPYRLLTSRAEYRLLLRHDNADLRLTEIGHEI
MNMG_OCEIH       ---PIILDRSQAYIGVMIDDLVTKGTN-EPYRLLTSRAEYRLLLRHDNADLRLTDIGYDY
MNMG_BACSK       ---GVILDRSEAYIGVLIDDLVTKGTN-EPYRLLTSRAEFRLILRHDNADLRLTEKGYEL
MNMG_ALKHC       ---GLILDRSEAYIGVLIDDLVTKGTN-EPYRLLTSRAEYRLLLRHDNADLRLTEKGYEI
MNMG_EXIS2       ---PLILSRSQGYIGVMIDDLVTKGTN-EPYRLLTSRAEYRLLLRHDNADLRLSDIGYDL
MNMG_LEVBA       ---GFTLKRSDAYIGVMVDDLVTKGTK-EPYRLLTSRAEYRLILRHDNADLRLTAKGHEL
MNMG_LACPL       ---QFTLKRSDAYIGVMIDDLVTKGTN-EPYRLLTSRAEYRLILRHDNADLRLTDKGREL
MNMG_PEDPA       ---PLTLKRSDAYIGVMIDDLVTKGTK-EPYRLLTSRAEYRLILRHDNADLRLTEVGHNL
MNMG_LACS1       ---EITLKRSDAYIGVMIDDLVTKGTN-EPYRLLTSRAEYRLILRHDNADLRLTELGHEI
MNMG_ENTFA       ---PLVLKRSDGYIGVMIDDLVTKGTN-EPYRLLTSRAEYRLILRHDNADLRLTEMGHEI
MNMG_LACSS       ---PFILDRSEAYIGVLIDDLVTKGTK-EPYRLLTSRAEYRLMLRHDNADLRLTEKGHEL
MNMG_LACP3       ---PFTLKRSDAYIGVMIDDLVTKGTN-EPYRLLTSRAEYRLLLRHDNADLRLKPMGHEL
MNMG_LACAC       ---GFTLGRNDAYIGVLIDDLVTKGTN-EPYRLLTSRAEYRLILRHDNADLRLTEYGHKL
MNMG_LACH4       ---GFTLGRNDAYIGVLIDDLVTKGTN-EPYRLLTSRAEYRLILRHDNADLRLTEYGHEL
MNMG_LACJO       ---GFTLQRDEAYIGVLIDDLVTKGTN-EPYRLLTSRAEYRLLLRHDNADLRLTEKGHEL
MNMG_LACGA       ---GFTLQRDEAYIGVLIDDLVTKGTN-EPYRLLTSRAEYRLLLRHDNADLRLTEKGHEL
MNMG_LACDA       ---AFTLGRDEAYIGVLIDDLVTKGTE-EPYRLLTSRAEYRLLLRHDNADLRLTEKGHDL
MNMG_LACDB       ---AFTLGRDEAYIGVLIDDLVTKGTE-EPYRLLTSRAEYRLLLRHDNADLRLTEKGHDL
MNMG_LACLM       ---EFILKRSEAYIGVMIDDLVTKGTL-EPYRLLTSRAEYRLILRHDNADRRLTEIGRQV
MNMG_LACLS       ---EFILKRSEAYIGVMIDDLVTKGTL-EPYRLLTSRAEYRLILRHDNADRRLTEIGRQV
MNMG_LACLA       ---EFILKRSEAYIGVMIDDLVTKGTL-EPYRLLTSRAEYRLILRHDNADRRLTEIGRQV
MNMG_STRA3       ---ELILKRSDAYIGVMIDDLVTKGTL-EPYRLLTSRAEYRLILRHDNADMRLTEIGYEI
MNMG_STRA5       ---ELILKRSDAYIGVMIDDLVTKGTL-EPYRLLTSRAEYRLILRHDNADMRLTEIGYEI
MNMG_STRA1       ---ELILKRSDAYIGVMIDDLVTKGTL-EPYRLLTSRAEYRLILRHDNADMRLTEIGYEI
MNMG_STRP1       ---ELILKRSDAYIGVMIDDLVTKGTL-EPYRLLTSRAEYRLILRHDNADMRLTEIGRDI
MNMG_STRPD       ---ELILKRSDAYIGVMIDDLVTKGTL-EPYRLLTSRAEYRLILRHDNADMRLTEIGRDI
MNMG_STRPB       ---ELILKRSDAYIGVMIDDLVTKGTL-EPYRLLTSRAEYRLILRHDNADMRLTEIGRDI
MNMG_STRPC       ---ELILKRSDAYIGVMIDDLVTKGTL-EPYRLLTSRAEYRLILRHDNADMRLTEIGRDI
MNMG_STRPG       ---ELILKRSDAYIGVMIDDLVTKGTL-EPYRLLTSRAEYRLILRHDNADMRLTEIGRDI
MNMG_STRP8       ---ELILKRSDAYIGVMIDDLVTKGTL-EPYRLLTSRAEYRLILRHDNADMRLTEIGRDI
MNMG_STRPF       ---ELILKRSDAYIGVMIDDLVTKGTL-EPYRLLTSRAEYRLILRHDNADMRLTEIGRDI
MNMG_STRPM       ---ELILKRSDAYIGVMIDDLVTKGTL-EPYRLLTSRAEYRLILRHDNADMRLTEIGRDI
MNMG_STRP3       ---ELILKRSDAYIGVMIDDLVTKGTL-EPYRLLTSRAEYRLILRHDNADMRLTEIGRDI
MNMG_STRP6       ---ELILKRSDAYIGVMIDDLVTKGTL-EPYRLLTSRAEYRLILRHDNADMRLTEIGRDI
MNMG_STRT2       ---ELILKRSDAYIGVMIDDLVTKGTL-EPYRLLTSRAEYRLILRHDNADMRLTPIGREV
MNMG_STRT1       ---ELILKRSDAYIGVMIDDLVTKGTL-EPYRLLTSRAEYRLILRHDNADMRLTPIGREV
MNMG_STRTD       ---ELILKRSDAYIGVMIDDLVTKGTL-EPYRLLTSRAEYRLILRHDNADMRLTPIGREV
MNMG_STRMU       ---ELILKRSDAYIGVMIDDLVTKGTL-EPYRLLTSRAEYRLILRHDNADLRLTEIGHQV
MNMG_STRGC       ---ELILKRSDGYIGVMIDDLVTKGTV-EPYRLLTSRAEYRLILRHDNADMRLTEMGREI
MNMG_STRSV       ---ELILKRSDGYIGVMIDDLVTKGTV-EPYRLLTSRAEYRLILRHDNADMRLTEMGREI
MNMG_STRR6       ---ELILKRSDGYIGVMIDDLVTKGTI-EPYRLLTSRAEYRLILRHDNADMRLTEMGREI
MNMG_STRP2       ---ELILKRSDGYIGVMIDDLVTKGTI-EPYRLLTSRAEYRLILRHDNADMRLTEMGREI
MNMG_STRPN       ---ELILKRSDGYIGVMIDDLVTKGTI-EPYRLLTSRAEYRLILRHDNADMRLTEMGREI
MNMG_STRPI       ---ELILKRSDGYIGVMIDDLVTKGTI-EPYRLLTSRAEYRLILRHDNADMRLTEMGREI
MNMG_STRSY       ---ELILKRSDGYIGVMIDDLVTKGTV-EPYRLLTSRAEYRLILRHDNADMRLTEIGRQV
MNMG_STRS2       ---ELILKRSDGYIGVMIDDLVTKGTV-EPYRLLTSRAEYRLILRHDNADMRLTEIGRQV
MNMG_DESRM       ---PFYLSRSEAYIGVLIDDLVVKGTN-EPYRLMTARAEYRLLLRQDNADHRLTQKGYNI
MNMG_PELTS       ---PFILNRSEAYIGVLIDDLVTKEID-EPYRMLTSRAEYRLLLRQDNADLRLTEKGYKI
MNMG_CARHZ       ---PFILKRSEAYIGVMIDDLVTKGVT-DPYRLLTSRAEYRLLLRHDNADLRLTEKGYKI
MNMG_MOOTA       ---PLILRRDQAYIGVLIDDLVTRGVT-EPYRLLTSRAEHRLLLREDNADLRLGRIGYEI
MNMG_HELMI       ---PLVLKRSDAYIGVLIDDLVTKGTN-EPYRMLTSRAEYRLLLRQDNADQRLTEIGRSI
MNMG_SYNWW       ---PFILKRSEAYIAVMIDDLINKEIV-EPYRLLTSRAEYRLLLRQDNADLRLTEKGRQI
MNMG_DESAP       ---PLVVSRAQAYIGVLIDDLVTKGTR-EPYRIFTSRAEYRLALRQDNADLRLTERAHRI
MNMG_SYMTH       ---PLVISRSEGYIGVLIDDLVTKGSP-EPYRMLTSRAEFRMMLRQDNAHLRLTEKGREY
MNMG_DESHY       ---PFIVRRSEGYLGVLIDDLVNKGVK-EPYRLLTSRAEYRLILRQDNADLRLTPRGREV
MNMG_ROSCS       ---PIILRRDEAYIGVLIDDLITKEIR-EPYRMFTSRAEHRLLLRTDNADLRLTRLAGEL
MNMG_ROSS1       ---SVLLRRDEAYIGVLIDDLVTKEIR-EPYRMFTSRAEHRLLLRADNADLRLTPLAGEL
MNMG_CHLAA       ---PVILGRAEAYIGVLIDDLTTKEIR-EPYRMFTSRAEYRLLLRGDNADLRLTPLAYRL
MNMG_DEIRA       ---EQVIGRETSYLGVLLDDLVFKGSD-EPYRMMTSRVEHRLLVRQDNADERMTPIGHAL
MNMG_DEIGD       ---ELQISRETSYLGVLLDDLVLKGSD-EPYRMMTSRVEHRLIVRQDNADERLTELGVKL
MNMG_THET2       ---EVHLPRESGYIGVLVDDLVGRGTD-EPYRMMTSRVELRLLCRADNADERLTPLAVAW
MNMG_THET8       ---EVHLPRESGYIGVLVDDLVGRGTD-EPYRMMTSRVELRLLCRADNADERLTPLAVAW
MNMG_MYXXD       ---PLLPGRDEAHGAVLVDDLVTKGVD-EPFRMFTSRSEHRLKLREGNADLRLARHGHRV
                         *  .: . : :*:       :*:*::..  * *   .      *:       

MNMG_NOSS1       GLIDDRRWQMFTRKQEQITGEKERLYATRVKENDD------VGKAIASNTQQAIKGSITL
MNMG_TRIV2       GLIDDRRWQLFTRKQEQITGEKERLYATRVKENDE------VGKAIASNTQQAIKGSITL
MNMG_TRIEI       GLIDDRRWELFESKQANINSEKSRLNSTRIKELDE------VAINIVADTHTKIKGSITL
MNMG_SYNY3       GLIDDRRWDLFQTKQANITAEKERLYSTRIKEQDA------VGKEIVDYTQQKIKGSIVL
MNMG_SYNP2       GLIGDRRWALYQTKQENIAAEKERLHTERVKELDP------LGQKIAADTGQKIKSSVTL
MNMG_MICAN       GLIDNRRWQLFQSKQANIIAEKERLHETRIKERDQ------VAIAIVKDTEQKIKGSLSL
MNMG_ACAM1       GLIDDRRWHLFTRKQATITAEKERLHATRLKERDP------AAQAIVQTTGEKIKGSITL
MNMG_SYNP6       GLIDDRRWALFEQKQARIAAEQTRLTQQRVKEHDP------VGQAIAQQTQAPIKGSATL
MNMG_SYNE7       GLIDDRRWALFEQKQARIAAEQTRLTQQRVKEHDP------VGQAIAQQTQAPIKGSATL
MNMG_THEEB       GLVSEAQWQVFQAKQRRLAAETQRLQTTRIKAHEP------VGEAIVTATGQAIKSAIAL
MNMG_SYNJB       GLIDDRRWALFQAKQARIAAEIERLETQRVKAHDL------AGIQLSQLTGQGIKGSATL
MNMG_SYNJA       GLIDDRRWALFQAKQARIAAEIERLETQRVKAHDP------AGIHLSQLTGQGIKGSATL
MNMG_PROM1       GLIDERRWNIFNAKQQLINQEKERLDKERIKESDK------CAKEIFSSTGTPIKGSLTL
MNMG_PROMT       GLIDERRWKIFNAKQQLINQEKERLEKERIKESDK------SAKEIYSSTGTPIKGSLTL
MNMG_PROMA       GLVNDYQWNIFQIKQSNMEKEKKRLEQQRIKDSDP------IALKIEKESGASIKGSITL
MNMG_PROM3       GLIDARRWQLFQSKQTALEDEKQRLEKQRIKASDP------AAPALEAKTGAKIKGSITL
MNMG_PROMM       GLIDARRWQLFQRKQTALEDEKQRLEKQRLKASDP------AAPALEAKTGATIKGSITL
MNMG_SYNSC       GLIDDRRWQLFEDKLQAMEGEKQRLETVRLKVSDP------VAPAVEQETGAAIKGSITL
MNMG_SYNPX       GLIDDRRWQLFEDKLQAMEREKQRLETVRLKVSDP------VAPAVEEETGAAIKGSITL
MNMG_SYNS9       GLIDDRRWQLFEEKLQAMDAEKKRLESTRLKVSDP------IAPTVEEETGAPIKGSITL
MNMG_SYNPW       GLIDDRRWRLFEDKLQAMEAEKQRLEQQRLKVSDP------AAPAVEQETGAPIKGSITL
MNMG_SYNS3       GLIDDRRWQLFNDKLQAMEEEKQRLETVRLKVSDP------VASTVEKESGAPIRGSITL
MNMG_SYNR3       GLIDARRWQIYERKQEGIAAETKRLETVRLKVSDP------VAPAVVEQTGAAIKGSITL
MNMG_PROMS       GLINEKRWSAYQEKMNLLEEEKFRLNNTRLKNTDE------ISKKIELETGSKIKGSTTL
MNMG_PROM0       GLINEKRWSAYQEKMKLLEEEKFRLNKTRLKNTEE------ISKKIELETGSKIKGSITL
MNMG_PROM9       GLIDEKRWWAYQEKMNLLEEEKLRLNNTRLKNTDE------ISKNIELDTGSKIKGSTTL
MNMG_PROM2       GLIDEKRWSAYEEKMKLLEEEKLRLNNTRLKNTDE------ISKKIELDTGSKIKGSTTL
MNMG_PROM5       GLIDERRWFAHKEKMKLLKEENSRLENTRLKCTDE------IARNIELESGSKIKGSTTL
MNMG_PROMP       GLIDERRWLAHKKKMKSLKEENSRLENTRLKCTDE------IAKKIELDSGSKIKGSTTL
MNMG_CHLTR       GLLSSERYAMFQEQKACIEQEKERLS---------------------KTFRKYGDTVVPL
MNMG_CHLTA       GLLSSERYAMFQEQKACIEQEKERLS---------------------KTFRKYGDTVVPL
MNMG_CHLT2       GLLSSERYAMFQEQKACIEQEKERLS---------------------KTFRKYGDTVVPL
MNMG_CHLTB       GLLSSERYAMFQEQKACIEQEKERLS---------------------KTFRKYGDTVVPL
MNMG_CHLMU       GLLSSERYAMFQKQKNCIEHEKERLA---------------------KTFRKYGDSIVPL
MNMG_CHLAB       GLLSKERYEIFENQKQIIEEEKLRLS---------------------KTFKKYGNSVVSL
MNMG_CHLCV       GLLSQERYEIFENQKQIIEDEKARLN---------------------KTFKKYGNSVVSL
MNMG_CHLFF       GLLSKERYELFEHQKQIIEEEKLRLS---------------------KTFKKYGNSVVSL
MNMG_CHLPN       GLLSEERYELVKKQNQLLEEEKVRLQ---------------------KTFRQYGQSVVSL
MNMG_PARUW       GLVDQTRYDRVKEKQRIMEEESERLA---------------------KTFKQVSNKGYTL
MNMG_RHOBA       GLIDAARRERFHRKLAEIERGTELLQ---------------------QAKFQPETGPTVR
MNMG_OPITP       KLLNVNRLDNIARKKEAIESWVRRLE---------------------SER----TSEGTL
MNMG_AQUAE       GLLSEEQYKLVKELEREIEKWKEFYKSER------------------VSVAVGGDTRSYS
MNMG_ECOLI       GLVDDERWARFNEKLENIERERQRLKSTWVTPSAE-----AA-AEVNAHLTAPLSREASG
MNMG_ECOL6       GLVDDERWARFNEKLENIERERQRLKSTWVTPSAE-----AA-AEVNAHLTAPLSREASG
MNMG_ECO24       GLVDDERWARFNEKLENIERERQRLKSTWVTPSAE-----AA-AEVNAHLTAPLSREASG
MNMG_ECODH       GLVDDERWARFNEKLENIERERQRLKSTWVTPSAE-----AA-AEVNAHLTAPLSREASG
MNMG_ECOL5       GLVDDERWARFNEKLENIERERQRLKSTWVTPSAE-----AA-AEVNAHLTAPLSREASG
MNMG_ECOHS       GLVDDERWARFNEKLENIERERQRLKSTWVTPSAE-----AA-AEVNAHLTAPLSREASG
MNMG_ECOLC       GLVDDERWARFNEKLENIERERQRLKSTWVTPSAE-----AA-AEVNAHLTAPLSREASG
MNMG_SHIBS       GLVDDERWARFNEKLENIERERQRLKSTWVTPSAE-----AA-AEVNAHLTAPLSREASG
MNMG_SHISS       GLVDDERWARFNEKLENIERERQRLKSTWVTPSAE-----AA-AEVNAHLTAPLSREASG
MNMG_ECOUT       GLVDDERWARFNEKLENIERERQRLKSTWVTPSAE-----AA-AEVNAHLTAPLSREASG
MNMG_ECOK1       GLVDDERWARFNEKLENIERERQRLKSTWVTPSAE-----AA-AEVNAHLTAPLSREASG
MNMG_ECOSM       GLVDDERWARFNEKLENIERERQRLKSTWVTPSAE-----AA-AEVNAHLTAPLSREASG
MNMG_ECO57       GLVDDERWARFNEKLENIERERQRLKSTWVTPSAE-----AA-AEVNAHLTAPLSREASG
MNMG_SHIDS       GLVDDERWARFNEKLENIERERQRLKSTRVTPSAE-----AA-AEVNAHLTAPLSREASG
MNMG_SHIFL       GLVDDERWARFNEKLENIERERQRLKSTWVTPSAE-----AA-AEVNAHLTAPLSREASG
MNMG_SHIF8       GLVDDERWARFNEKLENIERERQRLKSTWVTPSAE-----AA-AEVNAHLTAPLSREASG
MNMG_SALCH       GLVDDERWARFNEKLENIERERQRLKSTWVTPSAE-----SA-DEVNAHLTTPLSREASG
MNMG_SALTY       GLVDDERWARFNEKLENIERERQRLKSTWVTPSAE-----SA-DEVNAHLTTPLSREASG
MNMG_SALPB       GLVDDERWARFNEKLENIERERQRLKSTWVTPSAE-----SA-DEVNAHLTTPLSREASG
MNMG_SALPA       GLVDDERWARFNEKLENIERERQRLKSTWVTPSAE-----SA-DEVNAHLTTPLSREASG
MNMG_SALTI       GLVDDERWARFNEKLENIERERQRLKSTWVTPSAE-----SA-DEVNAHLTTPLSREASG
MNMG_CITK8       GLVDDERWARFNEKLENIERERQRLKSTWVTPSAE-----SA-GEVNAHLTAPLSREASG
MNMG_SALAR       GLVDDERWARFNEKLENIERERQRLKSTWVTPSAE-----FA-ADVNAHLTTPLSREASG
MNMG_ENT38       GLVDDERWARFNEKLERIETERQRLKSTWVNPLAD-----SV-AEVNAHLAAPLSREASG
MNMG_KLEP7       GLVDDERWARYNEKLESIERERQRLKSTWVNPQAE-----SA-NEVNAHLTAPLSREASG
MNMG_CROS8       GLVDDARWARFNEKLENIERERQRLRSTWVTPSTA-----SV-EEINTMLTAPLSREASG
MNMG_PECAS       GMVDDHRWARFNEKLENIEKERQRLRDIHVHPQSE-----LL-DQVNSLLKTPLSREANG
MNMG_YERPE       GLVDDIRWAHFSQKVEQIEKERQRLRDIWVHPHSE-----NV-SEINALLKAPLSKEANG
MNMG_YERPY       GLVDDIRWAHFSQKVEQIEKERQRLRDIWVHPHSE-----NV-SEINALLKAPLSKEANG
MNMG_YERPA       GLVDDIRWAHFSQKVEQIEKERQRLRDIWVHPHSE-----NV-SEINALLKAPLSKEANG
MNMG_YERPN       GLVDDIRWAHFSQKVEQIEKERQRLRDIWVHPHSE-----NV-SEINALLKAPLSKEANG
MNMG_YERPP       GLVDDIRWAHFSQKVEQIEKERQRLRDIWVHPHSE-----NV-SEINALLKAPLSKEANG
MNMG_YERPS       GLVDDIRWAHFSQKVEQIEKERQRLRDIWVHPHSE-----NV-SEINALLKAPLSKEANG
MNMG_YERP3       GLVDDIRWAHFSQKVEQIEKERQRLRDIWVHPHSE-----NV-SEINALLKAPLSKEANG
MNMG_YERE8       GLVDDARWAHFSQKIEQIEKERQRLRDIWVHPHSE-----NV-AEINAVLKAPLSKEANG
MNMG_SERP5       GLVDDARWARFSEKLEHIEQERQRLRDIWMHPHAE-----NV-EQVNALLKAPLSREANG
MNMG_PHOLL       GLVDDSRWEHYCRKLEMVEQERQRLRNIWIHPNSN-----NL-NDINNILKMPLSKEANG
MNMG_SODGM       GMVDDVRWERFCAKQEQIERERQRLRDIWVHPGSD-----GV-EQLNPLLKASLTREANG
MNMG_VIBCH       GLVDDARWARFNQKIDNMAKERQRLQETWMNPNSV-----GV-EQLNTLLKTPMSREASG
MNMG_VIBC3       GLVDDARWARFNQKIDNMAKERQRLQETWMNPNSV-----GV-EQLNTLLKTPMSREASG
MNMG_VIBCB       GLIDDARWARFNEKIENMETERQRLKSTWMNPNSA-----GI-DELNKLLKTPMAREASG
MNMG_VIBPA       GLIDDVRWARFNEKIENMETERQRLKSTWVNPNSA-----GI-DELNKLLKTPMAREASG
MNMG_VIBVU       GLVDDARWARFNQKIDNMEQERQRLKSTWMNPAST-----GI-EELNQLLKSPMNREASG
MNMG_VIBVY       GLVDDARWARFNQKIDNMEQERQRLKSTWMNPAST-----GI-DELNQLLKTPMNREASG
MNMG_ALIF1       GLVDDVRWARFNEKVENMEQERQRLKDIWINPKSE-----QV-DQVNAILKTPIAREASG
MNMG_PHOPR       GLVDDDRWARFNQKVENIEQERQRLKDIWINPNSD-----HV-DEINKILKTPIAREANG
MNMG_AERHH       GLVDDERWGKFNAKMEQVEQERQRMRSTWIHPQHP-----SL-EAVNALVNTPLTREQSL
MNMG_AERS4       GLVDDERWGKFNIKMEQVELERQRMRSTWIHPQHP-----SL-EAVNALVNTPLTREQNL
MNMG_COLP3       GLVGDTRWQRFNEKMENVELERQRLRSTWVQKDHT-----KI-DQINALLKTPMSKEASL
MNMG_PSEA6       GLVDEERWQAFNIKLEAIELERQRLRDTWVHPKHA-----AA-EALNPLLKNALSKENTL
MNMG_IDILO       GLVDDERWAAFNKKMESVEQEKQRLKTTWVHKDHA-----SV-EQINALVKSPVTKEVSG
MNMG_PSET1       GLVNDERWQAYNEKMEVIAKEKQRIKDTWIHKDHT-----MI-DQVNALLKTPLTREASL
MNMG_SHEB5       GLVDDARWAAFSEKLESIELELQRLRGQWVHPNSP-----LI-HALNPHLNTPISREASF
MNMG_SHEB8       GLVDDARWAEFSEKLESIELELQRLRGQWVHPNSP-----LI-HALNPHLNTPISREASF
MNMG_SHEB9       GLVDDARWAAFSEKLESIELELQRLRGQWVHPNSP-----LI-HALNPHLNTPISREASF
MNMG_SHEPC       GLVDDIRWAAFSEKLESIELELQRLRAQWVHPNSP-----LI-HALNPHLNTPISREASF
MNMG_SHESW       GLVDDIRWAAFSEKLESIELELQRLRAQWVHPNSP-----LI-HALNPHLNTPISREASF
MNMG_SHESM       GLVDDARWASFSEKLESIELELQRLRSQWIHPNSP-----LV-PVLNPHLNTPISREASF
MNMG_SHESR       GLVDDARWASFSEKLESIELELQRLRSQWIHPNSP-----LV-PVLNPHLNTPISREASF
MNMG_SHESA       GLVDDARWASFSEKMESIELELQRLRSQWIHPNSP-----LV-PVLNPHLNTPISREASF
MNMG_SHEON       GLVDDARWAAFSEKMESIELELQRLRSQWIHPNSP-----LV-PVLNPHLNTPISREASF
MNMG_SHEDO       GLVNDDRWAKFTEKRESIELELQRLRGQWIHPNSP-----LL-GVLNPELNTPISREASF
MNMG_SHEFN       GLVDDKRWESFIAKRESIELELQRLRSQWVHPNSA-----LL-GVLNPELNTPISREASF
MNMG_SHEHH       GLVDDKRWALFSEKMESIETELQRLRGQWIHPNSP-----LV-EALNPNLNTPITREATF
MNMG_SHEPA       GLVDDNRWALFSEKMESIETELQRLRGQWVHPNSP-----LV-EALNPHLNTPITREATF
MNMG_SHESH       GLVDEDRWAKFNKKRESIELELQRLRSQWVHPNSP-----LL-EVLNPELNTPISREASF
MNMG_SHEWM       GLVDDERWAKFSEKRESIELELQRLRSQWVHPNSP-----LI-DVLNPELNTPISREASF
MNMG_SHELP       GLVDDDRWAKFNAKREAIELELQRLRSQWIHPNSP-----LV-DALNPHLNTPITREATF
MNMG_SHEAM       GLVDDFRWQKFSEKRESIELEQQRLRGQWVHVNSP-----QV-AELNEVLSAPLTREASL
MNMG_PSYIN       GLVDDIRWKAFSMKQESVETEIQRLKNQWIHPKSE-----NA-SQINALLKTPMQRESTL
MNMG_ACTP2       GLIDDARWARFNQKMENIERERERLKQIWIHPQSE-----HL-AVVNELVNSPLTREASG
MNMG_ACTPJ       GLIDDARWARFNQKMENIERERERLKQIWIHPQSE-----HL-AVVNELVNSPLTREASG
MNMG_HAEDU       GLIDEARWQRFNQKMENIERERERLKQIWIHPQSA-----YV-DAVNQLVNSPLTREVNG
MNMG_HAEIN       GLIDEARWARFNQKMENIEQERQRLRSIWLHPRSE-----YL-EEANKVLGSPLVREASG
MNMG_HAEIG       GLIDEARWARFNQKMENIEQERQRLRSIWLHPRSE-----YL-EEANKVLGSPLVREASG
MNMG_HAEIE       GLIDDARWARFNQKMENIEQERQRLRNIWLHPRSE-----YL-EEANKVLGSPLVREASG
MNMG_HAEI8       GLIDEARWARFNQKMEKIEQERQRLRSIWLHPRSE-----YL-EEANKVLGSPLVREASG
MNMG_HAES1       GLIDDIRWARFNQKMENIELERQRLRSIWLHPRSE-----YL-NEANEILKSPLIREVNG
MNMG_HISS2       GLIDDIRWARFNQKMENIELERQRLRSIWLHPRSE-----YL-NEANEILKSPLVREVNG
MNMG_MANSM       GLIDENRWARFNQKMENIERERQRLRNIWIHPRSE-----HL-DVINEVLSSPLVREASG
MNMG_PASMU       GLIDEKRWARFNQKMENIELERQRLRQIWLHPRSE-----YL-DEANKVLGSPLVREASG
MNMG_ACTSZ       GLIDEARWARFNRKMDNITKERERLKQIWIHPQSE-----HL-NHINGLLNAPLTREASG
MNMG_HYDCU       GLVDDARWLSFEGKMETMEAELARLKQTWIHPKHA-----EA-KKAEALMDLPLSKEQTL
MNMG_ACIAC       GLVDDARWDAFSRKRDAVARETERLKSTWVNPRNL-----PA-EESARVLGKSIEHEYNL
MNMG_ACISJ       GLVDDARWDAFSRKRDAVSRETERLKSTWVNPRNL-----PT-VEAERVLGKAIEHEYNL
MNMG_VEREI       GLVDDARWEVFSRKRDAVLRETERLKATWVNPRNL-----PD-IESGRVLGKPMAHEYSL
MNMG_POLNA       GLVDDARWDAFNRKRDIVSRETQRLRALWINPNNL-----PA-SEAERVLGKAIEREYNL
MNMG_POLSJ       GLVDDARWDAFSRKRDAVSRETERLRSLWVNPHNL-----PL-AEAERVLGKSIEREYNL
MNMG_RHOFT       GLVDDARWEAFSRKREAVSRETERLRSLWVSPKNL-----TA-TESERVLGKSIEHEYSL
MNMG_LEPCP       GLVDDVRWDAFNRKRDAVSRETERLKSTWVHPAIL-----PA-ADSERLFGKALEHEYNL
MNMG_METPP       GLVDDERWAAFNRKRDAVSRETERLKSTWVNAALL-----PA-ADAERLVGKALEHEYAL
MNMG_BURCA       GLVDDARWDAFSRKRDAVSRETERLKSTWVTPKTL-----PV-EEATALLGKAIDHEYSL
MNMG_BURCH       GLVDDARWDAFSRKRDAVSRETERLKSTWVTPKTL-----PV-EEATALLGKAIDHEYSL
MNMG_BURCC       GLVDDARWDAFSRKRDAVSRETERLKSTWVTPKTL-----PA-EEATALLGKAIEHEYSL
MNMG_BURCM       GLVDDARWDAFSRKRDAVSRETERLKSTWVTPKTL-----PP-EEATALLGKAIDHEYSL
MNMG_BURA4       GLVDDARWDAFSRKRDAVSRETERLKSTWVTPKTL-----PP-KEATALLGKAIDHEYSL
MNMG_BURL3       GLVDDTRWDAFSRKRDAVSRETERLKSTWVTPKTL-----PP-EEATALLGKAIDHEYSL
MNMG_BURVG       GLVDDVRWDAFSRKRDAVSRETERLKSTWVTPKTL-----PP-EEATALLGKPIDHEYSL
MNMG_BURMA       GVVDDVRWDAFNRKRDAVSRETERLRTTWVTPKTL-----PA-DEATALLGKPIDHEYSL
MNMG_BURM9       GVVDDVRWDAFNRKRDAVSRETERLRTTWVTPKTL-----PA-DEATALLGKPIDHEYSL
MNMG_BURP0       GVVDDVRWDAFNRKRDAVSRETERLRTTWVTPKTL-----PA-DEATALLGKPIDHEYSL
MNMG_BURM7       GVVDDVRWDAFNRKRDAVSRETERLRTTWVTPKTL-----PA-DEATALLGKPIDHEYSL
MNMG_BURMS       GVVDDVRWDAFNRKRDAVSRETERLRTTWVTPKTL-----PA-DEATALLGKPIDHEYSL
MNMG_BURP1       GVVDDVRWDAFNRKRDAVSRETERLRTTWVTPKTL-----PA-DEATALLGKPIDHEYSL
MNMG_BURPS       GVVDDVRWDAFNRKRDAVSRETERLRTTWVTPKTL-----PA-DEATALLGKPIDHEYSL
MNMG_BURP6       GVVDDVRWDAFNRKRDAVSRETERLRTTWVTPKTL-----PV-DEATALLGKPIDHEYSL
MNMG_BURTA       GVVDDVRWDAFNRKRDAVSRETERLRTTWVTPKTL-----PA-DEATELLGKPIDHEYSL
MNMG_PARXL       GVVDDVRWDAFSRKRDAVSRETERLRTTWVNPKTL-----SA-DEATALLGKPIDHEYSL
MNMG_CUPNH       GVVDDARWDAFNRKRDAVSRETERLKSTWVNPAML-----PG-EDAVPLLGKPIEREYSL
MNMG_CUPPJ       GVVDDVRWDAFNRKRDAVSRETERLKSTWVNPTIL-----PA-EDAVPLLGKPIEREYSL
MNMG_CUPMC       GVVDDVRWDAFNRKRDAVSRETERLKSTWVNPTLL-----PE-ADAVPLLGKGIEREYSL
MNMG_RALSO       GVVDDARWDAFNRKRDAVSRETERLKSTWVNPAIL-----PA-ADAEPVLGKGIEREYSL
MNMG_JANMA       GCVGDAQWAVFETKREAVARELERLRSTWVSPRIL-----AE-AEAERVLGKGIEREYAL
MNMG_HERAR       GCVGDVQWALFETKREAVARELERLRSTWVSPRIL-----AE-AEAERVLGKGIEREYAL
MNMG_BORBR       GLVDDVRWDAFSRKRDAVAQEVERLKSTWVNPRVL-----PA-HAAEALLGKAIEREYSL
MNMG_BORPA       GLVDDVRWDAFSRKRDAVAQEVERLKSTWVNPRVL-----PA-HAAEALLGKAIEREYSL
MNMG_BORPE       GLVDDVRWDAFSRKRDAVAQEVERLKSTWVNPRVL-----PA-HAAEALLGKAIEREYSL
MNMG_BORPD       GLVDDARWDAFSRKRDAVAAEVERLKSTWVNPRNF-----PA-ETAEPLLGKAIEREYSL
MNMG_BORA1       GLVDDIRWDVFNRKRDAIQAEVQRLQSTWVNPRLL-----PE-EPAQALLGKAIEREYAL
MNMG_AZOSB       GLVDDVRWAAFCAKREAIERETARLKTSLARPDLI-----PV-ADQERVLGKTLEREARY
MNMG_AROAE       GLVDDVRWAAFCEKRDAIERETARLRAAWAHPARV-----PA-VDAERVVGKALEREYRF
MNMG_DECAR       GLVDDVRWTAFCQKRDAIAAEQERLKSTWVNPKIT-----PA-DDCIRVLGKAIDHEYNL
MNMG_METFK       GLVDDVRWEAFQRKQEAIEREQQRLRRTFIHPQHV-----PQ-EQLQQVFGKVLEREYSM
MNMG_THIDA       GVVDDARWDQFNRKRDEVARETERLKSVWVNPAIL-----PA-DAATQLIGQPIEREYSL
MNMG_NITMU       GVVNDARWVAFNIKLEAIAQEQNRLKTTWLSPKSL-----SE-TDALRVIGKNIEHECSL
MNMG_NEIG1       GLVGEAQWRMFNEKREAVEREIQRLKTTWYTPQKL-----AE-DEQIRVFGQKLSREANL
MNMG_NEIMA       GLVGEAQWRMFNEKREAVEREIQRLKTTWYTPQKL-----AE-DEQIRVFGQKLSREANL
MNMG_NEIMB       GLVSEAQWRMFNEKREAVEREIQRLKTTWYTPQKL-----AE-GEQIRVFGQKLSREANL
MNMG_NEIM0       GLVGEEQWRMFNEKREAIEREIQRLKTTWYTPQKL-----AE-DEQIRVFGQKLSREANL
MNMG_NEIMF       GLVGEAQWRMFNEKREAIEREIQRLKTTWYTPQKL-----AE-DEQIRVFGQKLSREANL
MNMG_CHRVO       GVVGDEQWDAFCRKRDAVEAEKARLQATWLHPSKL-----ADPAALARVLGKPIEREYTL
MNMG_POLAQ       GLVDDYRWEVFCRKQEAVSRETSRLKDIWVGPKHE-----IA-PLVTQLLGQELSHECNL
MNMG_ACIBT       GLVDDVRWAAYCEKMEAVERETSRLQHLWAAPNNP-----MG-KKFVEMTGADLSKECSA
MNMG_ACIBY       GLVDDVRWAAYCEKMEAVERETSRLQHVWAAPNNP-----MG-KKFVEMTGADLSKECSA
MNMG_ACIAD       GLVDDVRWAAYCEKMEAVETETARLAHLWAAPNNP-----MG-KQFVEMTGADLSKECSA
MNMG_PSYA2       GLVDDVRWQAYEEKMEAIASETSRLKDIWATPINA-----LG-AQVTAQTGEVLSKESTA
MNMG_PSYCK       GLVDDVRWQAYEEKMEAIASETARLKDMWATPANA-----LG-KKVTEQTGEVLSKEATA
MNMG_PSYWF       GLVDDTRWQAYQQKMESMATESARLKDLWATPHNE-----LG-KKFTEQTGEVLSKEATA
MNMG_PSEAE       GLVDDRRWAAFEAKREGIEREEQRLKSTWVRPNTP-----QG-DAIAERFGTPLTHEYNL
MNMG_PSEAB       GLVDDRRWAAFEAKREGIEREEQRLKSTWVRPNTP-----QG-DAIAERFGTPLTHEYNL
MNMG_PSEA7       GLVDDRRWAAFEAKREGIEREEQRLKSTWVRPNTP-----QG-EAIAERFGTPLTHEYNL
MNMG_PSEPU       GLIDDQRWAAFCAKRDGIEREEQRLKSTWVRPNTE-----QG-QAIVDKFGTPLSHEYSL
MNMG_PSEPK       GLIDDQRWAAFCAKRDGIEREEQRLKSTWVRPNTE-----QG-QAIVDKFGTPLSHEYSL
MNMG_PSEP1       GLIDDLRWAAFCAKRDGIEREEQRLKSTWVRPNTE-----QG-QAVVDKFGTPLSHEYSL
MNMG_PSEPG       GLIDDQRWAAFCAKRDGIEREEQRLKSTWVRPNTE-----QG-QAIVDKFGTPLSHEYSL
MNMG_PSEPW       GLIDDQRWAAFCAKRDGIEREEQRLKSTWVRPNTP-----QG-QAVVDKFGTPLSHEYSL
MNMG_PSEE4       GLIDDARWAAFCAKREGIEREEQRLKSTWVRPGTP-----QG-QAVVDKFGTPLAHEYSL
MNMG_PSEF5       GLVDDVRWAAFCKKREGIAQEEQRLKSTWVRPGTE-----QG-DAIAQKFGTPLTHEYNL
MNMG_PSEPF       GLVDDARWAAFCKKRESIELEEQRLKSTWVRPGTQ-----QG-DAIAEKFGTPLTHEYNL
MNMG_PSE14       GLVDDARWAAFCTKRESIELEEQRLKSTWVRPGTA-----QG-DAIAEHFGTPLTHEYNL
MNMG_PSEU2       GLVDDARWAAFCIKRESIELEEQRLKSTWVRPGTE-----QG-DAIAAHFGTPLTHEYNL
MNMG_PSESM       GLVDDARWAAFCTKRESIELEEQRLKSTWVRPGTQ-----QG-DAISAHFGTPLTHEYNL
MNMG_PSEMY       GLVDDERWAAFEAKREGIVREEQRLKSTWVRPGTP-----QG-DAIAARFGTPLAHEYNL
MNMG_PSEU5       GLVDDARWAAFCAKREGIEREEQRLKNSWVRPGTP-----QG-DAIAERFGSPLAREYNL
MNMG_ALCBS       GLVGDERWAAFNAKRDGMASEEQRLKTTWVRPKTP-----EA-EAVNALIEKPLTHEYNL
MNMG_HAHCH       GMIDDERWRVFCEKREAIAREQQRLKSIWIQPATE-----KA-RKAAELLETELTREYSL
MNMG_MARMS       GLVSDERWAAFCKKREAIELETQRLRSSWIVPNTP-----EA-DSINPKLETPITHEYSL
MNMG_SACD2       GLVDDARWQAFCKKREAIELETQRMRTTWIQPNSA-----EA-NALAAKMPAELAREYSL
MNMG_CHRSD       GLVDDTRWAHFSTKREAIARETERLRETWVQPSSE-----LA-KRLSGKLDKPLAREYRL
MNMG_MARHV       GLVDDERWQKFSEKCEGIAKERSRLESTRIHPNTE-----AG-ERANGYLKQPMTRDQSL
MNMG_ALKEH       GLVDDERWRRFNAKREALEREQARLAATLIRPGDL-----PD-ALARQVLGGPLRKEQRL
MNMG_NITOC       RVVDEVRWRRFNTKWKAIERENQRLVQQRIEPDKV-----SE-GEAVTLLGEPLRREYRL
MNMG_METCA       GLVDDARWSAFEAKREAIETLGARLAARRIRPDSS-----QA-ESWNALTEIPLQREASL
MNMG_XANAC       GLVDDARWARFAAKQEAVQRETARLSALWATPGNA-----LG-REVADALGVTVSRETNV
MNMG_XANC5       GLVDDARWARFAAKQEAVQRETTRLSALWATPGNA-----LG-REVAGALGVTVSRETNV
MNMG_XANOR       GLVDDARWARFSAKQEAVQRETARLSALWATPGNA-----LG-REVADALGVTVSRETNV
MNMG_XANOM       GLVDDARWARFSAKQEAVQRETARLSALWATPGNA-----LG-REVADALGVTVSRETNV
MNMG_XANCP       GLVDDARWARFSSKQEAVQRETARLSALWATPGNA-----LG-REVVDTLGVPMSRETNV
MNMG_XANC8       GLVDDARWARFSSKQEAVQRETARLSALWATPGNA-----LG-REVVDTLGVPMSRETNV
MNMG_XANCB       GLVDDARWARFSSKQEAVQRETARLSALWATPGNA-----LG-REVVDTLGVPMSRETNV
MNMG_XYLFA       GLIDDARWAHFNAKQEAVARECERLSAFWATPGNA-----LG-REVKETLGVTLSRETNI
MNMG_XYLFT       GLVDDARWAHFNAKQEAVARECGRLSALWATPGNA-----LG-REVKETLGVTLSRETNI
MNMG_COXBU       GCVDDERWNFFVKKKETIEKEQQRLKKQRIWPKST-----VA-KAIESRFQQLLERDYSA
MNMG_COXBN       GCVDDERWNFFVKKKETIEKEQQRLKKQRIWPKST-----VA-KAIESRFQQLLERDYSA
MNMG_COXBR       GCVDDERWNFFVKKKETIEKEQQRLKKQRIWPKST-----VA-KAIESRFQQLLERDYSA
MNMG_LEGPC       GLVGDERWDSFSKKREAIESTQALLHNS--WVRVH-----HN-DLFKEALLNPMQHDCRA
MNMG_LEGPA       GLVGDERWESFSKKREAIESTQALLHNS--WVRVH-----HN-DLFKEALLNPMQHDCRA
MNMG_LEGPL       GLVGDERWDSFSKKREAIESTQALLHNS--WVRVH-----HN-DLFKEALLNPMQHDCRA
MNMG_LEGPH       GLVGDERWDSFSKKREAIESTQALLYNS--WVRVH-----HN-DLFKETLFNPMQHDCRA
MNMG_NITEU       GLVSEERWQAFAAKREAIETEKTRLRNTWISPGTL-----SK-LQTPDQP--ADDRSYSL
MNMG_NITEC       GLVDEKRWQIFAAKREAIETEKARLRRTWVPAGVL-----HK-LQTLQTSDQSDDRSYSL
MNMG_FRATF       GLLSKEDQQHFISKKNAIIENIAMMKNTWIGPQTQ-----KA-RDLEKFLDKKMTRESTL
MNMG_FRATH       GLLSKEDQQHFISKKNAIIENIAMMKNTWIGPQTQ-----KA-RDLEKFLDKKMTRESTL
MNMG_FRATO       GLLSKEDQQHFISKKNAIIENIAMMKNTWIGPQTQ-----KA-RDLEKFLDKKMTRESTL
MNMG_FRATW       GLLSKEDQQHFISKKNAIIENIAMMKNTWIGPQTQ-----KA-RDLEKFLDKKMTRESTL
MNMG_FRATT       GLLSKEDQQHFISKKNAIIENIAMMKNTWIGPQTQ-----KA-RDLEKFLDKKMTRESTL
MNMG_FRAT1       GLLSKEDQQHFISKKNAIIENIAMMKNTWIGPQTQ-----KA-RDLEKFLDKKMTRESTL
MNMG_FRATN       GLLSKEDQQHFISKKNAIIENIAMMKNTWIGPQTQ-----KA-RDLEKFLDKKMTRESTL
MNMG_FRAP2       GLLNKQDQEIFINKKTAIDENIAIMKNTWIGPQTQ-----KA-RDLEKFLDKKMTRESTL
MNMG_VESOH       GLISEARWQSFQVKYNAVEQEKKRLKNTWIQANDT-----QA-NTI---LNQNISHEYSL
MNMG_RUTMC       GLISEVCWQSFQVKYEAITQEKNRLKNTWIQASDT-----QA-GVV---LNQNLNHEYSL
MNMG_DICNV       GCVGSARMKQFDAKMTAVAHASDQLKKLLIPADRL-----SG-----------LTHNTYA
MNMG_BLOFL       GLIDDNRWRIFCLKQENIEKERQRLRNTYIFPYSE-----DI-VQLNRFLNSPIKNKVSG
MNMG_BLOPB       GLIDESRWKAFCCKKENIEKERQRLRNTYIFPYSS-----DV-AQLNNFLKTPLTHETNG
MNMG_BAUCH       GLVNENHWHKFCIKLDYIERERQRLRNLWVQPNTI-----GI-QDLNQLLKKPIMCKING
MNMG_BUCAI       GLVNDSRWIRYNQKVLNIQTEMNRLKKNKISPISP-----DA-DILKKLYNINLIKEISM
MNMG_BUCAP       GLVDNPRWIRYNEKVLNISNEKNRLKKIKIYPKSS-----DS-TILNQLFNIVLTKEINI
MNMG_BUCBP       NLIDNSRWTRYVEKLSNIKNETTRLENLKIRSKLY-----SI-TELNNFFSIKINTESTA
MNMG_WIGBR       GIIEDDRWNNFYNKKNIIYKEIKNLKNTKILFNKE-----EK-NKIN--LNINKSGSITA
MNMG_BUCCC       GLIDDFRWKIFSKKQDSISRERNRLKNIILQPKTV-----FF-SSNNK-KTIYLKKKCTA
MNMG_HALHL       GSVGDDQWTRFARYRDALNAERARLNGTRVHPGRL-----TA--SQQARLGGALRRDQTL
MNMG_RHIME       GCVGDARRQRFEAWKHSYETGRTLLQSLSVTPSEG-----KR---F-GLKLNQDGQRRTA
MNMG_SINMW       GCVGNARLTRFQQWKSAYEAGRTLLQSLSVTPNEG-----KR---F-GLKLNQDGQRRTA
MNMG_RHIEC       GCVGAERAERFTAYQAEIDAGRAQLMALTVTPNEA-----RR---A-GLNINLDGQRRSA
MNMG_RHIL3       GCVSDARVRRFTSYQAEIETCRALLQSLAVTPNEA-----RR---A-GLNINLDGQRRTA
MNMG_AGRFC       GILGRERQQRFTDFLSDLDSVRALMKELSISPSQA-----AK---Q-GLKLNQDGQRRSV
MNMG_BARHE       GIVSKLRWECYQKKQQRLDQARSLCQELFLTPNQA-----SA---H-GLQVNHDGIRRSA
MNMG_BARQU       GIVSQKRWDLYQQKQQRLDQARSICQKLFLTPNQA-----SA---H-GLQVNHDGIRRSA
MNMG_BART1       GIVSKVRWDCYQKKQQRLDQARSICKNLFLTPNEA-----SA---H-GLHVNHDGIRRSA
MNMG_BARBK       GIVSHKRWTCYQNKQQRLDHARSICQKLFLTPNEA-----SA---H-GLQINNDGVRRSA
MNMG_BRUAB       GILSEERRKRYLTRETALSHARMVTQSLSITPNLA-----GY---Y-DLRLNQDGVRRSA
MNMG_BRUA2       GILSEERRKRYLTRETALSHARMVTQSLSITPNLA-----GY---Y-DLRLNQDGVRRSA
MNMG_BRUC2       GILSKERRKRYLTRETALSHARMVTQSLSITPNLA-----GY---Y-DLRLNQDGVRRSA
MNMG_BRUSU       GILSKERRKRYLTRETALSHARMVTQSLSITPNLA-----GY---Y-DLRLNQDGVRRSA
MNMG_BRUSI       GILSKERRKRYLTRETALSHARMVTQSLSITPNLA-----GY---Y-DLRLNQDGVRRSA
MNMG_BRUME       GILSEERRKRYLTRETALSHARMVTQSLSITPNLA-----GY---Y-DLRLNQDGVRRSA
MNMG_BRUO2       GILSEERRKRYLTRETALSHARMVTQSLSITPNLA-----GY---Y-DLRLNQDGVRRSA
MNMG_BRUA4       GILGHARKERFEARETALDEARSLTQSLTITPNLA-----SR---Y-DLRLNQDGVRRSA
MNMG_RHILO       GIASVQRMQRYGDVMQRLDAARELARSVAMTPNEA-----AR---Q-GLEINRDGVRRSG
MNMG_CHESB       GVASKVRRDRFYKAEQELSDARELTKARGLTPNEA-----AR---H-GIAVNQDGVRRSA
MNMG_BRASB       GCVGGDRARFHRTKMDALEAARSLARSVTITPNEA-----AK---Y-GLTLNRDGQRRSA
MNMG_BRASO       GCVGGERVRFHRRKLAALQAARAVATSLTITPNEA-----AK---H-GLTLNRDGQRRSA
MNMG_BRADU       GCVRSARTLHHRTKMEALNAARTLSKSLTITPNEA-----IK---H-GLSLNRDGQRRSA
MNMG_NITHX       GCVGAGRAVHHRAKMAALSAAKALATSLSVTPNEA-----AR---Y-GLSLNRDGHRRSA
MNMG_NITWN       GCVGAGRAAYHRAKMAALQAAKQGAMSLSVTPNEA-----AR---H-GLSLNRDGHRRSA
MNMG_RHOPS       GCVGAERAAFHRTKMAALADAKALAQSLSITPNEA-----SR---H-GLSLNRDGQRRSA
MNMG_RHOP2       GCVGTERAAFHRGKMAALAEAKALAQSLAITPNEA-----AR---H-GLSLNRDGQRRSA
MNMG_RHOPA       GCVGVERSAFHHDKMSALSDAKALAQSLSITPNEA-----AK---H-GLALNRDGQRRSA
MNMG_RHOP5       GLVGAERAAFHRRKMAALAAAKTWARSLAVTPNEA-----AK---H-GLALNRDGVRRSA
MNMG_RHOPB       GCVGAERTEFHTAKMAALAQAKALAQSLAITPSQA-----AK---H-GLSLNRDGVRRSA
MNMG_AZOC5       GLVGTERAAVFGRRMAALDAARERARTLNITPNEA-----AK---H-GLALNKDGQRRSA
MNMG_METPB       GCVGSIRAAHFAASQGALSEARTRLDTLSLTPNEA-----AA---H-GLALNRDGLRRTA
MNMG_METRJ       GCVGGHRAAQFAAGQAALGAARARLDAVSLTPSQA-----AP---H-GISLNRDGIRRTG
MNMG_METS4       GCVGAARARHFAESQQALAAARARLDALAITPSEA-----AR---H-GLALNRDGIRRSA
MNMG_BEII9       GCIGQQRAEIFKAKSEALNSARDLLAGLSLSPTEA-----TR---H-GLKVNRDGVRRTA
MNMG_PARL1       GVVGERRVMAYEAKARALEAARVLCDGLRLSPTEL-----AR---R-GLKVNQDGVARTA
MNMG_RHORT       GCVGAARTAAFEDKRAALTAARTMIDGLALTPPDL-----AR---R-GIAVNQDGQRRTP
MNMG_MAGSA       GCVDSERWAAFMVKAAGLERGRALLQSLKGSPDWL-----RR---Q-GLEINRDGVVRSA
MNMG_CAUVC       GVVGPVRAAAWTEKKARLDAARAFARSVTLTPNEA-----VK---A-GFKVNSDGVRRDV
MNMG_CAUSK       GCVGSVRAEAWAAKKAELEAVRAFARSVTLTPAEA-----NR---T-GFKVNHDGQRRDV
MNMG_MARMM       GLASRGRGAVFCRKMEELSEARSLASNLSLTPNEA-----RD---K-GLSVNADGKRRAV
MNMG_HYPNA       GVVCETRAAMFHVKHRALESARNLLKTLNLSPAAA-----VR---N-GWAVNQDGRIRSA
MNMG_GLUOX       GCVLPEREAAFTAQKAELDAAMARAAETTFLPQTL-----RD---V-GFEVSLDGRRRTV
MNMG_GLUDA       GCVGSARAHLFTAERDAIDTAMQRAGAESFLPDAL-----QQ---A-GITVSADGRRRTL
MNMG_GRABC       GCVSDERWKTFAAYDQAMNDALTLAAQDTRTPVQL-----QQ---V-GITVRQDGRRRPL
MNMG_ACICJ       GCVGPARQAAFAALAAAVATVR-------------------------------DG-----
MNMG_RUEPO       GCVGDERRDVFARKAEKLATASALLDQSSFSPKEI-----AT---A-GITISQDGNRRNG
MNMG_RUEST       GCISEVRRSEFDRKMDAITRTKSALTSVLLTPKQL-----LE---A-GIQVNQDGNKRNG
MNMG_ROSDO       GCVSDERKQAFEVKIEALDRARRLLTESSYTPKQA-----GE---A-GISVSHDGSRRTA
MNMG_DINSH       GCVGKERRIKFEKKMGLLDETLKKLKSFEVTPKQA-----NE---A-GIRVNEDGRRRSG
MNMG_RHOS1       GCVSDARRESFNKKRELLEKGRALLEGSSFTPSQL-----NE---L-GIQVSQDGMRRTA
MNMG_CERS4       GCVSDARRESFNRKRELLEKGRALLEGSSFTPSQL-----NE---L-GIQVSQDGMRRTA
MNMG_CERS5       GCVGPARRDAFLTKMDSLSRGRTMLQQVMLTPTDL-----AR---L-EIRISQDGTRRSA
MNMG_PARDP       GCVGQERRAAFSEKMRRYTAARDRAESVSFTPTEL-----SR---S-GIEVRHDGARRSL
MNMG_JANSC       DLLTEERTSEFTAKMERLSRGYDILNDLVVTSKQA-----AA---A-GMSVNADGKKRTG
MNMG_NOVAD       GCIGDERRKWFEDRSQARSRLETALAQP-ATPTEL-----NR---A-GIPVRADGARRSL
MNMG_ERYLH       GCVGGERAEWFARREEKRARLDAALDSQ-ASAKQM-----QD---L-GLPVKSDSGKMAL
MNMG_SPHAL       GLVRPATAALFARRMAERARAGALLEAP-VATADY-----GA---I-GLPLPGDGIARRR
MNMG_SPHWW       GAISAARRMFHVEREARRIAMADCLDRRIAGSAEL-----IA---A-GAAVAADHARRSL
MNMG_ZYMMO       GALGAEMTDFVTKRLAEREKCQKLLEK--AASSRD-----MQ---A-VGANVTEGASHSL
MNMG_ANAMM       GLVSERRFGVLYNKKQEMDRLVDELHRTSITPHTL-----SK---C-GIFISQNGEKKTA
MNMG_ANAPZ       SLVSQERFDRLSQKKQEMHALLNALKGIVATPNDI-----AE---Y-DIAIAQNGEKKNA
MNMG_EHRCJ       SAVSSKRYCALKNKQHDIESLTNILKNIIITPTQL-----AA---Y-DIPVSQDGVKRSI
MNMG_EHRCR       SVVSSKRYTILKNKKQEIITLTNILKNIITTPTQL-----AR---H-NIPISQDGVRRSI
MNMG_EHRRG       SAVSYQRYLTLNRKKEEVTKLTNILKETVILPSQL-----SQ---H-GVCISQDGRKRSA
MNMG_EHRRW       SAVSYQRYLTLNRKKEEVTKLTNILKETVILPSQL-----SQ---H-GVCISQDGRKRSA
MNMG_WOLPM       SLVSHERYSVLQNKLESIKQLEEKLGSLTITPEQL-----RS---Y-GIKISYDGIRKTA
MNMG_WOLTR       SLVSYKRYSALQNKLKSIKQLEEKLESLKITPEQL-----RF---C-GIKISHDGIRKTA
MNMG_NEOSM       GLVDEERYAAYKKKYDTFHNYKSKLNELSTTPYEL-----AK---IEGISIAQDGVRKSA
MNMG_RICRO       GVVSEKRKKIFTKKCEDIEKIKSLLNTLSLTTSKL-----AK---M-GIQVAQDGTYKTV
MNMG_RICRS       GVVSEKRKKIFTKKCEDIEKIKSLLNTLSLTTSKL-----AK---M-GIQVAQDGTYKTV
MNMG_RICCN       GVVSEKRKKIFTKKCEDIEKIKSLLNTLSLSTSKL-----AK---M-GIQVAQDGTYKTV
MNMG_RICM5       GVVSEKRKKIFTKKCEDIEKIKSLLNTLSLTTSKL-----AK---M-GIQVAQDGTYKTV
MNMG_RICFE       GVVSEKRKKIFTKKCEDIEKTKLLLNTLSLTTSKL-----AK---M-GIQVAQDGTYKTV
MNMG_RICAH       GVISEKRKKIFTKKYEDIEKTKSLLNTLSFTTSKL-----AK---M-DIQVAQDGTYKTV
MNMG_RICCK       GVVSKKRKEIFKKKCYNIEKTRNLLKTLSFTTSKL-----VK---I-GVQVAQDGTYKTV
MNMG_RICB8       GVISEKRKEIFTIKCKNIESTKSLLNTLCLTTSKL-----AK---M-GIQVAQDGTYKTV
MNMG_RICBR       GVISEKRKEIFTIKCKNIESTKSLLNTLCLTTSKL-----AK---M-GIQVAQDGTYKTV
MNMG_RICPR       GVITEKRKKFFTKKCKNIEKTKLLLNNLSLTTSKL-----AK---M-GIQVAQDGKYKTI
MNMG_RICTY       GVVTEKRKNIFTKKCNNIEKTKLLLNKLSLTTSKL-----AK---I-GIQVAQDGKYKTV
MNMG_ORITB       GCVSQLRQEVFQKKLSKLNTLRDYVQSLTITPKQL-----QN---C-GYQISQNGIARTA
MNMG_PELUB       GLISKEREDIFKDKEKKLGIISKIMGESLISPTKI-----KS---F-NIKIAKDGILRKS
MNMG_KORVE       GLIKDEAWHAHLAKQQRMDELKMTLEKTRIRTSEL-----PV----ELAEKFGNIDGSTV
MNMG_SOLUE       GLATDERWELFQRKERQKLRLTQAFETHKNG-----------------------------
MNMG_MAGMM       GLVGHKRWEKYLSKKKQYDLLEDLSQKFKIN-------------------------GQPV
MNMG_CAMJE       GLLSEQDFTYIQNIANNLQKGLEFLLSKEFTPNNQ-----NN-AFLESLGEDKISSIVNL
MNMG_CAMJJ       GLLSEQDFTYIQNIANNLQKGLEFLLSKEFTPNNQ-----NN-AFLESLGEDKISSIVNL
MNMG_CAMJR       GLLSEQDFTYIQNIANNLQKGLEFLLSKEFTPNNQ-----NN-AFLESLGEDKISSIVNL
MNMG_CAMJ8       GLLSEQDFTYIQNIANNLQKGLEFLLSKEFTPNNQ-----NN-AFLESLGEDKISSIVNL
MNMG_CAMJD       GLLSEQDFAYIQNIANNLQKGLEFLLSKEFTPNNQ-----NN-AFLESLGEDKISSIVNF
MNMG_CAMC1       GLLDDETFNEIENIRRNLKEGLEFLNETQITPSKA-----NL-ELLASLDEEPISQNVSL
MNMG_CAMC5       GLIDDETHARIEQIRVNLAKGLEILNTREFTPSKQ-----NL-EFLAGLDEDVISEKVTL
MNMG_CAMFF       GLLPKEAFEEMLKLKSNLEKGMEILLTKDMSPNKE-----NL-EFLASIDEDIINEKVPL
MNMG_CAMHC       GLIKDYEFDEISRRKAQIQKGINFLLNNVITPNKE-----NL-AKLKSLGADAISQNTTW
MNMG_NITSB       GLVDEETYMKMIRKKEQIEKGLDLLKNSFITPNKE-----TL-ELLSSLEEGKITDKTAL
MNMG_SULDN       GLIDDENYERVKAKEAQIQEGARILRETIFTPNKE-----FI-AFLNSIGEEGVRDTISA
MNMG_ARCB4       GLIDDETIKKVENKRKTIEEAIEFMANEWMTSKKE-----TL-ELLESIGEEKINDRVLL
MNMG_SULNB       GLLDDAYIAKFEEKQKNIEEALNYLQENYVTPTKE-----FL-AKLEAIGAVKINDRTCW
MNMG_HELPY       GLMEEDFYKELKKDKQEIQDNLKRLKEYILTPSKE-----VL-KRLDELDENPINDKVDG
MNMG_HELPH       GLMEQDFYKELKKDQQAIQENLKRLKEYVLTPSKE-----VL-KRLNELDENPINDKVDG
MNMG_HELPJ       GLMEQDFYKELEKDKQAIQENLKRLKECVLTPSKE-----VL-KRLNELGENPINDKMDG
MNMG_HELAH       GLMEKDFYKELKKDKQEIQENLKRLKECVLTPSKE-----VL-KRLSELDENPINDKING
MNMG_HELHP       GLIDKVRYTQIMADKTHIEHTINYLQNHHITPSSS-----NL-TMLASLGLPPISDKALL
MNMG_WOLSU       GLVEEEALLALQKDEQSIHGGLVHLRESSATPSKE-----TL-AFLEEMGEEKINDKTTW
MNMG_LEPIN       GLVDQKSYDCMKEKYERVNSVREKIYQIPLKPSDK-----FQ-NLLDQKGITNYKFGMKL
MNMG_LEPIC       GLVDQKSYDCMKEKYERVNSVREKIYQIPLKPSDK-----FQ-NLLDQKGITNYKFGMKL
MNMG_LEPBJ       GLVDQESYDRMKDKYERVNSVREKIYQIPLKPSDE-----FQ-NLLDQKGITNYKFGMKL
MNMG_LEPBL       GLVDQESYDRMKDKYERVNSVREKIYQIPLKPSDE-----FQ-NLLDQKGITNYKFGMKL
MNMG_LEPBA       GLVEESLYKDMKDRYARIESIKSHLFVSAMKPSPE-----LT-KVLEEKQITNYKFGHSL
MNMG_LEPBP       GLVEESLYKDMKDRYARIESIKSHLFVSAMKPSPE-----LT-KVLEEKQITNYKFGHSL
MNMG_GEOMG       GLVPEGAYQRFLEKRERIGAELARLKGTKLLPSEA-----DPDFLA-AFSLTALQNALTY
MNMG_GEOSL       GLVRDEEYRLFLEKRERIGAELERLRTAKLLPSEA-----DPSFLE-TYGMTDLRNALTF
MNMG_GEOUR       GLVREEEYRRFHAKKNMIEEELQRLRQEKLLPSEA-----DDVFME-EFGLTGMQNAMTY
MNMG_PELPD       GLVSDAEYEGYLRKRDMIQAERERLAATRISMSQA-----EEEYFT-ARGLPDLQKGTSY
MNMG_PELCD       GLVSDERWQRFTRKMDKIVEGRDFLEKRRLSSS-------DKEAIG-RLGLEDLKNGLSL
MNMG_DESPS       GLLDEDKHQRYLIKQAAIDAGCATLDAISIKPTAE-----VNRILN-DAASADLKQKSAL
MNMG_DESVH       GLVDDTHWQLFSTKRAALHSLLDELENRRITPDAA-----ARDIFS-RLGEPAPTKGVSL
MNMG_DESVV       GLVDDTHWQRFSTKRAALHSLLDELENRRITPDAA-----ARDIFS-RLGEPAPTKGVSL
MNMG_DESAG       GLVDDAQWQLYTAKKTALEQLLAELDARQVRPDAA-----TRDIFV-HMNEAVPTRSVSL
MNMG_LAWIP       GLVGDYQWNLFQKKISDIDTLVNRLQNIRIKPDTL-----DPSIFL-ELGESIPNRAYTL
MNMG_SYNFM       GLHSADAAKELRERRGAIRNELERLRLTHVRPSAQ-----VNQTLA-ENHSPPLDAPAPL
MNMG_SYNAS       GLIPQDLHEQISERIRRIEEGMKCLSSFKIYPGTA-----VNSKLE-EHGSPAIKNPVTL
MNMG_CHLTE       NLVSSDDLHRTESIIKRVQHCLEVMKTAKVTPAEI-----NTLLMNKGLQE--LKTPARA
MNMG_CHLCH       GLLPEHRYQATRQKIEQINAVKTLLSQIRLESGLA-----NKLLQELEYGE--VTGAQQV
MNMG_CHLPM       GLVDDDTYRETLSKDDEIVRMTAFLRSKTIPTTAL-----YNLLPAESNRP--MTGGQKA
MNMG_CHLL3       GLVSDAAMERCRTKMRAIGEIKALTEKTAIPAEVL-----DSLISKQGQPH--AASGQKI
MNMG_CHLPD       GTVDFSSFTKTEYKISAIRQLRQLCDTMKLHPDQI-----ISAMAGAAQQP--PLQPIAI
MNMG_BACFR       GLVKEDRYALLKSKREAVENIVNFTRNYSIKAALI-----NDALENLGTTP--LRQGCKL
MNMG_BACFN       GLVKEDRYALLKSKREAVENIVNFTRNYSIKAALI-----NDALENLGTTP--LRQGCKL
MNMG_BACTN       GLAREDRYQLMKTKKEALEQIVNFAKNYSMKPALI-----NDALEKLGTTP--LRQGCKL
MNMG_PHOV8       GLVKQDRYEHLCSKREAVNQIIDFAKTFSIKAALI-----NDALESLGTAR--LTHGCKL
MNMG_PARD8       GLAKQDRYDLLREKKESRDAIIRFAETYSVKPQYI-----NSGLEKLGTAP--LSHGCKL
MNMG_PORGI       GLADSRRSELLREKQVFRDKLIDFTHKFSLKPDLI-----NPHLESAGHLP--LKQGIKL
MNMG_FLAJ1       GLASEDRMRRMEHKLNESEKMVAFFKETSVTVAET-----NPILIEKESAP--ISQGDKM
MNMG_FLAPJ       GLASDARLRRMEHKLNESEKMVAFFKETSITPTEA-----NPVLIAKKTAE--VNQTDKI
MNMG_GRAFK       GLASEKRMRKMEEKKDKSLKFVQYLKDLSVVPEEA-----NPVLEKRNSSP--MKQSDKV
MNMG_CYTH3       GLATEERYQDMLLKKHNSEKLVEEIKNTKIKPETA-----NEILEENGSAP--IKEKVVL
MNMG_SULMW       GLVSYDRIKKLKNKNKNKKQCFLFFK-----------------INKANNLI--LKENIKI
MNMG_SALRD       GLASKERLDRTREKERAIDVTRETLSDTTVSPQQV-----DDYLQSVGTST--LNQPRPV
MNMG_BORAP       GLVDEERYSKYLFKKRRVEEIKELLKQRRLSLKDI-----A-DEQLKKHV------NKDF
MNMG_BORBP       GLVDEERYSKYLFKKRRVEEIKELLKQRRLSLKDV-----A-DEQLKKHV------SKDF
MNMG_BORBU       GLVDEKRYSRYLFKESRVEEIKELLKQRRLSLKDV-----V-DEQLKKHV------SKDF
MNMG_TREDE       GLQTKEASNRLKEKLLTREKIISLWKDIKITRDLI-----AKNPELKNHI------GKSL
MNMG_TREPA       GLQKKSAVETLQKKMRTKHEILHLLQTNKVSLTHA-----NAYVQLKPHI------GKSF
MNMG1_FUSNN      GIVDKDKIEFLEKSINDVYMEINNLKNISVSMNEA-----NKFLESLDIEERFVK-GVKA
MNMG2_FUSNN      GLVPEEEYQRVEKKRKDVKIITEILAKTNVGPSNP-----RVNEILLKRGENPIKDGSTL
MNMG_ENDTX       GLISDKAYKKFELYRK---------AFTDICENNA-----ENLPDDEDLSPWSIE-----
MNMG_ONYPE       GLIDEKDYNNFQNKKAKINLLLEKSKNYEILVNSD-----NLSYLKQQKSAS-LGEKTTL
MNMG_AYWBP       GLIDKKDYNSFQNKKAKINLLLEKSKNYEILVNSD-----NLSYLKQQNSAS-LGEKTTL
MNMG_ACHLI       GLVDDATYERFEHKKIALKEMIERAKSTKINPTEE-----NLNYLASVNSSP-IYEGVTV
MNMG_MYCCT       GLISDTEWEQYLIYVKEIEQAIKELKEIRFTPKSQ-----LAINLKNKKQAD-LSHGYSG
MNMG_MYCMS       GLISDQEWNQYLIYVKEIEQAIKELKEIRFTPKSQ-----LAINLKNKNQAD-LSHGYSG
MNMG_MESFL       GLIKQAEYNEYLKYTEEINNAIKELEEIRFTPKSE-----LAIKLKELGQAD-LSHGYSG
MNMG_MYCGE       GLTDKKTYELFLKKEKKKQELISFLKNTQVGKVKA-----LKFTNKN--------TAQSL
MNMG_MYCPN       GLVEADVYANYLEQQQKKKQLIDYLQTTTVGQIAA-----LKLNFKN--------TAQTL
MNMG_MYCGA       GTISKEQIDLYNQNLEKKNKLIEFLKDKKVGMYTL-----LKAHTNN--------TNFSL
MNMG_UREPA       GLLKPEVYDQYLNNLKQIKEILNWLKTTTVGQIDD-----LKFTTLK--------TNSYL
MNMG_UREP2       GLLKPEVYDQYLNNLKQIKEILNWLKTTTVGQIDD-----LKFTTLK--------TNSYL
MNMG_MYCPE       GLISQSHWDEYNKNLENFNNTLKELETSTLKNVKE-----FKYNSRK--------TNTTL
MNMG_MYCH7       GLISKKEYLKIKAKYAKIDRKILELSKEFVSPKDE-----LAKKYNL-------EKRISK
MNMG_MYCHJ       GLISKKEYLKIKAKYAKIDRKILELSKEFVSPKDE-----LAKKYNL-------EKRISK
MNMG_MYCH2       GLISKKEYLKIKAKYAKIDRKILELSKEFVSPKDE-----LAKKYNL-------EKRISK
MNMG_MYCPU       HLISQQDYQKILEKYKKIDEKIEELKTKFVSSKTD-----FAQKYKI-------ENGISY
MNMG_MYCS5       GLISKDEYSQIQKKYKNINSKINYLSKKYLSTNSN-----IAKKYNI-------KEATSY
MNMG_MYCMO       KTLTDKEIATTEAKYDLITKKIAELENQYISINDP-----LAKKYNL-------ANSTSF
MNMG_MYCAP       GMISKEEYQKVLDKYKLIDDEIQRLNTTYLSGKSD-----VALKYNI-------TNGSTL
MNMG_THEM4       GLIPKWFYEKVLNLEKNIKLQIERLKNVKVPVSDR-----VNDILVKLGSTP-LKEGTKL
MNMG_FERNB       GLIPRWFYDKIINLENNIKYHIERLENVKVPASSS-----VNELLQSLGTTP-LTEGTRL
MNMG_THEMA       GLIPKWFYEKVLSLERRINEEIERLKKVIVKPSDR-----VNDLLTSLRTSP-LKEPVSF
MNMG_THESQ       GLIPKWFYEKVLSLERRINEEIERLKKVIVKPSDR-----VNDLLTSLGTSP-LKESVSL
MNMG_THEP1       GLIPKWFYEKVLSLERRINEEIERLKKVAVKPSDR-----INDLLTSLGTSP-LKESVSL
MNMG_PETMO       GLLSKEQYEQLHRLENLINHQIERLDQIKVSP-NQ-----VNDILASKGSSK-ITQPVHM
MNMG_BDEBA       GLVSAESFELLTNLRERRQVLHDRLKNTVLYPTKD-----IQAILATIPTPA-MSKSLTF
MNMG_ALKMQ       GLASKERLERYLLKKSHIEEEITRLKKTNVSP-E------KANPILEENKSSLIKAGMSL
MNMG_ALKOO       GLVKEDRYERYLLKKEHIKNEMERLKTTNVSP-T------IANPVLERAESTPIKVGMSL
MNMG_CLOD6       GLVKKDRYERFLNKKAAVEKEFERLKNERVTP-K------EVNSLLEEKGATPIKVGISL
MNMG_FINM2       GLATDERYEKMLHKKKTIDEEIERLKSIMVTPTE------ETNEKLRNLGSSELKTGITL
MNMG_CALS8       GLISQERYEKFLKKKKMIEDEIERLKKTVIAPSD------KVNKFLIEHGSSPISTGVKL
MNMG_ACET2       GLISEERYRKFEEKRRLIEQEIERVKKTNIAPTE------KVNEFLKKHNSTPIKSGVKL
MNMG1_CALS4      GLVTEERYEKFLRKKIQLEKEMRRLSTVMVRPTE------EVNNFLISRGSTPLVSGVDL
MNMG2_CALS4      GLVTEERYEKFLRKKIQLEKEMMRLPTVMVRPTE------EVNNFLISRGSTPLVSGVDL
MNMG_THEP3       GLVTEERYQKFLKKKIQLEKEMRRLLGVMIKPSE------EVNNFLISKGSTPLVTGVDL
MNMG_THEPX       GLVTEERYQKFLKKKIQLEKEMRRLLGVMIKPSE------EVNNFLISKGSTPLVTGVDL
MNMG_CLOB1       GLVKEDRYNKFLNRKKNVENEIERLRNMQITGKR------EINEFLLEKGSTELKKPISL
MNMG_CLOBH       GLVKEDRYNKFLNRKKNVENEIERLRNMQITGKR------EINEFLLEKGSTELKKPISL
MNMG_CLOBL       GLVKEDRYNKFLNRKKNVENEIERLRNMQITGKR------EINEFLLEKGSTELKKPISL
MNMG_CLOBK       GLVKEDRYNKFLNRKKNVENEIERLRNMQITGKR------EINEFLLEKGSTELKKPISL
MNMG_CLOBM       GLVKEDRYNKYLNRKKNVENEIERIKKVQITGKK------EINEFLLEKGSTELKKPISL
MNMG_CLONN       GLVKEDRYERFTKRKTAIEDEIERLKNIQITNKQ------EVNKFLEGLNSAGLKKPISL
MNMG_CLOAB       GLVDENRYEKFIGRKNAIEEELNRLKKVQITNKK------EVNDFLEGLGSVSLKKPISL
MNMG_CLOTE       GLVSEERYKRYINRRESIKSEIERIKNVQITNKK------EVNEFLLSLNSSELKKPISL
MNMG_CLOK5       GLVTKERYDKYLERKNSIETEIKRIKNLYITPKK------EVIEFLNSLGSSELKKSISL
MNMG_CLOP1       GLVTEERWSKFQERKQNLERELERLKELQITNKT------ENNEKIVELGSTELKKPIRM
MNMG_CLOPS       GLVTEERWNKFQERKQNLERELERLKELQITNKT------ENNEKIVELGSTELKKPIRM
MNMG_CLOPE       GLVTEERWNKFKERKQNLERELERLKELQITNKT------ENNEKIVELGSTELKKPIRM
MNMG_CLOB8       GLVTEERYDKFIKRKQNIENELERLKNLKVTNKK------EINEFLISLNSAELRKPITF
MNMG_LACP7       GLISEDRYEHLIDKERMIKEEMMRLENSLIGASK------EVQEILEGLGTTTLKTGTTL
MNMG_NATTJ       GLIKEGNYQKFKEKLEKIESEKERLKSIKLTPNK------NVQNFMEEHNTSGLKKPTTL
MNMG_BACVZ       GLISDERYEAFEKKKAAIEAEKKRLWSVIIKPSP------ENQEYIRSLGGSELKDGVRG
MNMG_BACSU       GLISDERYAAFEKKKAAIEAEKKRLHSVIIKPSP------ENQEYIRSLGGSELKDGVRG
MNMG_BACLD       GLISEERYQKFQEKKAAIEAEKKRLHSVIIKPTK------ENQEYIRSLGGSELKDGIRA
MNMG_BACP2       GLISQERFQAFQQKKEAIEAEKKRLYSVIIKPTA------ETQEFIRSLGGSELKDGIRA
MNMG_BACAH       GLITEERYERFTNKKLQIEQEKERLSSIIIKPRP------EVQELIRNIGGSELKDGIRA
MNMG_BACHK       GLITEERYERFTNKKLQIEQEKERLSSIIIKPRP------EVQELIRNIGGSELKDGIRA
MNMG_BACAN       GLITEERYERFTNKKLQIEQEKERLSSIIIKPRP------EVQELIRNIGGSELKDGIRA
MNMG_BACCZ       GLITEERYERFTNKKLQIEQEKERLSSIIIKPRP------EVQELIRNIGGSELKDGIRA
MNMG_BACC1       GLIKEERYERFTNKKLQIEQEKERLSSIIIKPRP------EVQELIRNIGGSELKDGIRA
MNMG_BACCR       GLIKEERYERFTNKKLQIEQEKERLSSIIIKPRP------EVQELIRNIGGSELKDGIRA
MNMG_BACMK       GLIKEDRYERFTNKKLQIEQEKERLESIFIKPRP------EVQELIRSIGGSELKDGIRA
MNMG_BACCN       GLIPEERYERYSQKKEQIEQEKARLEGIIIKPRP------EVQELIRSVGGSELKDGIRA
MNMG_GEOKA       GLISEERYQKFLAKKEAIEREKKRLQTVIIKPTP------KVQEVIREAGGSELKDGIRA
MNMG_GEOTN       GLISEERYQAFLAKKEAIEREKKRLQTVIIKPTP------EVQEVIRQAGGSELKDGIRA
MNMG_LYSSC       GMVPQERYDKFNAKKALIENEIARLREIIIKPNE------ATQAVIRSAGGSELKDGIRG
MNMG_STAA2       GMISEERYARFNEKRQQIDAEIKRLSDIRIKPNE------HTQAIIEQHGGSRLKDGILA
MNMG_STAA9       GMISEERYARFNEKRQQIDAEIKRLSDIRIKPNE------HTQAIIEQHGGSRLKDGILA
MNMG_STAAR       GMISEERYARFNEKRQQIDAEIKRLSDIRIKPNE------HTQAIIEQHGGSRLKDGILA
MNMG_STAAS       GMISEERYARFNEKRQQIDAEIKRLSDIRIKPNE------HTQAIIEQHGGSRLKDGILA
MNMG_STAA1       GMISEERYARFNEKRQQIDAEIKRLSDIRIKPNE------HTQAIIEQHGGSRLKDGILA
MNMG_STAAM       GMISEERYARFNEKRQQIDAEIKRLSDIRIKPNE------HTQAIIEQHGGSRLKDGILA
MNMG_STAAW       GMISEERYARFNEKRQQIDAEIKRLSDIRIKPNE------HTQAIIEQHGGSRLKDGILA
MNMG_STAAN       GMISEERYARFNEKRQQIDAEIKRLSDIRIKPNE------HTQAIIEQHGGSRLKDGILA
MNMG_STAAB       GMISEERYARFNEKRQQIDAEIKRLSDIRIKPNE------HTQAIIEQHGGSRLKDGILA
MNMG_STAA8       GMISEERYARFNEKRQQIDAEIKRLSDIRIKPNE------HTQAIIEQHGGSRLKDGILA
MNMG_STAA3       GMISEERYARFNEKRQQIDAEIKRLSDIRIKPNE------HTQAIIEQHGGSRLKDGILA
MNMG_STAAC       GMISEERYARFNEKRQQIDAEIKRLSDIRIKPNE------HTQAIIEQHGGSRLKDGILA
MNMG_STAAE       GMISEERYARFNEKRQQIDAEIKRLSDIRIKPNE------HTQAIIEQHGGSRLKDGILA
MNMG_STAAT       GMISEERYARFNEKRQQIDAEIKRLSDIRIKPNE------HTQAIIEQHGGSRLKDGILA
MNMG_STAES       GLISEERYARFNEKRQQIKDEIQRLTDVRIKPNE------HTQAIIEAKGGSRLKDGILA
MNMG_STAEQ       GLISEERYARFNEKRQQIKDEIQRLTDVRIKPNE------HTQAIIEAKGGSRLKDGILA
MNMG_STAHJ       GMISEERYARFNEKRQQIQDEIQRLTDIRIKPNE------HTQSVIEANGGSRLKDGILA
MNMG_STAS1       GMISEERYARFNEKRAMIKAEQERLNGIRVKPND------RVQEIIEAQGGSRLKDGILA
MNMG_LISMO       GLISDERYERFLAKQSAIEAEKERLQKTRIKPTA------EVQAMLKEIGSGELKDGILA
MNMG_LISMF       GLISDERYERFLAKQSAIEAEKERLQKTRIKPTA------EVQAMLKEIGSGELKDGILA
MNMG_LISIN       GLISDERYERFLAKQRAIEAEKERLQKTRIKPTA------EVQAMLKEIGSGELKDGILA
MNMG_LISW6       GLISDERYERFLAKQSAIEAEKERLQKTRIKPTA------EVQAMLKEIGSGELKDGILA
MNMG_OCEIH       GLITEERYQRFTEKKQQIEQEKKRLSKIIIKPTE------DIQDIMEKAGASRLKEAIKA
MNMG_BACSK       GLISEERYSRFKAKQEAIEQEKQRISALVVKPSD------EVNQLLERLGSRSMTEALKA
MNMG_ALKHC       GLIARERYERFCEKKAQIAAEKKRLESITVKPSK------EVNALLEEVGSAPLKEAVQA
MNMG_EXIS2       GLINETRHAKLAEKKEDIQREMKRLEKVVIKATS------EVNERLTEIGVSPLKEALHA
MNMG_LEVBA       GLISDERYADFLAKKATLQAELDRLNQIRIKPND------EINAFVESHGDKPLQDGVLA
MNMG_LACPL       GLIDDERYAAFEAKRQAIKNELDRLGKIRIKPND------EVNAFLRAHNSGELKDGVLA
MNMG_PEDPA       GLVSDEEYNAFLEKKQDIKDELQRLSEIRIKPS-------QVQKFLESKGSNGLKDGVLA
MNMG_LACS1       GLISDERYAAFEEKKAQIEAEKQRLSKIRIKPNA------EVNAFVEAHGDRELKDGVLA
MNMG_ENTFA       GLVKEEQYAAYLVKKAAVEAEIARLGKHRIKPTK------EVQAFLETKGAAGLKDGILA
MNMG_LACSS       GLINDDRFDSYEVKKAAVEAELARLEKIRLKPTP------EIQAFLAAKGEAPLKDGVLA
MNMG_LACP3       GLISDERYAEFLAKRQAIETELNRLNTTRLKPK-------DVNPWLEAHHYAPLKDGVLA
MNMG_LACAC       GLISDDRYQAFEEKKQAIKDTQARLHEITVHVTD------EVQDFLKSIGQEPMKAGVKA
MNMG_LACH4       GLISDERYEKFEEKKQAIRDAKERLHEITVHLSD------DVQEFLKSIGQEPMKAGVKA
MNMG_LACJO       GLISEDRYKEFQDKKQAISQAMEAIKKVTIHPTD------EVQEYLASVKQDRLNAGVSG
MNMG_LACGA       GLISEERYAKFEAKKQAISRAMAAIKKVTIHPTD------EVQEYLASVKQDRLNAGVSG
MNMG_LACDA       GLIDDDRYAEFLAKKELIQEDLDRLGEITVHPTI------AVNEYLAGLGQTDLNGGVKA
MNMG_LACDB       GLIDDDRYAEFLAKKELIQEDLDRLGEITVHPTI------AVNEYLAGLGQTDLNGGVKA
MNMG_LACLM       GLVSDAQWEHYQAKMAQFDREMKRLNSEKLKPLP------DTQEKLGKLGFGPIKDALTG
MNMG_LACLS       GLVSDAQWEHYQAKMAQFDREMKRLNSEKLKPLP------DTQEKLGKLGFGPIKDALTG
MNMG_LACLA       GLVSDEQWEHYQAKMAQFDREMKRLNSEKLKPLP------DTQEKLGKLGFGPIKDALTG
MNMG_STRA3       GLVDEERYAIFKKRQMQFENELERLDSIKLKPVS------ETNKRIQELGFKPLTDALTA
MNMG_STRA5       GLVDEERYAIFKKRQMQFENELERLDSIKLKPVS------ETNKRIQELGFKPLTDALTA
MNMG_STRA1       GLVDEERYAIFKKRQMQFENELERLDSIKLKPVS------ETNKRIQELGFKPLTDALTA
MNMG_STRP1       GLVDDERWKAFEIKKNQFDNELKRLNSIKLKPIK------ETNDRVQDLGFKPLTDAMTA
MNMG_STRPD       GLVDDERWKAFEIKKNQFDNELKRLDSIKLKPIK------ETNDRVQDLGFKPLTDAMTA
MNMG_STRPB       GLVDDERWKAFEIKKNQFDNELKRLNSIKLKPVK------ATNDRVQELGFKPLTDAMTA
MNMG_STRPC       GLVDDERWKAFEIKKNQFDNELKRLNSIKLKPVK------ATNDRVQELGFKPLTDAMTA
MNMG_STRPG       GLVDDERWKAFEIKKNQFDNELKRLNSIKLKPVK------ATNDRVQELGFKPLTDAMTA
MNMG_STRP8       GLVDDERWKAFEIKKNQFDNELKRLNSIKLKPVK------ATNDRVQELGFKPLTDAMTA
MNMG_STRPF       GLVDDERWKAFEIKKNQFDNELKRLNSIKLKPVK------ATNDRVQELGFKPLTDAMTA
MNMG_STRPM       GLVDDERWKAFEIKKNQFDNELKRLNSIKLKPVK------ATNDRVQELGFKPLTDAMTA
MNMG_STRP3       GLVDDERWKAFEIKKNQFDNELKRLNSIKLKPVK------ATNDRVQELGFKPLTDAMTA
MNMG_STRP6       GLVDDERWKAFEIKKNQFDNELKRLNSIKLKPVK------ATNDRVQELGFKPLTDAMIA
MNMG_STRT2       GLVDDERWNIFKIKKNQFDRELTRLSKEKLKPIK------ETNEKIQALGFKPLTDAMTA
MNMG_STRT1       GLVDDERWNIFKIKKNQFDRELTRLSKEKLKPIK------ETNEKIQALGFKPLTDAMTA
MNMG_STRTD       GLVDDERWNIFKIKKNQFDRELTRLSKEKLKPIK------ETNEKIQALGFKPLTDAMTA
MNMG_STRMU       GLVNEERYMRFQIRKNQFDNELTRLSSIKLKPVA------EINKRIEELGFKPLTDALTA
MNMG_STRGC       GLVDDERWARFEIKKNQFDNEMKRLESIKLKPVK------ETNAKVEELGFKPLTDAVTA
MNMG_STRSV       GLVDDERWARFEIKKNQFDNEMKRLESIKLKPVK------ETNAKVEALGFKPLTDAVTA
MNMG_STRR6       GLVDDERWARFEIKKNQFDNEMKRLDSIKLKPVK------ETNAKVEEMGFKPLTDAVTA
MNMG_STRP2       GLVDDERWARFEIKKNQFDNEMKRLDSIKLKPVK------ETNAKVEEMGFKPLTDAVTA
MNMG_STRPN       GLVDDERWARFEIKKNQFDNEMKRLDSIKLKPVK------ETNAKVEEMGFKPLTDAVTA
MNMG_STRPI       GLVDDERWTRFEIKKNQFDNEMKRLDSIKLKPVK------ETNAKVEEMGFKPLTDAVTA
MNMG_STRSY       GLVDDERWQVFQIHKNQFDNEMKRLESIKLKPIK------ETNEKVVAMGFKPLTDALTA
MNMG_STRS2       GLVDDERWQVFQIHKNQFDNEMKRLESIKLKPIK------ETNEKVVAMGFKPLTDALTA
MNMG_DESRM       GLVSQVRYDHYMNKWQSISKEMERLKTIVIP-----ANEETNKVLKSLESSEITQN-TPF
MNMG_PELTS       GLVSPERYAKYERKKKLVEEERQRLEKTMVA-----VGDEVKRVLEAANSPGLPQQGISL
MNMG_CARHZ       GLVTEERWRKFNERVEKINKLMEFLEENQVT-----PTKRNLEIMEEYGTS-PPKHGISG
MNMG_MOOTA       GLLDEQRFRKLEAKEKAINDGLVYLGKQHVG-----GNNPKIQEIIVACGEPPLKGTTSL
MNMG_HELMI       GLVDDRRYRRFREKMQLLEQEVVRWKSSFVT-----PGNKKIQAILDEKKSAPLTKGVSL
MNMG_SYNWW       GLVDDNRWMAYQQKEEILEVESNELKFSSFT-----PADEEMADFLSGKNTAAIRDRVSL
MNMG_DESAP       GLVSGAHYERFAQKKDRVRAELERLDRTVVPDPLGRVSRAEVQDWLAARGSAPLSRPCRL
MNMG_SYMTH       GLVDDARWEVFVALRDGIEAERERLARTVVG------PAPEVQRVLERLGSAPLKAGVTL
MNMG_DESHY       GLVKDERWAAFQKKKAAIAEINALWRGTTFS-----PLNEHLAEVLAGVHSAPVHGGISG
MNMG_ROSCS       GLVDRERVEAVERKREESERLLRVLRGQRLFPSA------ATNARLSDVGIAPLSSEMSA
MNMG_ROSS1       GLVDRERVAVVERKREEVERLLAVLRGKRLYPSA------AINARLSAAGIAPLTGEMSA
MNMG_CHLAA       GLVDGERAAVVEARRQQTEHALQQMRERRIFPSA------AVNASLEAHGIKPISQPVTV
MNMG_DEIRA       GLVDDAELIRVQEKYARVQSGIKSLSKQRMQGQTA-------------------------
MNMG_DEIGD       GLVDEDTQRAVQAKYRRVAEGIRALQMQRVQGQTG-------------------------
MNMG_THET2       GLRPREDLERVEAKYRRVAAELRRLEALRVEGVSG-------------------------
MNMG_THET8       GLRPKEDLERVEAKYRRVAAELRRLQALRVEGVSG-------------------------
MNMG_MYXXD       GLLPREALERVEARGRAVTEEVARLKRTGLA-----------------------------
                                                                             

MNMG_NOSS1       ADLLRRPGFHYVDLDRYGLGNPE-------------------------------------
MNMG_TRIV2       ADLLRRPGFHYVDLDRYGLGNPE-------------------------------------
MNMG_TRIEI       ADLLRRPGFHYVDLEKYNLGNLD-------------------------------------
MNMG_SYNY3       AELLRRPGFHYPDLEKFQLGNEE-------------------------------------
MNMG_SYNP2       ADLLRRPKFHYADLASYGLGNEA-------------------------------------
MNMG_MICAN       ADLLRRPSLHYLDLDRYGLGNPD-------------------------------------
MNMG_ACAM1       SDLLRRPKFHYCDLQQHGLGIET-------------------------------------
MNMG_SYNP6       ADLLRRPNFHYIDLEAHGLGDPS-------------------------------------
MNMG_SYNE7       ADLLRRPNFHYIDLEAHGLGDPS-------------------------------------
MNMG_THEEB       EELLRRSGVHYELLDRHGLGNPD-------------------------------------
MNMG_SYNJB       AEILRRNQIHYSDLLELGLGDAE-------------------------------------
MNMG_SYNJA       AELLRRNPIHYADLLELGLGNEE-------------------------------------
MNMG_PROM1       ANFLRRTNIHYKDLITYNLTTQS-------------------------------------
MNMG_PROMT       ANFLRRTNIHYKDLITFNLTTQS-------------------------------------
MNMG_PROMA       ANLLRRPGMHMNNLIRHKLANNS-------------------------------------
MNMG_PROM3       ADLLRRPGVHSADLIEHGLVDPE-------------------------------------
MNMG_PROMM       ADLLRRPGVRSADLIEHGLVDPE-------------------------------------
MNMG_SYNSC       ADLLRRPGMHAADLVRHGLADAD-------------------------------------
MNMG_SYNPX       ADLLRRPGMHAADLVRHGLADAD-------------------------------------
MNMG_SYNS9       ADLLRRPAMHAADLVRHGLADGD-------------------------------------
MNMG_SYNPW       ADLLRRPGMHAADLVRHGLADAG-------------------------------------
MNMG_SYNS3       ADLLRRSGVHSSDLVRHRLADAE-------------------------------------
MNMG_SYNR3       ADLLRRPGFHSNDLVRHGLADGE-------------------------------------
MNMG_PROMS       KELLKRPNFHYSDLIKYNLNERN-------------------------------------
MNMG_PROM0       KELLKRPDFHYSDLIKYNLTEKN-------------------------------------
MNMG_PROM9       KELLKRPNFHYSDLIKYNLTEKN-------------------------------------
MNMG_PROM2       KELLKRPNFHYLDLIKYNLAKKN-------------------------------------
MNMG_PROM5       KDLLKRPNVHYSDFIKYDLANKS-------------------------------------
MNMG_PROMP       KELLKRPNLHYSDFIRYDLVDKT-------------------------------------
MNMG_CHLTR       TKVLCRPEVSYQQLLTEFPADVRDLG----------------------------------
MNMG_CHLTA       TKVLCRPEVSYQQLLTEFPADVRDLG----------------------------------
MNMG_CHLT2       TRVLCRPEVSYQQLLTEFPADVRDLG----------------------------------
MNMG_CHLTB       TRVLCRPEVSYQQLLTEFPADVRDLG----------------------------------
MNMG_CHLMU       TKILCRPEVSYQQLLTEFPEDVKDWG----------------------------------
MNMG_CHLAB       AKALCRPEVSYDTLREAFPEDIRDYG----------------------------------
MNMG_CHLCV       AKALCRPEVSYDILRETFPDDVRDLG----------------------------------
MNMG_CHLFF       AKALCRPEVSYDTLREVFPEEVRDFG----------------------------------
MNMG_CHLPN       AKALSRPEVSYDMLREAFPNDIRDLG----------------------------------
MNMG_PARUW       TQLLCRPENTYASLLKEYPDVMQNFG----------------------------------
MNMG_RHOBA       GDVYLRRPEVTWNVIAEQVPELAGIG----------------------------------
MNMG_OPITP       AEIIRRQ-----NARAELPSELMRQS----------------------------------
MNMG_AQUAE       VATLMTMNYTLDDVKEKFGYEVPQH-----------------------------------
MNMG_ECOLI       EDLLRRPEMTYEKLTTLT---------------------PFAPALTD-------------
MNMG_ECOL6       EDLLRRPEMTYEKLTTLT---------------------PFAPALTD-------------
MNMG_ECO24       EDLLRRPEMTYEKLTTLT---------------------PFAPALTD-------------
MNMG_ECODH       EDLLRRPEMTYEKLTTLT---------------------PFAPALTD-------------
MNMG_ECOL5       EDLLRRPEMTYEKLTTLT---------------------PFAPALTD-------------
MNMG_ECOHS       EDLLRRPEMTYEKLTTLT---------------------PFAPALTD-------------
MNMG_ECOLC       EDLLRRPEMTYEKLTTLT---------------------PFAPALTD-------------
MNMG_SHIBS       EDLLRRPEMTYEKLTTLT---------------------PFAPALTD-------------
MNMG_SHISS       EDLLRRPEMTYEKLTTLT---------------------PFAPALTD-------------
MNMG_ECOUT       EDLLRRPEMTYEKLTTLT---------------------PFAPALTD-------------
MNMG_ECOK1       EDLLRRPEMTYEKLTTLT---------------------PFAPALTD-------------
MNMG_ECOSM       EDLLRRPEMTYEKLTTLT---------------------PFAPALTD-------------
MNMG_ECO57       EDLLRRPEMTYEKLTTLT---------------------PFAPALTD-------------
MNMG_SHIDS       EDLLRRPEMTYEKLTTLT---------------------PFAPALTD-------------
MNMG_SHIFL       EDLLRRPEMTYEKLTTLT---------------------PFAPALTD-------------
MNMG_SHIF8       EDLLRRPEMTYEKLTTLT---------------------PFAPALTD-------------
MNMG_SALCH       EDLLRRPEMTYAQLTSLA---------------------AFAPALED-------------
MNMG_SALTY       EDLLRRPEMTYAQLTSLA---------------------AFAPALED-------------
MNMG_SALPB       EDLLRRPEMTYAQLTSLA---------------------AFAPALED-------------
MNMG_SALPA       EDLLRRPEMTYAQLTSLA---------------------AFAPALED-------------
MNMG_SALTI       EDLLRRPEMTYAQLTSLA---------------------AFAPALED-------------
MNMG_CITK8       EDLLRRPEMTYAQLTSLT---------------------PFAPGLDD-------------
MNMG_SALAR       EDLLRRPEMTYAQLTSLS---------------------AFAPALED-------------
MNMG_ENT38       EDLLRRPGMTYEQLVQMT---------------------PFAPGLDD-------------
MNMG_KLEP7       EDLLRRPEMTYEQLVQLS---------------------PFTPGLED-------------
MNMG_CROS8       EDLLRRPEMTYAQLTSLS---------------------AFAPALDD-------------
MNMG_PECAS       EELLRRPEVDYAQLTALP---------------------LFAPGLTD-------------
MNMG_YERPE       EELLRRPEIDYRLLTSLT---------------------SFGPALTD-------------
MNMG_YERPY       EELLRRPEIDYRLLTSLT---------------------SFGPALTD-------------
MNMG_YERPA       EELLRRPEIDYRLLTSLT---------------------SFGPALTD-------------
MNMG_YERPN       EELLRRPEIDYRLLTSLT---------------------SFGPALTD-------------
MNMG_YERPP       EELLRRPEIDYRLLTSLT---------------------SFGPALTD-------------
MNMG_YERPS       EELLRRPEIDYRLLTSLT---------------------SFGPALTD-------------
MNMG_YERP3       EELLRRPEIDYRLLTSLT---------------------SFGPALTD-------------
MNMG_YERE8       EELLRRPEIDYRLLTTLP---------------------SFGPALTD-------------
MNMG_SERP5       EELLRRPEMDYTQLTSVA---------------------AFAPPLAD-------------
MNMG_PHOLL       EDLLRRPEMNYKLLTSLP---------------------LFSPSLEE-------------
MNMG_SODGM       EELLRRPEMDYARLTHLE---------------------RFGPALVD-------------
MNMG_VIBCH       EDLLRRPEMTYELLTTLP---------------------AFAPALED-------------
MNMG_VIBC3       EDLLRRPEMTYELLTTLP---------------------AFAPALED-------------
MNMG_VIBCB       EDLLRRPEISYSDLTQLD---------------------AFAPALED-------------
MNMG_VIBPA       EDLLRRPEISYSQLTQLD---------------------AFAPALED-------------
MNMG_VIBVU       EDLLRRPEMTYEQLTSLA---------------------AFAPALDD-------------
MNMG_VIBVY       EDLLRRPEMTYDQLTSLT---------------------AFAPAIDD-------------
MNMG_ALIF1       EDLLRRPEVNYQSLVSID---------------------GFGPALED-------------
MNMG_PHOPR       EDLLRRPEITYKLLTQLE---------------------DFSPAHID-------------
MNMG_AERHH       EELLRRPEVTYDALMAIE---------------------GVGPALPD-------------
MNMG_AERS4       EELLRRPEVTYDALMAIE---------------------GVGPALSD-------------
MNMG_COLP3       EDLIRRPEVNYTDLMKIE---------------------GLGPAIED-------------
MNMG_PSEA6       EDLIRRPEMTYETLMNVT---------------------EFGPGITD-------------
MNMG_IDILO       EELLRRPEIHYKDLALTD---------------------FFAPGLED-------------
MNMG_PSET1       EELLRRPEIRYNDLMAID---------------------GLGSEFTN-------------
MNMG_SHEB5       EELLRRPEMDYSKLMQIE---------------------GFGPGLED-------------
MNMG_SHEB8       EELLRRPEMDYSKLMQIE---------------------GFGPGLED-------------
MNMG_SHEB9       EELLRRPEMDYSKLMQIE---------------------GFGPGLED-------------
MNMG_SHEPC       EELLRRPEMDYSKLMQIE---------------------GFGPGLED-------------
MNMG_SHESW       EELLRRPEMDYSKLMQIE---------------------GFGPGLED-------------
MNMG_SHESM       EELLRRPEMDYSKLMQIE---------------------GFGPGLAD-------------
MNMG_SHESR       EELLRRPEMDYSKLMQIE---------------------GFGPGLAD-------------
MNMG_SHESA       EELLRRPEMDYSKLMQIE---------------------GFGPGLAD-------------
MNMG_SHEON       EELLRRPEMDYNKLMQIE---------------------GFGPGLAD-------------
MNMG_SHEDO       EDLLRRPEMDYQKLMSLE---------------------GFGPGLED-------------
MNMG_SHEFN       EDLLRRPEMDYAKLMSLE---------------------GFGPGLDD-------------
MNMG_SHEHH       EDLLRRPEMDYPKLMSID---------------------GFGPGLED-------------
MNMG_SHEPA       EDLLRRPEMDYPKLMSID---------------------GFGPSLED-------------
MNMG_SHESH       EDLLRRPEMDYPKLMSLE---------------------GFGPALED-------------
MNMG_SHEWM       EDLLRRPEMDYPKLMSLE---------------------GFGPGLDD-------------
MNMG_SHELP       EELLRRPELDYPKLMSVE---------------------GFGPAIED-------------
MNMG_SHEAM       EDLLRRPEIEYDTLMKVD---------------------GFGPGLAD-------------
MNMG_PSYIN       EGMIRRPEVNYQSLISIE---------------------GLGPVLEN-------------
MNMG_ACTP2       EDLLRRPEVTYDKLTQVA---------------------AFAPALDD-------------
MNMG_ACTPJ       EDLLRRPEVTYDKLTQVA---------------------AFAPALDD-------------
MNMG_HAEDU       EDLLRRPEINYAKLTEIA---------------------AFAPALDD-------------
MNMG_HAEIN       EDLLRRPEMTYDILTSLT---------------------PYKPAMED-------------
MNMG_HAEIG       EDLLRRPEMTYDILTSLT---------------------PYKPAMED-------------
MNMG_HAEIE       EDLLRRPEMTYDILTSLT---------------------PYKPAMED-------------
MNMG_HAEI8       EDLLRRPEMTYDILTSLT---------------------PYKPAIED-------------
MNMG_HAES1       EDLLRRPEINYQILTALT---------------------PFKPAMED-------------
MNMG_HISS2       EDLLRRPEINYQILTALT---------------------PFKPAMED-------------
MNMG_MANSM       EDLLRRPEINYQILTALD---------------------LFKPAMDD-------------
MNMG_PASMU       EDLLRRPEMNYQILTSLT---------------------PFQPAMDD-------------
MNMG_ACTSZ       EDLLRRPEVSYEKLTKTA---------------------AFSPALED-------------
MNMG_HYDCU       FDLLKRPNVSYDALATMD---------------------MFGNAVTD-------------
MNMG_ACIAC       FDLLRRPDVTYDALTGMD-----------------GGKYASTAVSR--------------
MNMG_ACISJ       FDLLRRPDVGYDALTTMD-----------------GGKYASEAVSR--------------
MNMG_VEREI       FELLRRPDVDYAGLMSLD-----------------GGKYAAADVSR--------------
MNMG_POLNA       ADLLRRPDVNYAGLMSLD-----------------GGRYANPEIPTGNE-----------
MNMG_POLSJ       LDLLRRPDVNYAGLMSLE-----------------EGKYANPELAA--------------
MNMG_RHOFT       ADLLRRPDVNYANLMSLE-----------------GGKYASAELNI--------------
MNMG_LEPCP       ADLMRRPGISYDTVAEALTIARP------------GNYVSRETLNS--------------
MNMG_METPP       VDLLRRPGVDFDAVAEVAQIAHARRSEGRQADDPAAAAWSRAALRN--------------
MNMG_BURCA       AELLRRPGVSYDGVCGLK-----------------GGECGPAEPLAD-------------
MNMG_BURCH       AELLRRPGVSYDGVCGLK-----------------GGECGPAEPLAD-------------
MNMG_BURCC       AELLRRPGVSYDGVCGLK-----------------GGECGPAEPLAD-------------
MNMG_BURCM       AELLRRPGISYDGVCSLK-----------------GGECAPTEPLAD-------------
MNMG_BURA4       AELLRRPGISYDGVCSLK-----------------GGECAPAEPLAD-------------
MNMG_BURL3       AELLRRPGISYDGVCGLK-----------------GGECGPAEPLAD-------------
MNMG_BURVG       AELLRRPGISYDGVCGLK-----------------GGECGPVEPLAD-------------
MNMG_BURMA       AELLRRPGVSYDGVCGLR-----------------GGECGPSEPLAE-------------
MNMG_BURM9       AELLRRPGVSYDGVCGLR-----------------GGECGPSEPLAE-------------
MNMG_BURP0       AELLRRPGVSYDGVCGLR-----------------GGECGPSEPLAE-------------
MNMG_BURM7       AELLRRPGVSYDGVCGLR-----------------GGECGPSEPLAE-------------
MNMG_BURMS       AELLRRPGVSYDGVCGLR-----------------GGECGPSEPLAE-------------
MNMG_BURP1       AELLRRPGVSYDGVCGLR-----------------GGECGPSEPLAE-------------
MNMG_BURPS       AELLRRPGVSYDGVCGLR-----------------GGECGPSEPLAE-------------
MNMG_BURP6       AELLRRPGVSYDGVCGLR-----------------GGECGPSEPLAE-------------
MNMG_BURTA       AELLRRPGISYDGVCGLR-----------------GGECGPSEPLAE-------------
MNMG_PARXL       ADLLRRPGVSYDGVCALR-----------------AGACAAPETLAE-------------
MNMG_CUPNH       ADLLRRPEVRYEALMALQ-----------------GGRHAPETPLDA-------------
MNMG_CUPPJ       ADLLRRPEVVYNDLMALQ-----------------GGRHAPEVPLDG-------------
MNMG_CUPMC       ADLLRRPEVRYEALVALQ-----------------DGRFAPETPLAD-------------
MNMG_RALSO       ADLLRRPNVTYESLMGMQ-----------------GGKYAPDAPLAD-------------
MNMG_JANMA       ADLLRRPNVSYETLMSLK-----------------GVDG---QDLAG-------------
MNMG_HERAR       ADLLRRPNVTYETLMSLK-----------------GMDG---QDLGG-------------
MNMG_BORBR       SDLLKRPNVSYEALMQAR--------------------TDEGELLAG-------------
MNMG_BORPA       SDLLKRPNVSYEALMQAR--------------------TDEGELLAG-------------
MNMG_BORPE       SDLLKRPNVSYEALMQAR--------------------TDEGELLAG-------------
MNMG_BORPD       SDLLKRPAVSYAALMRAR--------------------NADGSLLAG-------------
MNMG_BORA1       ADLLKRPNISYEALMQAR--------------------NGAGELLAG-------------
MNMG_AZOSB       FELLRRPETTYASLMSLP---------------------GAPEQ----------------
MNMG_AROAE       FELLRRPNTRYAELMSLP---------------------GAPEN----------------
MNMG_DECAR       FELLRRPEVTYTSLLTLP---------------------GAGE-----------------
MNMG_METFK       FELLRRPEVSYEALLSLP---------------------QAGE-----------------
MNMG_THIDA       FDLLRRPNLGYAQVLALP---------------------GGGA-----------------
MNMG_NITMU       HDLLRRPNVSYAELMTLP---------------------GAGE-----------------
MNMG_NEIG1       HDLLRRPNLDYAALMTLE---------------------GAMP-----------------
MNMG_NEIMA       HDLLRRPNLDYAALMTLE---------------------GAMP-----------------
MNMG_NEIMB       HDLLRRPNLDYAALMTLE---------------------GAMP-----------------
MNMG_NEIM0       HDLLRRPNLDYAALMTLE---------------------GAMP-----------------
MNMG_NEIMF       HDLLRRPNLDYAALMTLE---------------------GAMP-----------------
MNMG_CHRVO       QDLLKRPNVPYRELMTVP---------------------EAADG----------------
MNMG_POLAQ       TELLRRPGITYEAITALG------------------NRIWAPESLDD-------------
MNMG_ACIBT       IDLLKRPNINFSQIAELT---------------------GSE------------------
MNMG_ACIBY       IDLLKRPNINFGQIAELT---------------------GSE------------------
MNMG_ACIAD       IDLLKRPNINFTQIAELT---------------------GSQ------------------
MNMG_PSYA2       YDLLKRPQIHFNDIAAIT---------------------GSE------------------
MNMG_PSYCK       FDLLKRPQIHFADIAAIT---------------------DSQ------------------
MNMG_PSYWF       YDLLKRPNVGFNDIAAVT---------------------GAQ------------------
MNMG_PSEAE       LNLLSRPEIDYAGLVEIT---------------------GNA------------------
MNMG_PSEAB       LNLLSRPEIDYAGLVEIT---------------------GDA------------------
MNMG_PSEA7       LNLLSRPEIDYASLVEIT---------------------GDA------------------
MNMG_PSEPU       LNLLARPEIDYAGLIEAT---------------------GGE------------------
MNMG_PSEPK       LNLLARPEIDYAGLIEAT---------------------GGE------------------
MNMG_PSEP1       LNLLARPEIDYAGLIEAT---------------------GGE------------------
MNMG_PSEPG       LNLLARPEIDYAGLIEAT---------------------GGE------------------
MNMG_PSEPW       LNLLARPEVDYAGLIEAT---------------------GGE------------------
MNMG_PSEE4       LNLLARPEVDYAGLIEAT---------------------GGE------------------
MNMG_PSEF5       LNLLSRPEIDYAGLVEVT---------------------GQG------------------
MNMG_PSEPF       LNLLSRPEIDYAGLVEVT---------------------GLG------------------
MNMG_PSE14       LNLLTRPEIDYASLIAIT---------------------GQG------------------
MNMG_PSEU2       LNLLTRPEIDYASLISIT---------------------GQG------------------
MNMG_PSESM       LNLLTRPEIDYNSLIALT---------------------GQG------------------
MNMG_PSEMY       LNLLARPEIDYAALAEIT---------------------ESP------------------
MNMG_PSEU5       LNLLARPEIDYQSLIELT---------------------GPG------------------
MNMG_ALCBS       LDLLKRPELTYANLAEAV---------------------ALAD-----------------
MNMG_HAHCH       HDLLKRPEMTWEKLSLLD---------------------ADVA-----------------
MNMG_MARMS       LDLLKRPNIVYSDIANLK---------------------NGLD-----------------
MNMG_SACD2       LDLLKRPELTYDDLGSLK---------------------GEAV-----------------
MNMG_CHRSD       ADLLKRPELNHADLADDA---------------------PEL------------------
MNMG_MARHV       AELLRRPEIVYDHIAEIG---------------------AER------------------
MNMG_ALKEH       EELLRRPDVGYADLMRLP---------------------GAGDPVP--------------
MNMG_NITOC       IELLRRPHISYEKLMRLI---------------------GEPMAV---------------
MNMG_METCA       LELLRRPDVGLEHIAGHA---------------------PDLFEGM--------------
MNMG_XANAC       LDLIKRPELTYATLMRVP---------------------TLGPGVD--------------
MNMG_XANC5       LDLIKRPELTYATLMRVP---------------------TLGPGVD--------------
MNMG_XANOR       LDLIKRPELNYATLMRVP---------------------TLGPGVD--------------
MNMG_XANOM       LDLIKRPELNYATLMRVP---------------------TLGPGVD--------------
MNMG_XANCP       LDLIKRPELSYAALMRVP---------------------TLGPGVD--------------
MNMG_XANC8       LDLIKRPELSYAALMRVP---------------------TLGPGVD--------------
MNMG_XANCB       LDLIKRPELSYAALMRVP---------------------TLGPGVD--------------
MNMG_XYLFA       IDLMKRPELDYAALMRVP---------------------SLGPGVD--------------
MNMG_XYLFT       IDLMKRPELDYAALMRVP---------------------SLGPGVD--------------
MNMG_COXBU       MDLLRRPEINYPALMQIE---------------------ELGPAVLE-------------
MNMG_COXBN       MDLLRRPEINYPALMQIE---------------------ELGPAVLE-------------
MNMG_COXBR       MDLLRRPEINYPALMQIE---------------------ELGPAVLE-------------
MNMG_LEGPC       AEFLKRPEINYQHLLMMD---------------------DLNLPELP-------------
MNMG_LEGPA       AEFLKRPEINYQHLLMMD---------------------DLNLPELP-------------
MNMG_LEGPL       AEFLKRPEINYRHLLMMD---------------------DLNLPELP-------------
MNMG_LEGPH       VEFLKRPEINYQHLLMMD---------------------DLNLPELP-------------
MNMG_NITEU       YDLLRRPEIGYAELVSLS---------------------ARGQSVID-------------
MNMG_NITEC       YELLRRPGISYTELVSLS---------------------EVESSMID-------------
MNMG_FRATF       FDLLKRPEIDYSKLQQIS---------------------ELNLNLQD-------------
MNMG_FRATH       FDLLKRPEIDYSKLQQIS---------------------ELNLNLQD-------------
MNMG_FRATO       FDLLKRPEIDYSKLQQIS---------------------ELNLNLQD-------------
MNMG_FRATW       FDLLKRPEIDYSKLQQIS---------------------ELNLNLQD-------------
MNMG_FRATT       FDLLKRPEIDYSKLQQIS---------------------ELNLNLQD-------------
MNMG_FRAT1       FDLLKRPEIDYSKLQQIS---------------------ELNLNLQD-------------
MNMG_FRATN       FDLLKRPEIDYSKLQQIS---------------------ELNLNLQD-------------
MNMG_FRAP2       FDLLKRPELDYKKLQQIP---------------------DTNLKLED-------------
MNMG_VESOH       FELLKRPKVDYQILSKIE---------------------SGKPFLTD-------------
MNMG_RUTMC       LELLKRPKIDYQILSQIE---------------------SGKPFLTD-------------
MNMG_DICNV       AELLKRPEIDVRAVLALA---------------------NVPPDEYP-------------
MNMG_BLOFL       EDLLKRPEMNYVKLM---------------------QLNTFQSVKLD-------------
MNMG_BLOPB       EDLLRRPEINYKKLS---------------------QLSTFSPSILD-------------
MNMG_BAUCH       EELLRRPEINYKTLT---------------------NLSFFQPTLKN-------------
MNMG_BUCAI       SELLKRPQIRYQDLQ---------------------SLESFRTGIVD-------------
MNMG_BUCAP       LNLLKRPEITYENLK---------------------YLKNFKVGISD-------------
MNMG_BUCBP       KDLLKRPEINYSTLM---------------------LFKKFSPGIKD-------------
MNMG_WIGBR       EEILRRPEITYNDLI---------------------CYNFIKRKLKD-------------
MNMG_BUCCC       FDLLRRPEISYNDLILFL-----------------NSFLKKKIVIKN-------------
MNMG_HALHL       FDLLRRPELSYDDVRFIG---------------------GLEEADLP-------------
MNMG_RHIME       FDILSYPDQSIAALKPLWPE--------------------LQTIPA--------------
MNMG_SINMW       FEILSYPDQSIEGLRPLWPE--------------------LQAIAT--------------
MNMG_RHIEC       YDFLSYPTYDFAALRKVWPEE-------------------LGRLRP--------------
MNMG_RHIL3       YDLLSYPNYSFAALSDVWPEK-------------------LGMIGP--------------
MNMG_AGRFC       YELLAYPDMTLQALAEHWPE--------------------LNRLNA--------------
MNMG_BARHE       YDLLAYPHMSIERLSHIWPQ--------------------LQSIDS--------------
MNMG_BARQU       YDLLAYPHMSIERLSHFWQQ--------------------LQSIDP--------------
MNMG_BART1       YDFLAYPHMTLERLSHFWPQ--------------------LQAIDS--------------
MNMG_BARBK       YSLLSYPNMNVARLTDFWPQ--------------------LHSIDA--------------
MNMG_BRUAB       YDLLSYPDINLDRLIAIWPE--------------------LASIDP--------------
MNMG_BRUA2       YDLLSYPDINLDRLIAIWPE--------------------LASIDP--------------
MNMG_BRUC2       YDLLSYPDINLDRLIAIWPE--------------------LASIDP--------------
MNMG_BRUSU       YDLLSYPDINLDRLIAIWPE--------------------LASIDP--------------
MNMG_BRUSI       YDLLSYPDINLDRLIAIWPE--------------------LASIDP--------------
MNMG_BRUME       YDLLSYPDINLDRLIAIWPE--------------------LASIDP--------------
MNMG_BRUO2       YDLLSYPDINLDRLIAIWPE--------------------LASIDP--------------
MNMG_BRUA4       YDLLSYPEIDLDRLKSIWPE--------------------LGAVDP--------------
MNMG_RHILO       YELLAYPDVDVAWLARVEPK--------------------FAAIDA--------------
MNMG_CHESB       YDLLSFADINIERLKAIWPE--------------------LGSIAP--------------
MNMG_BRASB       FELMAYPEIGFSEVRGIWPE--------------------LGTIGP--------------
MNMG_BRASO       FELMAYPEIDFAKVRSIWPE--------------------LEAIDP--------------
MNMG_BRADU       FELMAYPDIGWSQVRAIWLE--------------------LSAIDP--------------
MNMG_NITHX       FELLAYPEIGWGEVAAIWPE--------------------LSAIDP--------------
MNMG_NITWN       FELLSYPEIGWREVAAIWPE--------------------LSAIDP--------------
MNMG_RHOPS       FDLLSYPEIGWDEVKAIWPE--------------------LAAVSP--------------
MNMG_RHOP2       FDLLSYPEIEWPQVRAIWPE--------------------LAAVSP--------------
MNMG_RHOPA       FDLLSYPEIEWAQVRAIWPE--------------------LGKVDP--------------
MNMG_RHOP5       FELLAYPEVGWDDVRRIWPE--------------------LGAVEP--------------
MNMG_RHOPB       FELLAYPEVDWARVEAIWPE--------------------LAAIEP--------------
MNMG_AZOC5       FDLLAYPDITLETLAGIWPE--------------------FGALEP--------------
MNMG_METPB       FQLLSYPEIGWDRLAAIWPD--------------------LAAVPP--------------
MNMG_METRJ       FQLLAYPEIGWADLAAVWPD--------------------LAEVPP--------------
MNMG_METS4       FQLLSYPEIDWPRLAAIWPE--------------------LAAVPP--------------
MNMG_BEII9       FDLLALPDVTLETLRSIWPE--------------------LKTIPE--------------
MNMG_PARL1       MDLLAYPDIDAGVLAGVWPE--------------------LAALEP--------------
MNMG_RHORT       LDLLCHADIDWARLVALWPE--------------------LGAIRP--------------
MNMG_MAGSA       WDLLAYPELGLQALAAVWPE--------------------LDSLSG--------------
MNMG_CAUVC       FAMLAYPDVTLDDLGRIWPE--------------------VFTWNT--------------
MNMG_CAUSK       LAMLALPEVTLDRLATVWPQ--------------------ISTWSP--------------
MNMG_MARMM       TELLAYPDVGWDRLVGIWPE--------------------LGRVSP--------------
MNMG_HYPNA       WEYLSYKEICFDHLAQVWPE--------------------LSAIPA--------------
MNMG_GLUOX       LDVLASNGD-HTKLDTLAPW--------------------FAELPL--------------
MNMG_GLUDA       LDVLATAAT-PDAIARIAPW--------------------FAALPS--------------
MNMG_GRABC       LSLIGSDPEQDQKLNQAFPW--------------------LHDLDP--------------
MNMG_ACICJ       ----GAGSE---------------------------------------------------
MNMG_RUEPO       FAVLAFPDVRFDDLVPLIPE--------------------LADTDA--------------
MNMG_RUEST       LDVLAFPKVEFDDILPLFPE--------------------LADTET--------------
MNMG_ROSDO       MQLLAFPNTSFKDLSLLDPV--------------------FDGIDV--------------
MNMG_DINSH       LDLLSLSNVSYESLAATWPE--------------------LQAS-T--------------
MNMG_RHOS1       FAVMAFGEEAASAVARGVEG--------------------YGDLPE--------------
MNMG_CERS4       FAVMAFGEEAASAVARGVEG--------------------YGDLPE--------------
MNMG_CERS5       FDVMAFGEEAASAVERAVPE--------------------LALLPH--------------
MNMG_PARDP       FALLAQQEIPQDQVLALDDQ--------------------LVLQDP--------------
MNMG_JANSC       AELLAFPSVELSDIAQLEPA--------------------VGQIDP--------------
MNMG_NOVAD       MEWLRFPEVTLDGLRDWIGN--------------------EP-FDP--------------
MNMG_ERYLH       REWLRFPTIDFPDLAPLVPE--------------------VD-TGT--------------
MNMG_SPHAL       IDLLRFPGATVERLTILVPE--------------------IESIDR--------------
MNMG_SPHWW       TEWLRFPEVGDAELTVLAPE--------------------LVDVPE--------------
MNMG_ZYMMO       FEWLRFPAVTRQHLEALIPE--------------------LTEFSD--------------
MNMG_ANAMM       FELLGHPSITMDILIQLWPSL-------------------NSFSR---------------
MNMG_ANAPZ       FELLSHPNINMEVLLKIWPSL-------------------RSFSA---------------
MNMG_EHRCJ       FDLLSHPNINIETVSKICDVI-------------------KKFSK---------------
MNMG_EHRCR       FDLLGHPNINMEIVSRICNTV-------------------KEFNK---------------
MNMG_EHRRG       FDLLSNPNINMNILSKICNQI-------------------KNYHA---------------
MNMG_EHRRW       FDLLSNPNINMNILSKIFNQI-------------------KNYHA---------------
MNMG_WOLPM       LDLLSYPNIDWNKLQEIWPEL-------------------SSVTRWNGK-----------
MNMG_WOLTR       LDLLSYPNIDWNKLQEIWPEL-------------------TNVTRWNDNKADQTVIQVVD
MNMG_NEOSM       WNLITQPLFVFEDLLRIWPEL-------------------SEVPE---------------
MNMG_RICRO       LDLFKIPNFNVEQAIKIFPML-------------------KETQNN--------------
MNMG_RICRS       LDLFKIPNFNVEQAIKIFPML-------------------KETQNN--------------
MNMG_RICCN       LDLFKIPNFNVEQAIKIFPML-------------------KETQNN--------------
MNMG_RICM5       LDLFKIPNFNVEQAIKIFPML-------------------KETQNN--------------
MNMG_RICFE       LDLFKIPSFNVEQAIKIFPML-------------------KEMQNN--------------
MNMG_RICAH       LDLFKIPSFNIEQAIKIFPML-------------------KEMQNN--------------
MNMG_RICCK       LDLFKIPNFTIEQAIKIFPKL-------------------QEI-NS--------------
MNMG_RICB8       LDLFKIPNFDVEQAIKIFPVL-------------------KNV-DN--------------
MNMG_RICBR       LDLFKIPNFDVEQAIKIFPVL-------------------KNV-DN--------------
MNMG_RICPR       LDLFKIPSFNVEQAIKIFPIL-------------------KKQ-NN--------------
MNMG_RICTY       LDLFKIPTFNVEQAIKIFPIL-------------------RKQ-NN--------------
MNMG_ORITB       FSLLGLPNFGINIVKDIYPEL-------------------NRY-DN--------------
MNMG_PELUB       NEILTQKGVNMKKIREIWPEI-------------------PYFDKK--------------
MNMG_KORVE       VQLLKRPESDVAAFEQIIRRV------------------QPTFFERGDSERE--------
MNMG_SOLUE       -QLLKRPEVSISDFLPWIVEV------------------LGEAPCRG-------------
MNMG_MAGMM       SEILKRTD---CDLEKVCEAM------------------QLDALSKN-------------
MNMG_CAMJE       QKIVARASFDIEKLKKLDPIF--------------------ETMDH--------------
MNMG_CAMJJ       QKIVARASFDIEKLKKLDPIF--------------------ETMDH--------------
MNMG_CAMJR       QKIVARASFDIEKLKKLDPIF--------------------ETMDH--------------
MNMG_CAMJ8       QKIVARASFDIEKLKKLDPMF--------------------ETMDN--------------
MNMG_CAMJD       QKIVARASFDIEKLKKLDPMF--------------------ETMDN--------------
MNMG_CAMC1       QKIVARKSFTAEKLRKLDERF--------------------VNLDD--------------
MNMG_CAMC5       QKIVARKSFTSEKLRKLDAFF--------------------ENLDE--------------
MNMG_CAMFF       QKIAARKSFTIEKLRKLNEFF--------------------LNLDD--------------
MNMG_CAMHC       QKIVGGKNFSAEKIREIDSMF--------------------VDFSD--------------
MNMG_NITSB       VNVVARPTFTMEKLEVLVPEI--------------------QEFSE--------------
MNMG_SULDN       EQIVARKSFDVSKMLKLIPEF--------------------EMYES--------------
MNMG_ARCB4       VDLIGRNSIDIFKFEKLVPSF--------------------AHLDN--------------
MNMG_SULNB       IDVIGRGDFNRDKLVSLLPEF--------------------DKYDD--------------
MNMG_HELPY       VSLLARDSFNAEKMRSFFSFL--------------------APLNE--------------
MNMG_HELPH       ISLLARDSFNAEKMRSFFSFL--------------------APLNE--------------
MNMG_HELPJ       VSLLARDSFNLEKMRSFFSFL--------------------VPLNE--------------
MNMG_HELAH       VDLLARDSFSLEKMRSFFSFL--------------------APLSE--------------
MNMG_HELHP       IHIVGREELDCALLRTLLTHLGITDV---------------ESMSD--------------
MNMG_WOLSU       LAIAGRKSFDEAKLRKISPLF--------------------EEMSE--------------
MNMG_LEPIN       DSFLKRPEIKIKDIEFMIPEV--------------------SSWSD--------------
MNMG_LEPIC       DSFLKRPEIKIKDIEFMIPEV--------------------SSWSD--------------
MNMG_LEPBJ       DSFLKRPEIKIEDVEFMLPEV--------------------SSWSE--------------
MNMG_LEPBL       DSFLKRPEIKIEDVEFMLPEV--------------------SSWSE--------------
MNMG_LEPBA       SSFLKRSDIKIKDLEPIVSEL--------------------SILNE--------------
MNMG_LEPBP       SSFLKRSDIKIKDLEPIVSEL--------------------SILNE--------------
MNMG_GEOMG       EQLLRRPDITYEELCRIDPRAAE-------------------------------------
MNMG_GEOSL       EQLLRRPDITYEELSQIDPVAGM-------------------------------------
MNMG_GEOUR       EQLLRRPDIDSRELARIDKHIME-------------------------------------
MNMG_PELPD       EQLLRRPEITYDDLLSFDTVSRE-------------------------------------
MNMG_PELCD       VQILRRPDINIEDLVFCDDRLAD-------------------------------------
MNMG_DESPS       SSLLRRPEINITFLQKLPLTAGDKEAVIAL------------------------------
MNMG_DESVH       ADILRRPSLTLPDLAPFWEGVTR-------------------------------------
MNMG_DESVV       ADILRRPSLTLPDLAPFWEGVTR-------------------------------------
MNMG_DESAG       ADLLRRPALGITDLQAFGLETDG-------------------------------------
MNMG_LAWIP       EELLKRPSITFQTLRKIYSDLPI-------------------------------------
MNMG_SYNFM       DKLLKRPELNYSTVAILSP-------PPEP------------------------------
MNMG_SYNAS       FQLLKRTDLSWEDLSMFQDLPDFPEDVPDG------------------------------
MNMG_CHLTE       LSLIKRPGISLQDILEHSLSVRSAAEELCND-----------------------------
MNMG_CHLCH       TTLLKRPRVTLAKLLATSPELHSQLSNISNN-----------------------------
MNMG_CHLPM       ASALKRPGITLNRLFAALPDFAKEARLISSN-----------------------------
MNMG_CHLL3       SAAIKRPGMSLEILMNSLPPFREALLSISTD-----------------------------
MNMG_CHLPD       SNLLKRPEIDFENLLVLSEDFRAGVNEITTD-----------------------------
MNMG_BACFR       IDLINRPQITIENISEYVPAFKRELDKITDE-----------------------------
MNMG_BACFN       IDLINRPQITIENISEYVPAFKRELDKITDE-----------------------------
MNMG_BACTN       IEILNRPQITIENIAEHVPAFQRELEKATAADSD--------------------------
MNMG_PHOV8       IDLLNRPQITIENIAGHIPAFKAMLDQITDR-----------------------------
MNMG_PARD8       FDVVLRPQTTLENLADLVPALRAELDKVPAS-----------------------------
MNMG_PORGI       YDLLLRPQIGMNEVCSMVPSLQRIVEEIPAS-----------------------------
MNMG_FLAJ1       FKVFSRPQIELEDMLKF--EKVDSYIKENN------------------------------
MNMG_FLAPJ       FKILSRPQIDLSDVLKF--ENVANYVANNN------------------------------
MNMG_GRAFK       FKVFSRPQITMEDVKNF--SGVEEFISENE------------------------------
MNMG_CYTH3       YNLLKRP--NMEVSLFA--EKVEEIKTLIEP-----------------------------
MNMG_SULMW       CDLLSRPEISIYDIIKL--SLIKNFIKKNN------------------------------
MNMG_SALRD       IELCKRPEVDSEDLLRHAGLYDEVVTEAPGM-----------------------------
MNMG_BORAP       YHILKDPSISLDNLIKID-------PSLSD------------------------------
MNMG_BORBP       YHILKDPSISLDNLIKID-------PSLSD------------------------------
MNMG_BORBU       YHILKDPSISLDNLIKID-------PSLSD------------------------------
MNMG_TREDE       ADALHDPQVSLECICAID-------ENSKDY-----------------------------
MNMG_TREPA       AATLRDPVIPLGLIASLN-------EQIAQF-----------------------------
MNMG1_FUSNN      SEILKIKDVSYDNLKVF------LNLNDYED-----------------------------
MNMG2_FUSNN      LELLRRPEVSFEDIKYISEEIRGIDLQGYDH-----------------------------
MNMG_ENDTX       ------------------------------------------------------------
MNMG_ONYPE       AQLLKRPELNFCTLQHFLQEKA--------------------------------------
MNMG_AYWBP       AQLIKRPELNFCTLQHFLQEKA--------------------------------------
MNMG_ACHLI       FKLLERPELKIETLKHFLPSDY--------------------------------------
MNMG_MYCCT       YEIIKIPTVDINELIEFIPSLQ-K------------------------------------
MNMG_MYCMS       YEIIKIPTVDINELIEFIPSLQ-K------------------------------------
MNMG_MESFL       IEILKIPTVDIEVMIPYISSLQ-N------------------------------------
MNMG_MYCGE       YDFNKRSEINLDKLIKDLPEKY-Q------------------------------------
MNMG_MYCPN       FDFTKRAEIKLVDLVQLLPKRF-D------------------------------------
MNMG_MYCGA       YEFLKRPEIKLIELLKLIEFDYSN------------------------------------
MNMG_UREPA       IDYLKRPEIKLNDLLIYCPIKI--------------------------------------
MNMG_UREP2       IDYLKRPEIKLNDLLIYCPIKI--------------------------------------
MNMG_MYCPE       YEILKRPDYSFIDMEPFLKNKN-T------------------------------------
MNMG_MYCH7       LKLISWPNVNFKDILPDFEFGY--------------------------------------
MNMG_MYCHJ       LKLISWPNVNFKDILPDFEFGY--------------------------------------
MNMG_MYCH2       LKLISWPNVNFKDILPDFEFGY--------------------------------------
MNMG_MYCPU       FQALTRPDIEPSDLIKDFEFLN--------------------------------------
MNMG_MYCS5       LKLLLRPEINPKDILKNYKYQN--------------------------------------
MNMG_MYCMO       LQLISRHEIDIKEIVGNFPFLE--------------------------------------
MNMG_MYCAP       LNVISRPDVDPSDIIPNFPYLE--------------------------------------
MNMG_THEM4       YNLLKRPEISYNDIEELDSERIT-------------------------------------
MNMG_FERNB       AKLLRRPEVSYNALKHLDPEPIS-------------------------------------
MNMG_THEMA       YQLLKRPQLSYSALKFLDPNPID-------------------------------------
MNMG_THESQ       YQLLKRPQLSYSALKFLDPNPID-------------------------------------
MNMG_THEP1       YHLLKRPQLSYSTLKFLDPNPMD-------------------------------------
MNMG_PETMO       SELLKRSEISYTDLKHLDEEAVE-------------------------------------
MNMG_BDEBA       EELLRRPELTSSHLELLNFELD--------------------------------------
MNMG_ALKMQ       YDLLKRPEVTYKVLKKIDENRNVD------------------------------------
MNMG_ALKOO       YDLLKRPELTYENIKEIDGTRPQD------------------------------------
MNMG_CLOD6       YEFLKRPEVTYELLEELGKGAGDD------------------------------------
MNMG_FINM2       LDLIKRPELTYDKTEEFDAER-TE------------------------------------
MNMG_CALS8       SELLKRPELSYEALREIDPQRPD-------------------------------------
MNMG_ACET2       ADLLRRPELDYDTLAEIDENRPD-------------------------------------
MNMG1_CALS4      YTLLKRPEVDYKSTKFLDPDRPDD------------------------------------
MNMG2_CALS4      YTLLKRPEIDYKSTKFLDPTRPDD------------------------------------
MNMG_THEP3       YTLLKRPEIDYKSTKFLDKNRPDD------------------------------------
MNMG_THEPX       YTLLKRPEIDYKSTKFLDKNRPDD------------------------------------
MNMG_CLOB1       YELIKRPELDYFKVESLDDKRPS-------------------------------------
MNMG_CLOBH       YELIKRPELDYFKVESLDDKRPS-------------------------------------
MNMG_CLOBL       YELIKRPELDYFKVEPLDDKRPS-------------------------------------
MNMG_CLOBK       YELIKRPELDYFKVEPLDDKRPS-------------------------------------
MNMG_CLOBM       YELIKRPELDYFKVEPLDDKRPN-------------------------------------
MNMG_CLONN       YELIKRPELNYFVVKDLDKDRAE-------------------------------------
MNMG_CLOAB       YELIRRPELDYDKLQTLDIDRKD-------------------------------------
MNMG_CLOTE       YELIKRPELDYYKVEQLDKGRIN-------------------------------------
MNMG_CLOK5       YELIKRPELDYFKLQLLDMDRPE-------------------------------------
MNMG_CLOP1       YELIKRPELDYFSLACLDPERPD-------------------------------------
MNMG_CLOPS       YELIKRPELDYFSLACLDPERPD-------------------------------------
MNMG_CLOPE       YELIKRPELDYFSLACLDPERPD-------------------------------------
MNMG_CLOB8       YELLQRPELDYFDLKQIDSERPE-------------------------------------
MNMG_LACP7       AELVRRPELTYAALAPLDKNREP-------------------------------------
MNMG_NATTJ       FHILKRPEISYEALEYFDETRPD-------------------------------------
MNMG_BACVZ       TDLMKRPEMNYETVTKLAPAD-SP------------------------------------
MNMG_BACSU       TDLMKRPEMNYETVTKLAPPE-VP------------------------------------
MNMG_BACLD       TDLMKRPEMNYETVTALAPPE-QK------------------------------------
MNMG_BACP2       SDLMKRPEMNYESVVRLAPAE-TP------------------------------------
MNMG_BACAH       SDLLRRPEMTYEHIHLLVPSE-VE------------------------------------
MNMG_BACHK       SDLLRRPEMTYEHIHLLVPSE-VE------------------------------------
MNMG_BACAN       SDLLRRPEMTYEHIHLLVPSE-VE------------------------------------
MNMG_BACCZ       SDLLRRPEMTYEHIHLLVPSE-VE------------------------------------
MNMG_BACC1       SDLLRRPEMTYEHIHLLVPSE-VE------------------------------------
MNMG_BACCR       SDLLRRPEMAYEHIHLLVPSE-VE------------------------------------
MNMG_BACMK       SDLLRRPEVTYEHIHLLVPSE-VA------------------------------------
MNMG_BACCN       SDLLRRPEMTYEHIRLLAPSE-LE------------------------------------
MNMG_GEOKA       ADLLRRPEMTYEHIRKLAPAD-EE------------------------------------
MNMG_GEOTN       ADLLRRPEMTYEHIQKLAPAD-ED------------------------------------
MNMG_LYSSC       ADLLKRPEMHYEMISSLIPAD-IE------------------------------------
MNMG_STAA2       IDLLRRPEMTYDIILEILEEE-HQ------------------------------------
MNMG_STAA9       IDLLRRPEMTYDIILEILEEE-HQ------------------------------------
MNMG_STAAR       IDLLRRPEMTYDIILEILEEE-HQ------------------------------------
MNMG_STAAS       IDLLRRPEMTYDIILEILEEE-HQ------------------------------------
MNMG_STAA1       IDLLRRPEMTYDIILEILEEE-HQ------------------------------------
MNMG_STAAM       IDLLRRPEMTYDIILEILEEE-HQ------------------------------------
MNMG_STAAW       IDLLRRPEMTYDIILEILEEE-HQ------------------------------------
MNMG_STAAN       IDLLRRPEMTYDIILEILEEE-HQ------------------------------------
MNMG_STAAB       IDLLRRPEMTYDIILEILEEE-HQ------------------------------------
MNMG_STAA8       IDLLRRPEMTYDIILELLEEE-HQ------------------------------------
MNMG_STAA3       IDLLRRPEMTYDIILELLEEE-HQ------------------------------------
MNMG_STAAC       IDLLRRPEMTYDIILELLEEE-HQ------------------------------------
MNMG_STAAE       IDLLRRPEMTYDIILELLEEE-HQ------------------------------------
MNMG_STAAT       IDLLRRPEMTYDIILELLEEE-HQ------------------------------------
MNMG_STAES       IDLLRRPEMNYETILEILEES-HQ------------------------------------
MNMG_STAEQ       IDLLRRPEMNYETILEILEES-HQ------------------------------------
MNMG_STAHJ       IDLLRRPEMTYNTILEILEES-HQ------------------------------------
MNMG_STAS1       LELLRRPEMTYDLILEILDES-HQ------------------------------------
MNMG_LISMO       ADLLRRPEITYDKIAQIVSRE-TF------------------------------------
MNMG_LISMF       ADLLRRPEITYDKIAQIVSRE-TF------------------------------------
MNMG_LISIN       ADLLRRPEITYDKIAQIVSRE-TF------------------------------------
MNMG_LISW6       ADLLRRPEITYDKIAQIVSRE-TF------------------------------------
MNMG_OCEIH       YDLMKRPELSYDIVDQMIESN-LE------------------------------------
MNMG_BACSK       TAVLKRPEMTYDHFLKIIPRPDVE------------------------------------
MNMG_ALKHC       NVFLKRPEVTYEHVAKVIPAPEQE------------------------------------
MNMG_EXIS2       ITLLKRPEITYAMIADMTPPP-VA------------------------------------
MNMG_LEVBA       AAFLRRPYVDYQTLLQFIDAPEQP------------------------------------
MNMG_LACPL       ADFLKRPEVQYADLMKFIPAAPEP------------------------------------
MNMG_PEDPA       SEFLRRPEVNYSDLLKFIDAPEKD------------------------------------
MNMG_LACS1       TEFLRRPYVTYQDLLKFIPAPAEP------------------------------------
MNMG_ENTFA       RDFLKRPEISYQEVAQFIPAPEEA------------------------------------
MNMG_LACSS       SDFLKRPEVKYADLIQFIPA-VEG------------------------------------
MNMG_LACP3       SDFLKRPEIDYQTMAQFLPD-NPT------------------------------------
MNMG_LACAC       DVFLRRPHVTINDIERLTGQ-KID------------------------------------
MNMG_LACH4       DVFLRRPNVKIADIERLTGE-KIP------------------------------------
MNMG_LACJO       ADFLKRPRVTFDAVERLSGE-TLA------------------------------------
MNMG_LACGA       ADFLKRPRVTFDAVEKLSGQ-TLA------------------------------------
MNMG_LACDA       DVFLRRPRVTVEDVERLTGQ-KLA------------------------------------
MNMG_LACDB       DVFLRRPRVTVEDVERLTGQ-KLA------------------------------------
MNMG_LACLM       AEFLKRPEVNYDEVIDFIGQAPEV------------------------------------
MNMG_LACLS       AEFLKRPEVHYDEVIDFIGQAPEV------------------------------------
MNMG_LACLA       AEFLKRPEVHYNEVIDFIGQAPEK------------------------------------
MNMG_STRA3       KEFMRRPQITYAVATDFVGCADEP------------------------------------
MNMG_STRA5       KEFMRRPQITYAVATDFVGCADEP------------------------------------
MNMG_STRA1       KEFMRRPQITYAVATDFVGCADEP------------------------------------
MNMG_STRP1       KEFMRRPEIDYATAVSFVGPAAED------------------------------------
MNMG_STRPD       KEFMRRPEIDYATAVSFVGPAAED------------------------------------
MNMG_STRPB       KEFMRRPEIDYATAVSFVGPAAED------------------------------------
MNMG_STRPC       KEFMRRPEIDYATAVSFVGPAAED------------------------------------
MNMG_STRPG       KEFMRRPEIDYATAVSFVGPAAED------------------------------------
MNMG_STRP8       KEFMRRPEIDYATAVSFVGPAAED------------------------------------
MNMG_STRPF       KEFMRRPEIDYATAVSFVGPAAED------------------------------------
MNMG_STRPM       KEFMRRPEIDYATAVSFVGPAAED------------------------------------
MNMG_STRP3       KEFMRRPEIDYAIAVSFVGPAAED------------------------------------
MNMG_STRP6       KEFMRRPEIDYATAVSFVGPAAED------------------------------------
MNMG_STRT2       KEFMRRPEIDYATATQFVGPAAED------------------------------------
MNMG_STRT1       KEFMRRPEIDYATATQFVGPAAED------------------------------------
MNMG_STRTD       KEFMRRPEIDYATATQFVGPAAED------------------------------------
MNMG_STRMU       KEFMRRPEINYAIATSFVGPAAES------------------------------------
MNMG_STRGC       KEFMRRPEVSYQDVVQFIGPAAEE------------------------------------
MNMG_STRSV       KEFMRRPEVSYQDVVQFIGPAAEE------------------------------------
MNMG_STRR6       KEFLRRPEVSYQDVVAFIGPAAEE------------------------------------
MNMG_STRP2       KEFLRRPEVSYQDVVAFIGPAAEE------------------------------------
MNMG_STRPN       KEFLRRPEVSYQDVVAFIGPAAED------------------------------------
MNMG_STRPI       KEFLRRPEVSYQDVVAFIGPAAED------------------------------------
MNMG_STRSY       KEFMRRPDVTYADAVAFIGPAAED------------------------------------
MNMG_STRS2       KEFMRRPDVTYADAVAFIGPAAED------------------------------------
MNMG_DESRM       INLLRRPEIKYNTLAGLSDHFLD-------------------------------------
MNMG_PELTS       AGLLRRPEIGYEHLLQIPGNHPD-------------------------------------
MNMG_CARHZ       KEFLRRPEINMEAIEKIFAIDGQ-------------------------------------
MNMG_MOOTA       KDLMRRPRIKYQDLAAAGLVPE--------------------------------------
MNMG_HELMI       YDLLRRPELTYDDLIPLCNDGEKDLP----------------------------------
MNMG_SYNWW       WELLRRPELSIYDYVEKGWLRD--------------------------------------
MNMG_DESAP       SELLRRPEIRYADLVGLGVADPD-------------------------------------
MNMG_SYMTH       EQLLRRPEVRYEHLVEMGLGRPD-------------------------------------
MNMG_DESHY       EELMRRPEITINEIKQLIPQLAE-------------------------------------
MNMG_ROSCS       EDVLRRPEVRYEQLRQAL-DLPAC------------------------------------
MNMG_ROSS1       EEVLRRPEVRYRQLQPAL-DLPAC------------------------------------
MNMG_CHLAA       AEVLARPEVRYTQLRDALPDLPAL------------------------------------
MNMG_DEIRA       DAWLRRPELSLADVETLGATLPAE------------------------------------
MNMG_DEIGD       DAWLRRPEFALEDVEALGFKLPA-------------------------------------
MNMG_THET2       LQWLRRPENTYRALAE-RFPPPEP------------------------------------
MNMG_THET8       LQWLRRPENTYRALAE-RFPPSEP------------------------------------
MNMG_MYXXD       -ARLRRPEVTYAQLGE-GREDWPV------------------------------------
                                                                             

MNMG_NOSS1       -------------------------------LTPAEKEGAEIDIKYSGYLARQQSQIEQI
MNMG_TRIV2       -------------------------------LTPAEREGAEIDIKYSGYLARQQSQIEQI
MNMG_TRIEI       -------------------------------LKLVEKEGAEIDIKYSGYLQRQQNQIDQI
MNMG_SYNY3       -------------------------------LKPEEKTSVEIEIKYSGYIKRQQTQIEQV
MNMG_SYNP2       -------------------------------LTQAEQAGAEIDIKYSGYIKRQQNQIDQI
MNMG_MICAN       -------------------------------INLAEREGVEIEIKYSGYLKRQQNQIDQI
MNMG_ACAM1       -------------------------------LERSERESVEIEIKYAGYIQRQQRQIEQV
MNMG_SYNP6       -------------------------------LAIAEKEGAEIAIKYAGYLQRQQAQVDQV
MNMG_SYNE7       -------------------------------LAIAEKEGAEIAIKYAGYLQRQQAQVDQV
MNMG_THEEB       -------------------------------LTPQEKEAVEIAIKYAGYIERQQREIEQI
MNMG_SYNJB       -------------------------------LDPFEQEAAEIAVKYSGYIQRQQSQIEQV
MNMG_SYNJA       -------------------------------LDPFEQEAAEIAVKYSGYIQRQQAQIEQV
MNMG_PROM1       -------------------------------IPLDVEEAVEIDIKYSGYLERQKAQINQL
MNMG_PROMT       -------------------------------IPLDVEEGVEIDIKYSGYLERQKAQINQL
MNMG_PROMA       -------------------------------LPLDVREGVEIDIKYSGYLKRQNLQIEQI
MNMG_PROM3       -------------------------------LALGVREGAEIDIKYSGYLQRQQQQIDQL
MNMG_PROMM       -------------------------------LALGVREGAEIDIKYSGYLQRQQQQIDQL
MNMG_SYNSC       -------------------------------LPLPVREGAEIDIKYSGYLQRQQQQIDQV
MNMG_SYNPX       -------------------------------LPLPVREGAEIDIKYSGYLQRQQQQIDQV
MNMG_SYNS9       -------------------------------LPLPVREGAEIDIKYSGYLQRQQQQIDQV
MNMG_SYNPW       -------------------------------LPLPVREGAEIDIKYSGYLARQQQQIDQV
MNMG_SYNS3       -------------------------------LPLAVREGAEIDIKYSGYLQRQQQQIDQV
MNMG_SYNR3       -------------------------------LPVDVREGAEIDVKYSGYLARQTQQIERV
MNMG_PROMS       -------------------------------LGSSIQEGVEIDIKYEGYLKRQKNNIEQI
MNMG_PROM0       -------------------------------LGSSIQEGVEIDIKYEGYLKRQKNNIEQI
MNMG_PROM9       -------------------------------LGSSIQEGVEIDIKYEGYLKRQKNNIEQI
MNMG_PROM2       -------------------------------LGYSIQEGVEIDIKYEGYLKRQKNNIEQI
MNMG_PROM5       -------------------------------LPIAVMEGVEIDIKYEGYLKRQQNNIDQI
MNMG_PROMP       -------------------------------LPISVIEGVEIDIKYEGYLKRQKNNIDQI
MNMG_CHLTR       ---------------------------------PVVGASLEMEIKYSGYISRQQTLIRSM
MNMG_CHLTA       ---------------------------------PVVGASLEMEIKYSGYISRQQTLIRSM
MNMG_CHLT2       ---------------------------------PIVGASLEMEIKYSGYISRQQTLIRSM
MNMG_CHLTB       ---------------------------------PIVGASLEMEIKYSGYISRQQTLIRSM
MNMG_CHLMU       ---------------------------------PIIGASLEMEIKYSGYISRQQTLIRSM
MNMG_CHLAB       ---------------------------------STLNASLEMEIKYAGYIDRQKALIHSL
MNMG_CHLCV       ---------------------------------STLNASLEMEIKYAGYIDRQKSLIHSL
MNMG_CHLFF       ---------------------------------SILNASLEMEIKYAGYIERQKSLIHSL
MNMG_CHLPN       ---------------------------------AVLNASLEMEIKYSGYIDRQKILIQSL
MNMG_PARUW       ---------------------------------EEINFQIELNLKYAGYIDRQTSEVAKL
MNMG_RHOBA       ---------------------------------REAAEQCSIDIKYAGYIDRQQAEVHKQ
MNMG_OPITP       ---------------------------------KPVRDEVLYRVLYSGYWEREQRHIDKL
MNMG_AQUAE       ---------------------------------PYVKEEVEIQLKYEPYIERERKLNEKL
MNMG_ECOLI       ---------------------------------EQAAEQVEIQVKYEGYIARQQDEIEKQ
MNMG_ECOL6       ---------------------------------EQAAEQVEIQVKYEGYIARQQDEIEKQ
MNMG_ECO24       ---------------------------------EQAAEQVEIQVKYEGYIARQQDEIEKQ
MNMG_ECODH       ---------------------------------EQAAEQVEIQVKYEGYIARQQDEIEKQ
MNMG_ECOL5       ---------------------------------EQAAEQVEIQVKYEGYIARQQDEIEKQ
MNMG_ECOHS       ---------------------------------EQAAEQVEIQVKYEGYIARQQDEIEKQ
MNMG_ECOLC       ---------------------------------EQAAEQVEIQVKYEGYIARQQDEIEKQ
MNMG_SHIBS       ---------------------------------EQAAEQVEIQVKYEGYIARQQDEIEKQ
MNMG_SHISS       ---------------------------------EQAAEQVEIQVKYEGYIARQQDEIEKQ
MNMG_ECOUT       ---------------------------------EQAAEQVEIQVKYEGYIARQQDEIEKQ
MNMG_ECOK1       ---------------------------------EQAAEQVEIQVKYEGYIARQQDEIEKQ
MNMG_ECOSM       ---------------------------------EQAAEQVEIQVKYEGYIARQQDEIEKQ
MNMG_ECO57       ---------------------------------EQAAEQVEIQVKYEGYIARQQDEIEKQ
MNMG_SHIDS       ---------------------------------EQAAEQVEIQVKYEGYIARQQDEIEKQ
MNMG_SHIFL       ---------------------------------EQAAEQVEIQVKYEGYIARQQDEIEKQ
MNMG_SHIF8       ---------------------------------EQAAEQVEIQVKYEGYIARQQDEIEKQ
MNMG_SALCH       ---------------------------------EQAAEQVEIQVKYEGYIARQQDEIEKQ
MNMG_SALTY       ---------------------------------EQAAEQVEIQVKYEGYIARQQDEIEKQ
MNMG_SALPB       ---------------------------------EQAAEQVEIQVKYEGYIARQQDEIEKQ
MNMG_SALPA       ---------------------------------EQAAEQVEIQVKYEGYIARQQDEIEKQ
MNMG_SALTI       ---------------------------------EQAAEQVEIQVKYEGYIARQQDEIEKQ
MNMG_CITK8       ---------------------------------AQAAEQVEIQVKYEGYIARQQDEIEKQ
MNMG_SALAR       ---------------------------------EQAAEQVEIQVKYEGYIARQQDEIEKQ
MNMG_ENT38       ---------------------------------AEAAEQVEIQIKYEGYIARQQDEIEKQ
MNMG_KLEP7       ---------------------------------RQAAEQVEIQVKYEGYIARQQDEIEKQ
MNMG_CROS8       ---------------------------------AQAAEQVEIQVKYEGYIARQQDEIEKQ
MNMG_PECAS       ---------------------------------EQAAEQVEIQVKYEGYIARQQDEIEKQ
MNMG_YERPE       ---------------------------------PQSADQVEIQVKYEGYITRQQEEIEKQ
MNMG_YERPY       ---------------------------------PQSADQVEIQVKYEGYITRQQEEIEKQ
MNMG_YERPA       ---------------------------------PQSADQVEIQVKYEGYITRQQEEIEKQ
MNMG_YERPN       ---------------------------------PQSADQVEIQVKYEGYITRQQEEIEKQ
MNMG_YERPP       ---------------------------------PQSADQVEIQVKYEGYITRQQEEIEKQ
MNMG_YERPS       ---------------------------------PQSADQVEIQVKYEGYITRQQEEIEKQ
MNMG_YERP3       ---------------------------------PQSADQVEIQVKYEGYITRQQEEIEKQ
MNMG_YERE8       ---------------------------------PQAADQVEIQVKYEGYIARQQEEIEKQ
MNMG_SERP5       ---------------------------------TQAAEQVEIQVKYEGYIARQQEEIEKQ
MNMG_PHOLL       ---------------------------------PQAADQVEIQVKYEGYIARQQEEIEKQ
MNMG_SODGM       ---------------------------------SQAAEQVEIQIKYQGYIARQQEEIARQ
MNMG_VIBCH       ---------------------------------AEAAEQVEIQVKYDGYIQRQQDEIEKS
MNMG_VIBC3       ---------------------------------AEAAEQVEIQVKYDGYIQRQQDEIEKS
MNMG_VIBCB       ---------------------------------QQASEQVEIQVKYDGYIKRQQEEIEKS
MNMG_VIBPA       ---------------------------------QQAAEQVEIQVKYDGYIKRQQEEIEKS
MNMG_VIBVU       ---------------------------------LEAAEQVEIQVKYEGYIKRQQDEIEKS
MNMG_VIBVY       ---------------------------------LEAAEQVEIQVKYEGYIKRQQDEIEKS
MNMG_ALIF1       ---------------------------------SQASEQVEIQVKYAGYIQRQRDEIEKS
MNMG_PHOPR       ---------------------------------TQASEQVEIQVKYQGYIDRQKDEVEKS
MNMG_AERHH       ---------------------------------TAAADQVEIQIKYAGYIERQHDEVEKQ
MNMG_AERS4       ---------------------------------HAAADQVEIQIKYAGYIERQYDEVEKQ
MNMG_COLP3       ---------------------------------SQASEQIEIQTKYAGYIDRQLDEIAKK
MNMG_PSEA6       ---------------------------------PKAAEQVEIQIKYAGYIERQQDEIAKS
MNMG_IDILO       ---------------------------------PLAAEQVEIQIKYAGYITRQQEEIAKQ
MNMG_PSET1       ---------------------------------QAALEQVEIHTKYAGYIVRQQDEINKQ
MNMG_SHEB5       ---------------------------------PQAAEQVQIQVKYSGYIQRQQEEINKA
MNMG_SHEB8       ---------------------------------PQAAEQVQIQVKYSGYIQRQQEEINKA
MNMG_SHEB9       ---------------------------------PQAAEQVQIQVKYSGYIQRQQEEINKA
MNMG_SHEPC       ---------------------------------PLAAEQVQIQVKYSGYIQRQQEEINKA
MNMG_SHESW       ---------------------------------PLAAEQVQIQVKYSGYIQRQQEEINKA
MNMG_SHESM       ---------------------------------PLAAEQVQIQVKYSGYIQRQQEEINKA
MNMG_SHESR       ---------------------------------PLAAEQVQIQVKYSGYIQRQQEEINKA
MNMG_SHESA       ---------------------------------PLAAEQVQIQVKYSGYIQRQQEEINKA
MNMG_SHEON       ---------------------------------PLAAEQVQIQVKYSGYIQRQQEEINKA
MNMG_SHEDO       ---------------------------------PSAAEQVQIQVKYSGYIQRQQDEIDKA
MNMG_SHEFN       ---------------------------------QQAAEQVQIQVKYSGYIQRQQDEIDKA
MNMG_SHEHH       ---------------------------------QRAAEQVQIQVKYSGYIQRQQGEIDKA
MNMG_SHEPA       ---------------------------------QRAAEQVQIQVKYSGYIQRQQGEIDKA
MNMG_SHESH       ---------------------------------QRAAEQVQIQVKYSGYIQRQQDEIDKA
MNMG_SHEWM       ---------------------------------PRAAEQVQIQVKYSGYIQRQQDEIDKA
MNMG_SHELP       ---------------------------------QRAAEQVQIQVKYSGYIQRQQDEIDKA
MNMG_SHEAM       ---------------------------------PLAAEQVQIQVKYAGYIQRQQDEIAKA
MNMG_PSYIN       ---------------------------------VQAAEQVEIIIKYQGYVDRQREEIEKL
MNMG_ACTP2       ---------------------------------KQAAEQVEISIKYQGYIEHQQNEIERH
MNMG_ACTPJ       ---------------------------------KQAAEQVEISIKYQGYIEHQQNEIERH
MNMG_HAEDU       ---------------------------------RQAAEQVEIAIKYQGYIEHQYNEIERH
MNMG_HAEIN       ---------------------------------KEAVEQVEIAIKYQGYIEHQQEEIEKQ
MNMG_HAEIG       ---------------------------------KEAVEQVEIAIKYQGYIEHQQEEIEKQ
MNMG_HAEIE       ---------------------------------KEAVEQVEIAIKYQGYIEHQQEEIEKQ
MNMG_HAEI8       ---------------------------------REAVEQVEIAIKYQGYIEHQQEEIEKQ
MNMG_HAES1       ---------------------------------KEAVEQVEIAIKYQGYIEHQQEEIERQ
MNMG_HISS2       ---------------------------------KEAVEQVEIAIKYQGYIEHQQEEIERQ
MNMG_MANSM       ---------------------------------KEAVEQVEIAVKYQGYIEHQQEEIEKQ
MNMG_PASMU       ---------------------------------QEAVEQVEIAIKYQGYIEHQQEEIARQ
MNMG_ACTSZ       ---------------------------------KQAAEQVEIAIKYQGYIEHQQEEIEKQ
MNMG_HYDCU       ---------------------------------PTVVEQIEIEAKYAGYIARQQEDIDKL
MNMG_ACIAC       --------------------------ETLGELSAPVIEQVEIAAKYAGYIDRQKDEVQRA
MNMG_ACISJ       --------------------------ETLGELSASVIEQVEIAAKYAGYIDRQRDEVQRA
MNMG_VEREI       --------------------------ETLGMLSESVVEQVEIAAKYAGYIERQKGEVERA
MNMG_POLNA       ----------------DVSRETSTDSALPADLVKSVIEQIEITAKYAGYIDLQKVEVERA
MNMG_POLSJ       ------------------------EAAASDDLAKSVIEQIEITAKYAGYIDLQKTEVERA
MNMG_RHOFT       ----------------PVSRETPAVPLPEAVFAAVVIEQVEIVAKYAGYIDRQIEEVGRA
MNMG_LEPCP       --------------------------QLGADLAAAVIEQLEIAIKYAGYIDKQNEDVQRA
MNMG_METPP       --------------------------EWGPALADAVIQQLETATKYAGYIDKQNEQVERA
MNMG_BURCA       ----------------------------DPVLLEQIKEQVEIGIKYQGYIERQASEIERN
MNMG_BURCH       ----------------------------DPVLLEQIKEQVEIGIKYQGYIERQASEIERN
MNMG_BURCC       ----------------------------DPVLLEQIKEQVEIGIKYQGYIERQASEIERN
MNMG_BURCM       ----------------------------DPVLLEQIKEQVEIGIKYQGYIERQASEIERN
MNMG_BURA4       ----------------------------DPVLLEQIKEQVEIGIKYQGYIERQASEIERN
MNMG_BURL3       ----------------------------DPVLLEQIKEQVEIGIKYQGYIERQASEIERN
MNMG_BURVG       ----------------------------EPVLLGQIKEQVEIGIKYQGYIERQANEIERN
MNMG_BURMA       ----------------------------DELLLAQIKEQIEIGIKYQGYIERQAGEIERN
MNMG_BURM9       ----------------------------DELLLAQIKEQIEIGIKYQGYIERQAGEIERN
MNMG_BURP0       ----------------------------DELLLAQIKEQIEIGIKYQGYIERQAGEIERN
MNMG_BURM7       ----------------------------DELLLAQIKEQIEIGIKYQGYIERQAGEIERN
MNMG_BURMS       ----------------------------DELLLAQIKEQIEIGIKYQGYIERQAGEIERN
MNMG_BURP1       ----------------------------DELLLAQIKEQIEIGIKYQGYIERQAGEIERN
MNMG_BURPS       ----------------------------DELLLAQIKEQIEIGIKYQGYIERQAGEIERN
MNMG_BURP6       ----------------------------DELLLAQIKEQIEIGIKYQGYIERQAGEIERN
MNMG_BURTA       ----------------------------DALLLAQIKEQIEIGIKYQGYIERQAGEIERN
MNMG_PARXL       ----------------------------DDVLLAQIKEQIEIGIKYQGYIDRQAGEIERN
MNMG_CUPNH       ----------------------------EPMLAEQIREQIEIGIKYHGYIARQAAEVDKL
MNMG_CUPPJ       ----------------------------DPLLMDQIREQIEIGVKYHGYIARQAAEVDKL
MNMG_CUPMC       ----------------------------DTMLAEQIREQIEIGIKYHGYIARQAAEVDKL
MNMG_RALSO       ----------------------------EPLLAEQIREQIEIGIKYHGYIARQADEVERL
MNMG_JANMA       ----------------------------PGVAEDAVREQVEIQLKYAGYIDRQAKEVERH
MNMG_HERAR       ----------------------------PGVAEPAVREQVEIQLKYAGYIDRQAREVERH
MNMG_BORBR       ---------------------------PGVLEDDVLAEQVETQVKYAGYIARQQDEVQKH
MNMG_BORPA       ---------------------------PGVLEDDVLAEQVETQVKYAGYIARQQDEVQKH
MNMG_BORPE       ---------------------------PGVLEDQVLAEQVETQVKYAGYIARQQDEVQKH
MNMG_BORPD       ---------------------------PGVTDDDILAEQVEIQVKYAGYIARQQDEVQKH
MNMG_BORA1       ---------------------------PGLLGDDVLAEQVEIQIKYAGYIERQRDEVQKH
MNMG_AZOSB       -----------------------------PETDPQVVEQLEIAAKYQGYIDRQQDEVAKQ
MNMG_AROAE       -----------------------------PATDPQVIEQIEIAAKYQGYIDRQQGEVAKQ
MNMG_DECAR       -----------------------------AQTDPLVVEQLEISAKYQGYIDRQAEEVAKS
MNMG_METFK       -----------------------------GEADPQVRQQLEIVAKYQGYIDRQAEEIERL
MNMG_THIDA       -----------------------------GVADVGVAEQVEIAAKYQGYIDRQNEEVDKH
MNMG_NITMU       -----------------------------PVVDLAAAEQVEIQAKYQGYIERQKDEVARN
MNMG_NEIG1       ----------------------------SENLSAEVIEQVEIQVKYQGYIDRQNEEIDSR
MNMG_NEIMA       ----------------------------SENLSAEVIEQVEIQVKYQGYIDRQNEEIDSR
MNMG_NEIMB       ----------------------------SENLSAEVIEQVEIQVKYQGYIDRQNEEIDSR
MNMG_NEIM0       ----------------------------SENLSAEVIEQVEIQVKYQGYIDRQNEEIDSR
MNMG_NEIMF       ----------------------------SERLSAEVVEQVEIQVKYQGYIDRQNEEIDSR
MNMG_CHRVO       ----------------------------APELADEVAEQVEIQVKYQGYINRQNEELARR
MNMG_POLAQ       ----------------------------DLGLAAQISDQVEISVKYQGYIERQAVEIARQ
MNMG_ACIBT       -------------------------------VSQQVGEQIEIAVKYEGYINRQHEDVAQL
MNMG_ACIBY       -------------------------------VSQQVGEQIEIAVKYEGYINRQHEDVAQL
MNMG_ACIAD       -------------------------------VSTQVGDQIEIAVKYEGYINRQHEDVAQL
MNMG_PSYA2       -------------------------------VDSQVGEQIEISVKYAGYIDRQQEDIDQM
MNMG_PSYCK       -------------------------------VDAQVGEQIEISVKYAGYIDRQQEDIDQM
MNMG_PSYWF       -------------------------------VAADVGEQIEISVKYAGYIDRQQEDIDQM
MNMG_PSEAE       -----------------------------VDNPQ-VAEQVEIRTKYAGYIDRQQEEISRL
MNMG_PSEAB       -----------------------------VDNPQ-VAEQVEIRTKYAGYIDRQQEEIARL
MNMG_PSEA7       -----------------------------VDNPQ-VAEQVEIRTKYAGYIDRQQEEIARL
MNMG_PSEPU       -----------------------------AIDPQ-VAEQVEIRTKYAGYIDRQQDEIARL
MNMG_PSEPK       -----------------------------AIDPQ-VAEQVEIRTKYAGYIDRQQDEIARL
MNMG_PSEP1       -----------------------------AIDPQ-VAEQVEIRTKYAGYIDRQQDEIARL
MNMG_PSEPG       -----------------------------AIDPQ-VAEQVEIRTKYAGYIDRQQDEIARL
MNMG_PSEPW       -----------------------------QIDPQ-VAEQVEIKTKYAGYIDRQQDEIARL
MNMG_PSEE4       -----------------------------VIDPQ-VAEQVEIKTKYAGYIDRQQEEIARL
MNMG_PSEF5       -----------------------------AEDPQ-VAEQVEIKTKYAGYIDRQQDEIARL
MNMG_PSEPF       -----------------------------AEDPQ-VAEQVEIKTKYAGYIDRQQDEIARL
MNMG_PSE14       -----------------------------CTDPQ-VAEQVEIKTKYSGYIDRQQDEIARL
MNMG_PSEU2       -----------------------------CTDPQ-VAEQVEIKTKYAGYIDRQQDEIARL
MNMG_PSESM       -----------------------------CADPL-VAEQVEIKTKYAGYIDRQQEEIARL
MNMG_PSEMY       -----------------------------AVDNQ-VAEQVEIKTKYAGYIDRQQDEIARL
MNMG_PSEU5       -----------------------------EPDPQ-VAEQVEIKTKYAGYIERQQDEIEKL
MNMG_ALCBS       -----------------------------RPDSA-VIEQMEILAKYAGYIDRQADEIEKL
MNMG_HAHCH       -----------------------------ATPYE-VAEQLEIQVKYAGYIDRQQEEIERL
MNMG_MARMS       -----------------------------EPVDEQVSEQVQIAVKYAGYISRQAEDIERL
MNMG_SACD2       -----------------------------S--DPQVAEQVEINTKYAGYINRQTDDIERM
MNMG_CHRSD       -------------------------------DPA-VAEQVQIQAKYQGYIARQQDEIDRL
MNMG_MARHV       -----------------------------AEDPN-VADQVEIEIKYEGYISRQADEIERL
MNMG_ALKEH       --------------------------------DAEVVEQLEIQARYAGYLERQHDEVARA
MNMG_NITOC       --------------------------------EPAVAEQIAIQAKYAGYIERQQLEIARQ
MNMG_METCA       --------------------------------DRAVREQVEIAAKYTGYIERQQAEIERV
MNMG_XANAC       --------------------------------DAQVAEQVEISVKYAGYLDRQRDDIARQ
MNMG_XANC5       --------------------------------DAQVAEQVEISVKYAGYLDRQRDDIARQ
MNMG_XANOR       --------------------------------DAQVAEQVEISVKYTGYLDRQRDDIARQ
MNMG_XANOM       --------------------------------DAQVAEQVEISVKYTGYLDRQRDDIARQ
MNMG_XANCP       --------------------------------DAQVAEQVEIGVKYAGYLNRQRDEIARQ
MNMG_XANC8       --------------------------------DAQVAEQVEIGVKYAGYLNRQRDEIARQ
MNMG_XANCB       --------------------------------DAQVAEQVEIGVKYAGYLDRQRDEIARQ
MNMG_XYLFA       --------------------------------DAQVAEQVEISVKYAGYLNRQSEEITRQ
MNMG_XYLFT       --------------------------------DAQVAEQVEISVKYAGYLNRQSEEITRQ
MNMG_COXBU       ---------------------------------PSVAEQIDIQAKYEGYLTHQLAEIARQ
MNMG_COXBN       ---------------------------------PSVAEQIDIQAKYEGYLTHQLAEIARQ
MNMG_COXBR       ---------------------------------PSVAEQIDIQAKYEGYLTHQLAEIARQ
MNMG_LEGPC       ---------------------------------QEITEQIEIQNKYAGYIDRQQQEIEKL
MNMG_LEGPA       ---------------------------------QEITEQIEIQNKYAGYIDRQQQEIEKL
MNMG_LEGPL       ---------------------------------QEITEQIEIQNKYAGYIDRQQQEIEKL
MNMG_LEGPH       ---------------------------------QEITEQIEIQNKYAGYIDRQQQEIEKL
MNMG_NITEU       ---------------------------------SQVAQQVEIDVKYEGYIERQRQEVVRH
MNMG_NITEC       ---------------------------------GRIAQQLEIDVKYEGYVERQRQEVVRH
MNMG_FRATF       ---------------------------------DAVIEQIEISAKYSGYIERQNKDIEKT
MNMG_FRATH       ---------------------------------DAVIEQIEISAKYSGYIERQNKDIEKT
MNMG_FRATO       ---------------------------------DAVIEQIEISAKYSGYIERQNKDIEKT
MNMG_FRATW       ---------------------------------DAVIEQIEISAKYSGYIERQNKDIEKT
MNMG_FRATT       ---------------------------------DAVIEQIEISAKYSGYIERQNKDIEKT
MNMG_FRAT1       ---------------------------------DAVIEQIEISAKYSGYIERQNKDIEKT
MNMG_FRATN       ---------------------------------EAVIEQIEISAKYSGYIERQNKDIEKT
MNMG_FRAP2       ---------------------------------ESVIEQIEISAKYSGYIERQSKDIAKI
MNMG_VESOH       ---------------------------------ITLMRVIENQIKYAGYIKRQLVEIEKY
MNMG_RUTMC       ---------------------------------ATLINSIENQIKYAGYIKRQLEEIEKY
MNMG_DICNV       --------------------------------SDEVIEQIDIAAKYSGYIQRQYEEVAKL
MNMG_BLOFL       ---------------------------------YQVFEQVEIQIKYSGYLLRQQEEIKKY
MNMG_BLOPB       ---------------------------------RQVFEQIEIQIKYEGYIRHQQEEIKRH
MNMG_BAUCH       ---------------------------------IQAAEQIEIQIKYEGYIAQQQEQILRQ
MNMG_BUCAI       ---------------------------------LEAIGQIENEIKYAGYIKRQSEEIERH
MNMG_BUCAP       ---------------------------------LEAAGQIENEIKYEGYIKRQLEEINRH
MNMG_BUCBP       ---------------------------------KEAYEQIEIQEKYCGYIKRQIKAIKNQ
MNMG_WIGBR       ---------------------------------EEIIKQIEIQIKYAGYIKRQEKEINKK
MNMG_BUCCC       ---------------------------------KEITEEIETQSKYFGYIQRQEKEIKKY
MNMG_HALHL       ---------------------------------VRAVQQLEIEARYDGYVERQELENQRH
MNMG_RHIME       ----------------------------------GVVEALEIDAAYAVYMERQATDIAGV
MNMG_SINMW       ----------------------------------DVAAALEIDAAYAVYMERQAADIIGV
MNMG_RHIEC       ----------------------------------KVAEALEIEAGYSVYLDRQAAAIADQ
MNMG_RHIL3       ----------------------------------KVAEALEIEAGYSVYLDRQASAIADQ
MNMG_AGRFC       ----------------------------------KVAEVLQIEASYAVYMQRQSADIVDI
MNMG_BARHE       ----------------------------------KTVESVEIEAQYAVYLEKQAQDILAL
MNMG_BARQU       ----------------------------------KTVESLEIEAQYAVYLEKQAQDISAL
MNMG_BART1       ----------------------------------KTVESLEIEAQYAVYLDKQAQDIASL
MNMG_BARBK       ----------------------------------KTVESLEIEAQYAVYLERQKQDIAAL
MNMG_BRUAB       ----------------------------------VTREALEIEAQYAVYMERQQSDIAVM
MNMG_BRUA2       ----------------------------------VTREALEIEAQYAVYMERQQSDIAVM
MNMG_BRUC2       ----------------------------------VTREALEIEAQYAVYMERQQSDIAVM
MNMG_BRUSU       ----------------------------------VTREALEIEAQYAVYMERQQSDIAVM
MNMG_BRUSI       ----------------------------------VTREALEIEAQYAVYMERQQSDIAVM
MNMG_BRUME       ----------------------------------VTREALEIEAQYAVYMERQQSDIAVM
MNMG_BRUO2       ----------------------------------VTREALEIEAQYAVYMERQQSDIAVM
MNMG_BRUA4       ----------------------------------ATREALEIEAQYAVYMDRQKSDIAVM
MNMG_RHILO       ----------------------------------KTAERLETEAKYSVYLDRQKSDVAQI
MNMG_CHESB       ----------------------------------KTCERLETEARYAVYLDRQVADAERV
MNMG_BRASB       ----------------------------------AIAVHLEIDAKYDVYVRRQSEDVDAF
MNMG_BRASO       ----------------------------------VVATHLEIDAKYDVYVRRQSEDVDAF
MNMG_BRADU       ----------------------------------VIATHLEIDAKYDVYLERQSADVEAF
MNMG_NITHX       ----------------------------------GVAVHLEIDAKYDVYLKRQTADVEAF
MNMG_NITWN       ----------------------------------AIAEHLEIDAKYDVYLKRQAADVEAF
MNMG_RHOPS       ----------------------------------AIAVHVEIDAKYHVYLARQTADVEAF
MNMG_RHOP2       ----------------------------------SIAGHVEIDAKYAVYLERQVADVAAF
MNMG_RHOPA       ----------------------------------AIAVHVEIDAKYHVYLERQTADVEAF
MNMG_RHOP5       ----------------------------------AIAVHLEIDAKYDVYLQRQTADVEAF
MNMG_RHOPB       ----------------------------------SIATHLEIDATYDVYLKRQTADVEGF
MNMG_AZOC5       ----------------------------------AIGAQLEIDAKYAVYLDRQAADIATL
MNMG_METPB       ----------------------------------RIAERLQTDATYAVYLDRQQADITAF
MNMG_METRJ       ----------------------------------RIADRMKTDATYAVYLDRQNADIAAF
MNMG_METS4       ----------------------------------RVAERLRTDAAYAVYLDRQRSDIAAF
MNMG_BEII9       ----------------------------------TIAAQIEIDAHYAVYLDRQEADIAAF
MNMG_PARL1       ----------------------------------HIAEQMGIEAQYAGYLDRQDADIKAF
MNMG_RHORT       ----------------------------------DVAEQLEIGARYAGYLERMHGDVAAF
MNMG_MAGSA       ----------------------------------AVAEQLEIEGRYAGYLDRQEADIRAY
MNMG_CAUVC       ----------------------------------DVREQIEIEAAYAGYLDRQRADAESL
MNMG_CAUSK       ----------------------------------MAREQIAIEAAYAGYLDRQRDDVEAF
MNMG_MARMM       ----------------------------------SVSEQIEIDALYAGYIDRQQADILAF
MNMG_HYPNA       ----------------------------------EIVAQIEIEALYSAYLDRQAEDVAAL
MNMG_GLUOX       ----------------------------------RVRRHVETEARYDGYLHRQDREIRQL
MNMG_GLUDA       ----------------------------------RVSRHVETEARYSGYLVRQAREIRQL
MNMG_GRABC       ----------------------------------RVREQLEIEGAYSGYLSRQDKERRVL
MNMG_ACICJ       ----------------------------------QAAAIVAADRLYEGYLTRQESEIRAR
MNMG_RUEPO       ----------------------------------ETRAQVERDALYANYIARQERDVEAM
MNMG_RUEST       ----------------------------------SIREQVTRDSLYANYIARQEKEVASL
MNMG_ROSDO       ----------------------------------ETQQQMEREALYATYIERQQKDVDLL
MNMG_DINSH       ----------------------------------EIAKQAKIEATYANYIERQQRDVMAL
MNMG_RHOS1       ----------------------------------EIRQQLAKDGLYAQFILRQEEEAAAL
MNMG_CERS4       ----------------------------------EIRQQLAKDGLYAQFILRQEEEAAAL
MNMG_CERS5       ----------------------------------DIRQQLARDALYAQFIARQELEAQSL
MNMG_PARDP       ----------------------------------AIIRQLATDALYHQYTDRQGKDAELL
MNMG_JANSC       ----------------------------------ATAKQLKIEAIYAVYIERQNQDAFAL
MNMG_NOVAD       ----------------------------------LLVEEVEEDAAYAPYLARQDAELRDL
MNMG_ERYLH       ----------------------------------ELAAELAEDAAYAPYLARQDAELREL
MNMG_SPHAL       ----------------------------------AILSEVVEDAHYAPYIARHEAELRAL
MNMG_SPHWW       ----------------------------------DVRAEVIQDGRYAPYLARQDQEIARL
MNMG_ZYMMO       ----------------------------------AVVSEIIDDGRYAPYLERQDAELARL
MNMG_ANAMM       ----------------------------------AALAAVGIEGKYAPYLQRQAADIQSF
MNMG_ANAPZ       ----------------------------------GTLALMEIEGKYAPYLKRQEADIKSF
MNMG_EHRCJ       ----------------------------------AVVSQVEIEGKYAPYFIRQDADIQDF
MNMG_EHRCR       ----------------------------------NVAEQVAIEAKYAPYFDRQDADIKAF
MNMG_EHRRG       ----------------------------------NTIQQVEIEAKYAPYFIKQELDIQSF
MNMG_EHRRW       ----------------------------------STIQQVEIEAKYAPYFIKQELDIQSF
MNMG_WOLPM       ----------------------MGHTKADNRAKNEICEAVEIEAKYKPYLIRQEADMKFL
MNMG_WOLTR       TRIQKKNADSSVTRWNDKTGYWNDSKTTSNTIKNEICEAVAIEAKYKPYLVRQEADMKFL
MNMG_NEOSM       ----------------------------------KYREMLTINARYEPYLLRQEQDVKLL
MNMG_RICRO       ----------------------------------NILQLLYIEAKYASYLTRQQADINLF
MNMG_RICRS       ----------------------------------NILQLLYIEAKYASYLTRQQADINLF
MNMG_RICCN       ----------------------------------NILQLLYIEAKYASYLTRQHADINLF
MNMG_RICM5       ----------------------------------NILQLLYIEAKYASYLTRQHADINLF
MNMG_RICFE       ----------------------------------NILQLLYIEAKYASYLTRQHADINLF
MNMG_RICAH       ----------------------------------NILQLLYIEAKYASYLTRQQADINLF
MNMG_RICCK       ----------------------------------NILQLLYIEAKYASYLAKQQADINLF
MNMG_RICB8       ----------------------------------NILQLLYIEAKYASYLVRQYADINLF
MNMG_RICBR       ----------------------------------NILQLLYIEAKYASYLVRQYADINLF
MNMG_RICPR       ----------------------------------NILQLLYIEAKYASYLTRQYADINLF
MNMG_RICTY       ----------------------------------NILQLLYIEAKYASYLTRQYADINLF
MNMG_ORITB       ----------------------------------NLLLLLTYESKYHVYLERQKEDIELF
MNMG_PELUB       -----------------------------------IDEQIEINAHYRGYLKKQKADILAF
MNMG_KORVE       ----------------------------FVSDIRNELKAVETEIKYAGYLDQQTKAIDRL
MNMG_SOLUE       -----------------------------------LLETVSTEAKYGGYIQQQERQMARM
MNMG_MAGMM       -----------------------------------VLEIYKNDLIYSGYEKKIIAENSRV
MNMG_CAMJE       ----------------------------------YSLREILNEAKYYHYISMQKAQVEKM
MNMG_CAMJJ       ----------------------------------YSLREILNEAKYYHYISMQKAQVEKM
MNMG_CAMJR       ----------------------------------YSLREILNEAKYYHYISMQKAQVEKM
MNMG_CAMJ8       ----------------------------------YSLREILNEAKYYHYISMQKAQVEKM
MNMG_CAMJD       ----------------------------------YSLREILNEAKYCHYISMQKAQVEKM
MNMG_CAMC1       ----------------------------------ASMDQILTECKYQHYISEQKNQIEKM
MNMG_CAMC5       ----------------------------------ASLEQILTECKYSHYIAEQKNQIDKM
MNMG_CAMFF       ----------------------------------KSLNQILTEAKYYHYIAQQQIEVEKM
MNMG_CAMHC       ----------------------------------DELSEILTECKYYFYIQMQKDEVAKM
MNMG_NITSB       ----------------------------------EAKEQILIEAKYHQYIQMQKEQIEKM
MNMG_SULDN       ----------------------------------YILDEILVEGKYARYVQKQSEEIQKM
MNMG_ARCB4       ----------------------------------YLKEQIIIEAKYYRYIQKQQKQIEKM
MNMG_SULNB       ----------------------------------EVMGQILVEAKYSRYIEKQQMQIDQM
MNMG_HELPY       ----------------------------------RVLEQIKIECKYNIYIEKQHENIAKM
MNMG_HELPH       ----------------------------------RVLEQIKIECKYNIYIEKQHENIAKM
MNMG_HELPJ       ----------------------------------RVLEQIKIECKYNIYIEKQHENIAKM
MNMG_HELAH       ----------------------------------RVLEQIKIECKYNIYIEKQHENIAKM
MNMG_HELHP       ----------------------------------LAIEQIFIESKYFDYIQKQKQQIGQM
MNMG_WOLSU       ----------------------------------RALGQVLIEAKYASYIQKQQESVGSM
MNMG_LEPIN       ----------------------------------LEKSILEMEIKYEGYIKRELETIQWK
MNMG_LEPIC       ----------------------------------LEKSILEMEIKYEGYIKRELETIQWK
MNMG_LEPBJ       ----------------------------------SEKNILEMEIKYEGYIKRELETIQWK
MNMG_LEPBL       ----------------------------------SEKNILEMEIKYEGYIKRELETIQWK
MNMG_LEPBA       ----------------------------------DEKAVLEMEVKYEGYLKRELETIEYR
MNMG_LEPBP       ----------------------------------DEKAVLEMEVKYEGYLKRELETIEYR
MNMG_GEOMG       -------------------------------VPPVVREQVEIQIKYQGYIERQLDQVERA
MNMG_GEOSL       -------------------------------VPPSVKEQVEIQIKYQGYIERQLDQVARA
MNMG_GEOUR       -------------------------------IPAAVREQVEIQIKYQGYIDRQLEQVERA
MNMG_PELPD       -------------------------------TPSVVREQVEIQIKYQGYIERQLEQIRRS
MNMG_PELCD       -------------------------------IPENVREQLQIEIKYEGYIARQYEMVERF
MNMG_DESPS       -------------------------------ANSAVCQEVQVRIKFKGYLQRQEEQVQRF
MNMG_DESVH       -------------------------------FADDVREEAETIVKYSGYLARQQELVARS
MNMG_DESVV       -------------------------------FADDVREEAETIVKYSGYLARQQELVARS
MNMG_DESAG       -------------------------------FAADVLEEAQTIVKYSGYLKRQEELVLRT
MNMG_LAWIP       -------------------------------TSEDVYLETETIIKYAGYLDRQEELVQRS
MNMG_SYNFM       -------------------------------LSSKVTEQVEVECKYEGYLKRQEAEVAKF
MNMG_SYNAS       -------------------------------YDRMIRKQIEIEAKYEGYIQRQREAVVRM
MNMG_CHLTE       ---------------------------------PRVAEQVQIEIKYEGYIKREQLVADRI
MNMG_CHLCH       ---------------------------------PLVYEQVEIDCKYEGYLKRDALVAEKI
MNMG_CHLPM       ---------------------------------PLVHEQVEINLAYEGYLKRELLQTEKV
MNMG_CHLL3       ---------------------------------KEAHQQVEIDLKYEGYLKRELLTADKI
MNMG_CHLPD       ---------------------------------PDVFEQVVIDLKYEGYLKRDLLMTEKI
MNMG_BACFR       -------------------------------RKEEILEAAEILIKYEGYIGRERIIADKL
MNMG_BACFN       -------------------------------RKEEILEAAEILIKYEGYIGRERIIADKL
MNMG_BACTN       -------------------------------RKEEILEAAEILIKYQGYIDRERMIAEKL
MNMG_PHOV8       --------------------------------KEEVIEAAEVLIKYQGYIDRERMIADKI
MNMG_PARD8       -------------------------------RKEEIIEAAEILIKYSGYIKREQIIADKI
MNMG_PORGI       -------------------------------RREEIVEAAEILIKYDGYIKRERALADKI
MNMG_FLAJ1       -------------------------------LDEEIVEQAVIQVKYSGYIEKERNNADKL
MNMG_FLAPJ       -------------------------------VDQEILEQAEIQVKYSGYIDKERANAEKL
MNMG_GRAFK       -------------------------------LNEEMIEQTEIQVKYSGYIEKEKNNADKL
MNMG_CYTH3       -------------------------------YTQEEIEQAMIEVKYRDYIDKEEQMALKM
MNMG_SULMW       -------------------------------IDKKILEQISLYIKYKGYLLKEEENVKKM
MNMG_SALRD       ---------------------------------LSAPRLIEIDLKYEGYIDRQKDMVEEM
MNMG_BORAP       --------------------------------SKVILEQVELDIKYEGYINRQKDLIKKL
MNMG_BORBP       --------------------------------SKVILEQVELDVKYEGYINRQKDLIKKL
MNMG_BORBU       --------------------------------SKVILEQVELDVKYEGYINRQKDLIKRL
MNMG_TREDE       --------------------------------SAELLESAELEIRYEHYIAVQNRKIAKV
MNMG_TREPA       --------------------------------PLEVFQSVGVEIRYEHYIAAQDQRIAQV
MNMG1_FUSNN      ----------------------------------FVKNQIETMIKYEIFIERENKQIEKF
MNMG2_FUSNN      ----------------------------------DTTYQVEITVKYEGYINRALKMIEKH
MNMG_ENDTX       ----------------------------------KAKEEVYIHKKYEGYIEIQNKMINKM
MNMG_ONYPE       --------------------------------DKTIYEQVEIQIKYEGYIAKAQKEAQKL
MNMG_AYWBP       --------------------------------DKTIYEQVEIQIKYEGYIAKAQKEAQKL
MNMG_ACHLI       --------------------------------NHEIYEQLEIYIKYDGYIEKARREADKL
MNMG_MYCCT       -------------------------------LKTNQLQSIVIEIRFEGYVKKERQLVDKL
MNMG_MYCMS       -------------------------------LKTNQLQSIVIEIRFEGYVKKERQLVDKL
MNMG_MESFL       -------------------------------LKNNQLQSIVIETRFAGYVKTERKTVERL
MNMG_MYCGE       -------------------------------LDSETLKQIEIEIKYEGYIKKNEKYFKGL
MNMG_MYCPN       -------------------------------LDVQSLNQIDIDIKYAGYIKKSEKYFKSL
MNMG_MYCGA       -------------------------------YDLELLKNIEITVKYEGYIKKESRIVNSL
MNMG_UREPA       -------------------------------EDEQIINKVQIQVKFEGYIKNQEENLKQL
MNMG_UREP2       -------------------------------EDEQIINKVQIQVKFEGYIKNQEENLKQL
MNMG_MYCPE       -------------------------------LDEYWKDKVDIYIKYGGYIKSQQKIINDT
MNMG_MYCH7       --------------------------------------ELTVMARLKGYIQKQNSEAQKM
MNMG_MYCHJ       --------------------------------------ELTVMARLKGYIQKQNSEAQKM
MNMG_MYCH2       --------------------------------------ELTVMARLKGYIQKQNSEAQKM
MNMG_MYCPU       --------------------------------------EMTIQIRLEGYIKKQNNAAAKM
MNMG_MYCS5       --------------------------------------ELLIKIKLEGYIKKQKQDASRM
MNMG_MYCMO       --------------------------------------ELSTNVRLDGYIKKQLSQADKM
MNMG_MYCAP       --------------------------------------EITTMVRLHGYIEKQKSDANKA
MNMG_THEM4       --------------------------------DKELLEQIEIYIKYEGYIEKMLEEVKIF
MNMG_FERNB       --------------------------------DTDVIEQIEIQLKYEGYINSMLEQVQIF
MNMG_THEMA       --------------------------------DPEVVEQVEINVKYEGYIQKMFEEVAVF
MNMG_THESQ       --------------------------------DPEVVEQVEINVKYEGYIQKMFEEVAVF
MNMG_THEP1       --------------------------------DPEVVEQVEINVKYEGYIQKMFEEVAVF
MNMG_PETMO       --------------------------------EKEVIEQIDIHFKYNGYFQRMQDEIAKM
MNMG_BDEBA       -------------------------------PDPNVVEPVEIEVKYSGYVKRQMDLIVQS
MNMG_ALKMQ       -------------------------------IVRDAQEQCEIIIKYEGYIEKQLRQIDQF
MNMG_ALKOO       -------------------------------LMKDAQFQCEVMIKYEGYIEKQLRQIDQF
MNMG_CLOD6       -------------------------------VSREVKEQCVIITKYEGYIEKQLKQIDQF
MNMG_FINM2       -------------------------------LPRYLRLQVETHIKYEGYIAKQMSQIKQF
MNMG_CALS8       -------------------------------LPRSVKEEVEIEIKYEGYIKKQLQQIEQF
MNMG_ACET2       -------------------------------LSFAVREQVSISIKYEGYIKRQMQQVEQF
MNMG1_CALS4      -------------------------------ILDSVAEQIDINIKYEGYILKQLRQVEQF
MNMG2_CALS4      -------------------------------ILDSVAEQIDINIKYEGYILKQLRQVEQF
MNMG_THEP3       -------------------------------ILDSVAEQIDINIKYEGYIMKQLRQVEHF
MNMG_THEPX       -------------------------------ILDSVAEQIDINIKYEGYIMKQLRQVEHF
MNMG_CLOB1       -------------------------------LSDDEKEEINIIAKYEGYINKQLEQVEQF
MNMG_CLOBH       -------------------------------LSDDEKEEINIIAKYEGYINKQLEQVEQF
MNMG_CLOBL       -------------------------------LSDDEKEEINIIAKYEGYINKQLEQVEQF
MNMG_CLOBK       -------------------------------LSDDEKEEINIIAKYEGYINKQLEQVEQF
MNMG_CLOBM       -------------------------------LSDDEKEEINIIAKYEGYINKQLEQVEQF
MNMG_CLONN       -------------------------------LPRDVQEQVNIISKYEGYIQKQLEQVEQF
MNMG_CLOAB       -------------------------------LAQDIIDEVNIMIKYEGYIEKQLEQVDQF
MNMG_CLOTE       -------------------------------LPEDVQEEVNTTAKYEGYIEKQLEQVNQF
MNMG_CLOK5       -------------------------------LNEDVQEEVNIISKYEGYIKKQLEQVQQF
MNMG_CLOP1       -------------------------------LPKDIGDQINIIARYEGYIQTQLEQVAQF
MNMG_CLOPS       -------------------------------LPKDIGDQINIIARYEGYIQTQLEQVAQF
MNMG_CLOPE       -------------------------------LPKDIGDQINIIARYEGYIQTQLEQVAQF
MNMG_CLOB8       -------------------------------LPHDVGEQINILTKYEGYIQSQLEQVAQF
MNMG_LACP7       -------------------------------LPEEVITQVEINFKYDGYIKRQEHQVEQF
MNMG_NATTJ       -------------------------------LPLEVTEQIEIQIKYEGYIDKQVEQVQRF
MNMG_BACVZ       -------------------------------VPQDVAEQVEIQVKYEGYIEKSLQQVEKL
MNMG_BACSU       -------------------------------VPQDVAEQVEIQVKYEGYIEKSLQQVEKL
MNMG_BACLD       -------------------------------VAGDVAEQVEIQIKYEGYIEKSLQQVEKL
MNMG_BACP2       -------------------------------LPSDVCEQVEIQIKYEGYIEKSLQQVEKL
MNMG_BACAH       -------------------------------LSDEVKEQVEIQIKYEGYIEKSLQQVERM
MNMG_BACHK       -------------------------------LSDEVKEQVEIQIKYEGYIEKSLQQVERM
MNMG_BACAN       -------------------------------LSDEVKEQVEIQIKYEGYIEKSLQQVERM
MNMG_BACCZ       -------------------------------LSDEVKEQVEIQIKYEGYIEKSLQQVERM
MNMG_BACC1       -------------------------------LSDEVTEQVEIQIKYEGYIEKSLQQVERM
MNMG_BACCR       -------------------------------LSDEVKEQVEIQIKYEGYIEKSLQQVERM
MNMG_BACMK       -------------------------------LSDEITEQVEIQTKYEGYIEKSLQQVERM
MNMG_BACCN       -------------------------------INDEVAEQVEIQIKYEGYIEKSLQQVERM
MNMG_GEOKA       -------------------------------IAPEVAEQVEIQIKYEGYIQKSLQEVERL
MNMG_GEOTN       -------------------------------IAPEVAEQVEIQIKYEGYIQKSLQEVERL
MNMG_LYSSC       -------------------------------FTEEVKEQIEIQLKYEGYIEKALLQVEKL
MNMG_STAA2       -------------------------------LNADVEEQVEIQTKYEGYINKSLQQVEKV
MNMG_STAA9       -------------------------------LNADVEEQVEIQTKYEGYINKSLQQVEKV
MNMG_STAAR       -------------------------------LNADVEEQVEIQTKYEGYINKSLQQVEKV
MNMG_STAAS       -------------------------------LNADVEEQVEIQTKYEGYINKSLQQVEKV
MNMG_STAA1       -------------------------------LNADVEEQVEIQTKYEGYINKSLQQVEKV
MNMG_STAAM       -------------------------------LNADVEEQVEIQTKYEGYINKSLQQVEKV
MNMG_STAAW       -------------------------------LNADVEEQVEIQTKYEGYINKSLQQVEKV
MNMG_STAAN       -------------------------------LNADVEEQVEIQTKYEGYINKSLQQVEKV
MNMG_STAAB       -------------------------------LNADVEEQVEIQTKYEGYINKSLQQVEKV
MNMG_STAA8       -------------------------------LNADVEEQVEIQTKYEGYINKSLQQVEKV
MNMG_STAA3       -------------------------------LNADVEEQVEIQTKYEGYINKSLQQVEKV
MNMG_STAAC       -------------------------------LNADVEEQVEIQTKYEGYINKSLQQVEKV
MNMG_STAAE       -------------------------------LNADVEEQVEIQTKYEGYINKSLQQVEKV
MNMG_STAAT       -------------------------------LNADVEEQVEIQTKYEGYINKSLQQVEKV
MNMG_STAES       -------------------------------LPEAVEEQVEIQTKYEGYINKSLQQVEKV
MNMG_STAEQ       -------------------------------LPEAVEEQVEIQTKYEGYINKSLQQVEKV
MNMG_STAHJ       -------------------------------LPEAVEEQVEIQTKYEGYINKSLQQVEKV
MNMG_STAS1       -------------------------------LPSDVEEQVEIQTKYEGYINKSLQQVEKV
MNMG_LISMO       -------------------------------VTDEIAEQVEIQIKYEGYIQKSNLQVEKM
MNMG_LISMF       -------------------------------VTDEIAEQVEIQIKYEGYIQKSNLQVEKM
MNMG_LISIN       -------------------------------VTDEIAEQVEIQIKYEGYIQKSNLQVEKM
MNMG_LISW6       -------------------------------ITDEIAEQVEIQVKYEGYIQKSNLQVEKM
MNMG_OCEIH       -------------------------------LSEEVKEQVAIQIKYEGYIKKAKEQVDRM
MNMG_BACSK       -------------------------------LDDEVYEQVEIQVKYEGYIEKQWQQIERL
MNMG_ALKHC       -------------------------------LSADVAEQVEIQIKYEGYISKMLQQVERA
MNMG_EXIS2       -------------------------------LSEEAAEQVEIQVKYAGYIDKQLDQVERM
MNMG_LEVBA       -------------------------------LDRHIIEEIEISLKYAGYIKKAEENVAKL
MNMG_LACPL       -------------------------------LERHVIEQVEIQIKYAGYIQKAEERVDRL
MNMG_PEDPA       -------------------------------LDRRVIEQVEIETKYAGYIKKAQDRVDRL
MNMG_LACS1       -------------------------------LDRRVIEQIEIQFKYEGYIKKEYAKVEKL
MNMG_ENTFA       -------------------------------LDPKVIEQVEIQIKYEGYIKKAMEKVEKL
MNMG_LACSS       -------------------------------IDNRVVEQVEIQVKYAGYIDKEKAKIAKL
MNMG_LACP3       -------------------------------LDHRVIEQVEIQIKYAGYIAKEEASVAKL
MNMG_LACAC       -------------------------------GDRYVKEQVEIGIKYAGYIKKEETRIARL
MNMG_LACH4       -------------------------------GDRYVKEQVEIGIKYAGYIKKEETRIARL
MNMG_LACJO       -------------------------------TDRYVKEQVEIALKYEGYIKKEKTLVDRL
MNMG_LACGA       -------------------------------TDRYVKEQVEIALKYEGYIKKEKTLVDRL
MNMG_LACDA       -------------------------------GDRYVKEQVEIDIKYAGYIKKQEIQVARL
MNMG_LACDB       -------------------------------GDRYVKEQVEIDIKYAGYIKKQEIQVARL
MNMG_LACLM       -------------------------------IDRTVIELIETEITYEGYIKKAMDQVDKM
MNMG_LACLS       -------------------------------IDRTVIELIETEITYEGYIKKAMDQVDKM
MNMG_LACLA       -------------------------------IDRTVIELIETEITYEGYIKKAMDQVDKM
MNMG_STRA3       -------------------------------LDSKVIELLETEIKYEGYIKKALDQVAKM
MNMG_STRA5       -------------------------------LDSKVIELLETEIKYEGYIKKALDQVAKM
MNMG_STRA1       -------------------------------LDSKVIELLETEIKYEGYIKKALDQVAKM
MNMG_STRP1       -------------------------------LDAKIIELLETEIKYEGYIRKALDQVAKM
MNMG_STRPD       -------------------------------LDAKIIELLETEIKYEGYIRKALDQVAKM
MNMG_STRPB       -------------------------------LDAKIIELLETEIKYEGYIRKALDQVAKM
MNMG_STRPC       -------------------------------LDAKIIELLETEIKYEGYIRKALDQVAKM
MNMG_STRPG       -------------------------------LDAKIIELLETEIKYEGYIRKALDQVAKM
MNMG_STRP8       -------------------------------LDAKIIELLETEIKYEGYIRKALDQVAKM
MNMG_STRPF       -------------------------------LDAKIIELLETEIKYEGYIRKALDQVAKM
MNMG_STRPM       -------------------------------LDAKIIELLETEIKYEGYIRKALDQVAKM
MNMG_STRP3       -------------------------------LDAKIIELLETEIKYEGYIRKALDQVAKM
MNMG_STRP6       -------------------------------LDAKIIELLETEIKYEGYIRKALDQVAKM
MNMG_STRT2       -------------------------------LDAKVIELLETEIKYEGYINKALDQVAKM
MNMG_STRT1       -------------------------------LDAKVIELLETEIKYEGYINKALDQVAKM
MNMG_STRTD       -------------------------------LDAKVIELLETEIKYEGYINKALDQVAKM
MNMG_STRMU       -------------------------------LDEKVIELLETEIKYEGYINKALDQVAKM
MNMG_STRGC       -------------------------------LDEKIIELIETEIKYEGYISKALDQVEKM
MNMG_STRSV       -------------------------------LDEKIIELIETEIKYEGYISKALDQVEKM
MNMG_STRR6       -------------------------------LDDKIIELIETEIKYEGYISKAMDQVAKM
MNMG_STRP2       -------------------------------LDDKIIELIETEIKYEGYISKAMDQVAKM
MNMG_STRPN       -------------------------------LDDKIIELIETEIKYEGYISKAMDQVAKM
MNMG_STRPI       -------------------------------LDDKIIELIETEIKYEGYISKAMDQVAKM
MNMG_STRSY       -------------------------------LDAKTIELIETEVKYEGYIAKALDQVEKM
MNMG_STRS2       -------------------------------LDAKTIELIETEVKYEGYIAKALDQVEKM
MNMG_DESRM       -------------------------------LPQEVIEEVEIEVKYEGYIKKQLAQVERF
MNMG_PELTS       -------------------------------LPDEVREQVEIQIKYEGYIKKQQAQVEKF
MNMG_CARHZ       -------------------------------FPDDVKEQVEILVKYEGYIEKQLKEIERF
MNMG_MOOTA       -------------------------------LPPEIAAEIEMMVKYEGYIAKEKIQVERL
MNMG_HELMI       -------------------------------IDPEVAEQVEISAKFEGYLVKQQAQVDRF
MNMG_SYNWW       -------------------------------NDPDILEQLEIQAKYEGYIEKQKEQVKRF
MNMG_DESAP       -------------------------------VAPDVAAEVENQIKYAGYIQKQAAQVARF
MNMG_SYMTH       -------------------------------LDEAIWREVETQVKYAGYIAKEQQQVDRM
MNMG_DESHY       -------------------------------YDEEALLEAGIEIKYAGYIEKQLAEIERF
MNMG_ROSCS       --------------------------------DADIAEQVEIEAKYGGYLQKQQREVERL
MNMG_ROSS1       --------------------------------EADVAEQVDIEAKYSGYLLKQQREVERL
MNMG_CHLAA       --------------------------------SDAVIEQVEIGCKYSGYIARQEREVARM
MNMG_DEIRA       -------------------------------LGASEREAVEIRVKYAGYIARAESQLRSE
MNMG_DEIGD       -------------------------------LSPEEREAVAIRVKYAGYIERAERQLAAE
MNMG_THET2       -------------------------------LSPEEAYQVEVRAKYAGYIERQERLREKM
MNMG_THET8       -------------------------------LSPEEAYQVEVRAKYAGYIERQERLREKM
MNMG_MYXXD       -------------------------------LSPDVAEEVEVEVKYEGYVAQAARAAARE
                                                                 :           

MNMG_NOSS1       ARQAQ-RQLPGDLDYTTVDTLSKEAREKLNKVKPLTIGQAARIGGVNPADINALLIYLEL
MNMG_TRIV2       ARQAQ-RQLPRDLDYTTVETLSKEAREKLNKVKPMTIGQAARIGGVNPADINALLIYLEL
MNMG_TRIEI       SRQKN-RRLPTNLDYLSISTLSLEAREKLSKVQPLTIGQASRIGGVNPADINALLVYLEV
MNMG_SYNY3       SRHSQ-KRLPPGLNYMAIETLSMEAREKLTQFQPLTIGQAGRIGGVNPADINALLVYLET
MNMG_SYNP2       SRHAN-RKLPEGLDYLTVETLSMEAREKLNKVRPLTIGQATRIGGVNPADINALLVYLEV
MNMG_MICAN       SRHSN-RHLSPDIDYMKIETLSMESREKLTKIKPATIGQASRIGGVNPADINALLVYLEM
MNMG_ACAM1       SRQEQ-RKLPENIDYASIETLSMEAREKLAKVRPLTVGQASRIGGVNPSDINALLFYLET
MNMG_SYNP6       VRQSQ-RPLPVDLDYSAITSMRLEAREKLARFRPLTLGQASRIGGVNPADINALLIWLEV
MNMG_SYNE7       VRQSQ-RPLPVDLDYSAITSMRLEAREKLARFRPLTLGQASRIGGVNPADINALLIWLEV
MNMG_THEEB       ARQEQ-RPLPVDLDYFAIPTLSMEAREKLSAIRPLTIGQASRIGGVNPADINALLVYLQV
MNMG_SYNJB       SKQYH-RPLPPDLDYHSIPTLSKESRDKLSAVRPLTVGQAARIGGVNPADINALLIYLEV
MNMG_SYNJA       SKQYH-RPLPPDLDYHSIPTLSKESREKLAAVRPLTVGQAARIGGVNPADINALLIYLEV
MNMG_PROM1       KQQSK-KLLPKNLNYNNIETLSKEAREKLTISQPKSLGHAAQVPGVSKADLTALLVWLKI
MNMG_PROMT       KQQSK-KLLPKNLNYNNIETLSKEAREKLTISQPKSLGHAAQLPGVSKADLTALLVWLKI
MNMG_PROMA       KKQNK-RALPSEVNYTNIKTLSQEAREKLNATQPKTFGEASQLPGVSKADLSALLIWLKI
MNMG_PROM3       KRQSQ-RRLPANLDYANISTLSKEAREKLTAVGPLNFAQASQIPGVSKADLTALLVWLEL
MNMG_PROMM       KRQSQ-RRLPANLDYANISTLSKEAREKLTAVGPLNFAQASQIPGVSKADLTALLVWLEL
MNMG_SYNSC       KRQSQ-RKLPADLNYAGIGTLSNEAREKLTAIQPSTLGQASRIPGVSKADITALLMWLEL
MNMG_SYNPX       KRQSQ-RKLPADLNYAGIGTLSNEAREKLGSIQPTTLGQASRIPGVSQADITALLMWLEL
MNMG_SYNS9       KRQSQ-RKLPSDLNYTNIGTLSNEAREKLSAIQPTTLGQANRIPGVSQADITALLMWLEL
MNMG_SYNPW       KRQGR-RKLPETIDYASISTLSREAREKLTAVRPLTLGQASQIPGVSQADLTSLLMWLEL
MNMG_SYNS3       KRQSL-RKLPADLDYASIGTLSREAREKLTAIQPTTLGQATHIPGVSQADLTALLLWLEL
MNMG_SYNR3       QRQGQ-RLIPSGIDFYSITTLSREARERLTAAQPLNLGQASRLPGVSPADVTALLLWLEL
MNMG_PROMS       NRQSC-KSLPQEINYEKIETLSLEARENLNKIKPKNFGDASKIPGVSKADLTALLVWLKI
MNMG_PROM0       NRQSC-KSLPQEINYEKIETLSLEARENLNKIKPKNFGDASKIPGVSKADLTALLVWLKI
MNMG_PROM9       NRQSC-KSLPQEINYEKIDTLSLEARENLNKIKPKNFGDASKIPGVSKADLTALLVWLKI
MNMG_PROM2       NRQSC-KSLPQEINYEKIDTLSLEARENLNKIKPKNFGDASKIPGVSKADLTALLVWLKI
MNMG_PROM5       NRQSL-KSLPIEINYDLIDTLSLEARENLNKIKPTNFGDASKIPGVSKADLTALLVWLKI
MNMG_PROMP       NRQSL-KSLSSEINYDQIDTLSLEARENLNKIKPTNFGDASKIPGVSKADLTALLVWLKI
MNMG_CHLTR       ERSEN-ISIPEDIDYHSISALSLEAREKLSKFTPRTIGSAARISGISVADIQVLMVSLKK
MNMG_CHLTA       ERSEN-ISIPEDIDYHSISALSLEAREKLSKFTPRTIGSAARISGISVADIQVLMVSLKK
MNMG_CHLT2       ERSEN-ISIPEDIDYHSISALSLEAREKLSKFTPRTIGSAARISGISVADIQVLMVSLKK
MNMG_CHLTB       ERSEN-ISIPEDIDYHSISALSLEAREKLSKFTPRTIGSAARISGISVADIQVLMVSLKK
MNMG_CHLMU       EKAEN-TLIPEGIDYHSISALSLEAREKLSKFTPRTIGSAARISGISVADIQVLMVSLKK
MNMG_CHLAB       SKSEN-MVIPEDIDYQSISSLSLEAREKLAKFTPRTIGSASRISGIACADIQVLMVAVKK
MNMG_CHLCV       SKSEN-MVIPEDIDYQSISSLSLEAREKLAKFTPRTIGSASRISGIACADIQVLMVAVKK
MNMG_CHLFF       SKSEN-MTIPEDIDYQSISSLSLEAREKLAKFTPRTIGSASRISGIANADIQVLMVAVKK
MNMG_CHLPN       EKAES-LLIPEDLDYKQITALSLEAQEKLAKFTPRTLGSASRISGIASADIQVLMIALKK
MNMG_PARUW       AHVEK-IQIPIGFDFSTVNGLRNEAKQKLNQIAPRHLGQALRISGVSPADISILMIALTR
MNMG_RHOBA       SRHAE-KSIPVSFDYDKIGPLRNEAKEKLTKVRPLNLGQAKRISGITPADLALVLAHLEN
MNMG_OPITP       AQIEA-VRIPAAIDYLRIPGLRRESALKLAAQRPDTLGQASRISGVNPADVSILMVLIKT
MNMG_AQUAE       KKLED-TKIPPDIDYDKIPGLTKEAREKLKKFKPITVGQASRIDGITPAAITALLVYLGK
MNMG_ECOLI       LRNEN-TLLPATLDYRQVSGLSNEVIAKLNDHKPASIGQASRISGVTPAAISILLVWLKK
MNMG_ECOL6       LRNEN-TLLPATLDYRQVSGLSNEVIAKLNDHKPASIGQASRISGVTPAAISILLVWLKK
MNMG_ECO24       LRNEN-TLLPATLDYRQVSGLSNEVIAKLNDHKPASIGQASRISGVTPAAISILLVWLKK
MNMG_ECODH       LRNEN-TLLPATLDYRQVSGLSNEVIAKLNDHKPASIGQASRISGVTPAAISILLVWLKK
MNMG_ECOL5       LRNEN-TLLPATLDYRQVSGLSNEVIAKLNDHKPASIGQASRISGVTPAAISILLVWLKK
MNMG_ECOHS       LRNEN-TLLPATLDYRQVSGLSNEVIAKLNDHKPASIGQASRISGVTPAAISILLVWLKK
MNMG_ECOLC       LRNEN-TLLPATLDYRQVSGLSNEVIAKLNDHKPASIGQASRISGVTPAAISILLVWLKK
MNMG_SHIBS       LRNEN-TLLPATLDYRQVSGLSNEVIAKLNDHKPASIGQASRISGVTPAAISILLVWLKK
MNMG_SHISS       LRNEN-TLLPATLDYRQVSGLSNEVIAKLNDHKPASIGQASRISGVTPAAISILLVWLKK
MNMG_ECOUT       LRNEN-TLLPATLDYRQVSGLSNEVIAKLNDHKPASIGQASRISGVTPAAISILLVWLKK
MNMG_ECOK1       LRNEN-TLLPATLDYRQVSGLSNEVIAKLNDHKPASIGQASRISGVTPAAISILLVWLKK
MNMG_ECOSM       LRNEN-TLLPATLDYRQVSGLSNEVIAKLNDHKPASIGQASRISGVTPAAISILLVWLKK
MNMG_ECO57       LRNEN-TLLPATLDYRQVSGLSNEVIAKLNDHKPASIGQASRISGVTPAAISILLVWLKK
MNMG_SHIDS       LRNEN-TLLPATLDYRQVSGLSNEVIAKLNDHKPASIGQASRISGVTPAAISILLVWLKK
MNMG_SHIFL       LRNEN-TLLPATLDYRQISGLSNEVIAKLNDHKPASIGQASRISGVTPAAISILLVWLKK
MNMG_SHIF8       LRNEN-TLLPATLDYRQISGLSNEVIAKLNDHKPASIGQASRISGVTPAAISILLVWLKK
MNMG_SALCH       LRNEN-TLLPATLDYRQVSGLSNEVIAKLNDHKPASIGQASRISGVTPVAISILLVWLKK
MNMG_SALTY       LRNEN-TLLPATLDYRQVSGLSNEVIAKLNDHKPASIGQASRISGVTPAAISILLVWLKK
MNMG_SALPB       LRNEN-TLLPATLDYRQVSGLSNEVIAKLNDHKPASIGQASRISGVTPAAISILLVWLKK
MNMG_SALPA       LRNEN-TLLPATLDYRQVSGLSNEVIAKLNDHKPASIGQASRISGVTPAAISILLVWLKK
MNMG_SALTI       LRNEN-TLLPATLDYRQVSGLSNEVIAKLNDHKPASIGQASRISGVTPAAISILLVWLKK
MNMG_CITK8       LRNEN-TLLPATLDYRQVSGLSNEVIAKLNDHKPVSIGQASRISGVTPAAISILLVWLKK
MNMG_SALAR       LRNEN-TLLPATLDYRLVSGLSNEVIAKLNDHKPASIGQASRISGVTPAAISILLVWLKK
MNMG_ENT38       QRNEN-TLLPEMLDYRQVTGLSNEVIAKLNDHKPVSIGQASRISGVTPAAISILLVWLKK
MNMG_KLEP7       QRNEN-TLLPATLDYRQVTGLSNEVIAKLNDHKPSSIGQASRISGITPAAISILLVWLKK
MNMG_CROS8       QRNEN-TLLPATLDYRQVNGLSNEVIAKLNDHKPASIGQASRISGITPAAISILLVWLKK
MNMG_PECAS       LRNEN-ALLPADLDYKQVNGLSNEVIAKLNDHKPSSIGQASRISGITPAAISILLIWLKK
MNMG_YERPE       LRNEN-TLLPVDLDYQQVSGLSNEVIAKLNDHKPSSIGQASRISGITPAAISILLVWLKK
MNMG_YERPY       LRNEN-TLLPVDLDYQQVSGLSNEVIAKLNDHKPSSIGQASRISGITPAAISILLVWLKK
MNMG_YERPA       LRNEN-TLLPVDLDYQQVSGLSNEVIAKLNDHKPSSIGQASRISGITPAAISILLVWLKK
MNMG_YERPN       LRNEN-TLLPVDLDYQQVSGLSNEVIAKLNDHKPSSIGQASRISGITPAAISILLVWLKK
MNMG_YERPP       LRNEN-TLLPVDLDYQQVSGLSNEVIAKLNDHKPSSIGQASRISGITPAAISILLVWLKK
MNMG_YERPS       LRNEN-TLLPVDLDYQQVSGLSNEVIAKLNDHKPSSIGQASRISGITPAAISILLVWLKK
MNMG_YERP3       LRNEN-TLLPVDLDYQQVSGLSNEVIAKLNDHKPSSIGQASRISGITPAAISILLVWLKK
MNMG_YERE8       LRNEN-TLLPADLDYRQVSGLSNEVIAKLNDHKPNSIGQASRISGITPAAISILLVWLKK
MNMG_SERP5       QRNEN-TVLPLDLDYQQVSGLSNEVIAKLNDHKPNSIGQASRISGITPAAISILLIWLKK
MNMG_PHOLL       LRNEN-TSLPVDLDYRQISGLSNEVVAKLNDHKPSSIGQASRISGVTPAAISILLVWLKK
MNMG_SODGM       MRNEH-TLLPAAMDFSTVSGLSNEVIAKLNDHKPNSIGQASRISGVTPAAISILLVWLKK
MNMG_VIBCH       LRHEH-TKLPAELDYKQVKGLSNEVVLKLNAAKPETIGIASRISGITPAAISILLVHLKK
MNMG_VIBC3       LRHEH-TKLPAELDYKQVKGLSNEVVLKLNAAKPETIGIASRISGITPAAISILLVHLKK
MNMG_VIBCB       LRHEH-TKLPADLDYKDVKGLSNEVVAKLTEAKPESIGIASRISGITPAAISILLVHLKK
MNMG_VIBPA       LRHEH-TKLPADLDYKDVKGLSNEVVAKLSEAKPESIGIASRISGITPAAISILLVHLKK
MNMG_VIBVU       LRHEH-TKLPADLDYSDVKGLSNEVVLKLNTAKPETLGIASRISGITPAAISILLVHLKK
MNMG_VIBVY       LRHEH-TKLPADLDYSDVKGLSNEVVLKLNTAKPETLGIASRISGITPAAISILLVHLKK
MNMG_ALIF1       LRHEN-TKLPFDLDYKEVKGLSNEVVAKLSDAKPETIGIASRISGITPAAISILLVHLKK
MNMG_PHOPR       LRHET-TKLPFDLEYSIVKGLSNEVIAKLTDAKPETIGMASRISGITPAAISLLLVYLKK
MNMG_AERHH       LRNEN-TLLPLDMNYRDVNGLSNEVIAKLNDAKPQTIGQASRISGITPAAISILLVHLKK
MNMG_AERS4       LRNEN-TLLPLDMNYRDVNGLSNEVIAKLNDAKPETIGQASRISGITPAAISILLVHLKK
MNMG_COLP3       KRNED-TKIPRDFDYQQISGLSNEVVAKLKDACPETIGKASRISGITPAAISLLLVYLKK
MNMG_PSEA6       RKNEN-TLIPLDFDYSQISGLSNEVVAKLSDAKPETLGLASRISGITPAAISLLLVYLKK
MNMG_IDILO       QRHEN-TLLPSPFDYAKIKGLSNEVVAKLNDHQPETVGKAARISGITPAAVSMLLVHLKK
MNMG_PSET1       LRHEQ-TILPKEFDYKTVSGLSNEVVAKLIDARPDTIGQASRISGITPAAISLLLVYLKK
MNMG_SHEB5       VRNEN-TGLPLTLDYKEVPGLSNEVIAKLNNHKPETIGQASRISGITPAAISILLVHLKK
MNMG_SHEB8       VRNEN-TGLPLTLDYKEVPGLSNEVIAKLNNHKPETIGQASRISGITPAAISILLVHLKK
MNMG_SHEB9       VRNEN-TGLPLTLDYKEVPGLSNEVIAKLNNHKPETIGQASRISGITPAAISILLVHLKK
MNMG_SHEPC       VRNEN-TGLPLHLDYKEVPGLSNEVIAKLNSHKPETIGQASRISGVTPAAISILLVHLKK
MNMG_SHESW       VRNEN-TGLPLHLDYKEVPGLSNEVIAKLNSHKPETIGQASRISGVTPAAISILLVHLKK
MNMG_SHESM       VRNEN-TGLPLNLDYKEVPGLSNEVIAKLNSHKPETIGQASRISGITPAAISILLVHLKK
MNMG_SHESR       VRNEN-TGLPLNLDYKEVPGLSNEVIAKLNSHKPETIGQASRISGITPAAISILLVHLKK
MNMG_SHESA       VRNEN-TGLPLNLDYKEVPGLSNEVIAKLNSHKPETIGQASRISGITPAAISILLVHLKK
MNMG_SHEON       VRNEN-TGLPLNLDYKEVPGLSNEVIAKLNSHKPETIGQASRISGITPAAISILLVHLKK
MNMG_SHEDO       IRHEN-SLLPLDLDYQEVPGLSNEVIAKLNNHKPDTIGQASRISGITPAAISILLVHLKK
MNMG_SHEFN       IRHEN-SLLPLDLDYQEVPGLSNEVIAKLNNHKPDTVGQASRISGITPAAISILLVHLKK
MNMG_SHEHH       IRHET-TLLPLDLDYQEVPGLSNEVIAKMNEHKPETIGQASRISGMTPAAISILLVHLKK
MNMG_SHEPA       IRHET-TLLPLDLDYQEVPGLSNEVIAKMNEHKPETIGQASRISGMTPAAISILLVHLKK
MNMG_SHESH       IKHET-TGLPLELDYQEVPGLSNEVIAKLNDHKPETIGQASRISGMTPAAISILLVHLKR
MNMG_SHEWM       IRHET-TGLPLDLDYQEVPGLSNEVIAKLNDHKPETIGQASRISGMTPAAISILLVHLKR
MNMG_SHELP       IRHEK-TGLPQDLDYQEVPGLSNEVIAKLNDHKPDTVGQASRISGITPAAISILLVHLKK
MNMG_SHEAM       ERNEN-TRLPLDLDYSEVPGLSNEVTAKLNAHKPETIGQASRISGVTPAAVSILLVHLKK
MNMG_PSYIN       KRNED-TLLPIHLDYSDIKGLSNEVTAKLNDTKPENIGQASRISGITPAAISILLIYIKK
MNMG_ACTP2       KRHEN-TLIPAEFDYDKVESLSNEVRAKLMQHRPVSIGQASRISGITPAAISILLVNLKK
MNMG_ACTPJ       KRHEN-TLIPAEFDYDKVESLSNEVRAKLMQHRPVSIGQASRISGITPAAISILLVNLKK
MNMG_HAEDU       KRHEN-TLIPAEFDYNKVDSLSNEVRAKLMQHRPISIGQASRISGITPAAISILLVNLKK
MNMG_HAEIN       KRHEN-TAIPANFDYSKVSGLSNEVRAKLEQHRPVSIGQASRISGITPAAISIILVNLKK
MNMG_HAEIG       KRHEN-TAIPANFDYNKVSGLSNEVRAKLEQHRPVSIGQASRISGITPAAISIILVNLKK
MNMG_HAEIE       KRHEN-TAIPANFDYSKVSSLSNEVRAKLEQHRPVSISQASRISGITPAAISIILVNLKK
MNMG_HAEI8       KRHEN-TAIPANFDYSKVSGLSNEVRAKLEQHRPVSIGQASRISGITPAAISIILVNLKK
MNMG_HAES1       KRHEN-TAIPANFDYKNISGLSNEVCAKLEQYRPISIGQASRISGITPAAISILLVNLKK
MNMG_HISS2       KRHEN-TAIPANFDYKNISGLSNEVCAKLEQYRPISIGQASRISGITPAAISILLVNLKK
MNMG_MANSM       KRHEN-TAIPDNFDYTLVAGLSNEVRAKLEQHRPVSIGQASRISGVTPAAISILLVNLKK
MNMG_PASMU       KRHES-TAIPAHFDYTVVSGLSNEVRAKLEQHRPVSIGQASRISGVTPAAISILLVSLKK
MNMG_ACTSZ       KRHEN-TLIPERFDYSLVAGLSNEVRAKLEQHRPVSIGQAGRISGVTPAAISILLVNLKK
MNMG_HYDCU       RRAEN-VEIPDALDLDKISGLSNEVKQKLRDHKPATLGMASRISGITPAAVSLLLIYIKK
MNMG_ACIAC       FYYEN-LQLPQELDYMQVAALSIEVRQKLQKHRPETLGQASRISGVTPAAVSLLLVHLKK
MNMG_ACISJ       AHFEK-LRLPEDLDYMQVAALSIEVRQKLQKHRPETLGQASRISGVTPAAISLLMVHLKK
MNMG_VEREI       AHFET-LRLPAGLDYAQVTALSIEARQVLSRHRPETLGQASRITGITPAAISLLLVHLKK
MNMG_POLNA       SHYEN-LKLPADLDYLQVSALSFEARQMLSKHRPETLGLASRIQGITPATISLLLVHLKK
MNMG_POLSJ       AHYEN-LKLPTDLDYLQVSALSFEARQTLARHRPETLGMASRISGITPATVSLLLVHLKK
MNMG_RHOFT       AHYEN-LKLPLELDYLQVSALSFEARQKLSKHRPETLGQASRLSGITPAAISLLLVHLKK
MNMG_LEPCP       AHYEH-LRLPDELDYAQVTALSFEVRQKLTKHRPETLGQASRISGVTPAALSLLLIHLKR
MNMG_METPP       AQYED-LKLPESLDYRQVAALSHEVRQKLQALRPETLGQAARVSGVTPAAISLLLIHLKK
MNMG_BURCA       DANEN-TRLPDGIDYREVRGLSFEVSQKLNEFRPETIGQASRISGVTPAAISLLMVHLKR
MNMG_BURCH       DANEN-TRLPDGIDYREVRGLSFEVSQKLNEFRPETIGQASRISGVTPAAISLLMVHLKR
MNMG_BURCC       DANEN-TRLPDGIDYREVRGLSFEVSQKLNEFRPETIGQASRISGVTPAAISLLMVHLKR
MNMG_BURCM       DANEN-TRLPDGIDYREVRGLSFEVSQKLNEFRPETIGQASRISGVTPAAISLLMVHLKR
MNMG_BURA4       DANEN-TRLPDGIDYREVRGLSFEVSQKLNEFRPETIGQASRISGVTPAAISLLMVHLKR
MNMG_BURL3       DANEN-TRLPDGIDYREVRGLSFEVSQKLNEFRPETIGQASRISGVTPAAISLLMVHLKR
MNMG_BURVG       DANEN-TRLPDGIDYREVRGLSFEVSQKLNEFRPETIGQASRISGVTPAAISLLMVHLKR
MNMG_BURMA       GANEN-TRLPDGIDYTEVRGLSFEVSQKLNQFRPETIGQASRISGMTPAAISLLMVHLKK
MNMG_BURM9       GANEN-TRLPDGIDYTEVRGLSFEVSQKLNQFRPETIGQASRISGMTPAAISLLMVHLKK
MNMG_BURP0       GANEN-TRLPDGIDYTEVRGLSFEVSQKLNQFRPETIGQASRISGMTPAAISLLMVHLKK
MNMG_BURM7       GANEN-TRLPDGIDYTEVRGLSFEVSQKLNQFRPETIGQASRISGMTPAAISLLMVHLKK
MNMG_BURMS       GANEN-TRLPDGIDYTEVRGLSFEVSQKLNQFRPETIGQASRISGMTPAAISLLMVHLKK
MNMG_BURP1       GANEN-TRLPDGIDYTEVRGLSFEVSQKLNQFRPETIGQASRISGMTPAAISLLMVHLKK
MNMG_BURPS       GANEN-TRLPDGIDYTEVRGLSFEVSQKLNQFRPETIGQASRISGMTPAAISLLMVHLKK
MNMG_BURP6       GANEN-TRLPDGIDYTEVRGLSFEVSQKLNQFRPETIGQASRISGMTPAAISLLMVHLKK
MNMG_BURTA       GANEN-TRLPDGIDYTEVRGLSFEVSQKLNQFRPETIGQASRISGVTPAAISLLMVHLKK
MNMG_PARXL       EAHES-TRLPEGLDYAEVRGLSFEARQKLTQFRPETIGQASRISGITPAAISLLMVHLK-
MNMG_CUPNH       EANES-TRLPEGLDYTEVRGLGFEVSQKLNQHRPETLGQASRISGVTPAAISLLLVHLKK
MNMG_CUPPJ       EANES-TRLPEGLDYTEVRGLGFEVSQKLNQHRPETLGQASRISGVTPAAISLLLVHLKK
MNMG_CUPMC       EANES-TKLPPNFDYTEVRGLGFEVSQKLNQHRPETLGQASRISGVTPAAISLLLVHLKK
MNMG_RALSO       GANEN-TRLPADFDYKQVRGLSIEVQQKLAQHKPETIGQASRISGITPAAVSLLLVHLKK
MNMG_JANMA       DYYEN-LKLPQEFDYMEVKGLSFEVRQKLCKHKPETLGQASRISGVTPAAISLLLVHLKK
MNMG_HERAR       DHYEN-LKLPAEFDYMAVKGLSIEVRQKLTKQRPETLGQASRISGVTPAAISLMLVHLKK
MNMG_BORBR       LSHEQ-QPIPADIDYDAVTSLSFEVRQKLKTHRPETIGQAARVSGVTPAAISLLLIHLKR
MNMG_BORPA       LSHEQ-QPIPADIDYDAVTSLSFEVRQKLKTHRPETIGQAARVSGVTPAAISLLLIHLKR
MNMG_BORPE       LSHEQ-QPIPADIDYDAVTSLSFEVRQKLKTHRPETIGQAARVSGVTPAAISLLLIHLKR
MNMG_BORPD       LAHEQ-QRIPADIDYDAVSSLSFEVRQKLKTHRPETIGQAARISGVTPAAISLLLIHLKR
MNMG_BORA1       VVHEQ-QAIPADIDYDAVSSLSFEVRQKLKTHRPETVGQAARISGVTPAAVSLLLIHLKR
MNMG_AZOSB       LQAES-TRLPADLDYAEVRGLSKEVQQKLNLHKPETIGQAGRIQGITPAAISLLLVWLKR
MNMG_AROAE       LQAES-TLLPADLDYSRVRGLSKEVQQKLNLHKPGTLGQAGRIQGVTPAAISLLMVWLKR
MNMG_DECAR       SSYEN-TVLPSELDYSSVAGLSNEVRQKLAQHKPQTIGQASRIQGITPAAISLLLIHLKR
MNMG_METFK       KESEH-YRLPLNMDYSEVHGLSIEVQQKLNKQKPETIGQAGRISGVTPAAVSLLLVHLKR
MNMG_THIDA       REQEG-LRLPPDLDYTRLTGLSMEVRQRLQTAQPETLGQASRLQGVTPAAISVLLVYAKR
MNMG_NITMU       AYYED-IRLPQDLDYKTVRGLSNEVQQKLNQFKPETAGQASRISGITPAAISLLLVHVKR
MNMG_NEIG1       RDIET-LKLPDGIDYGRVKGLSAEVQQKLNQHKPETVGQASRISGVTPAAVALLMVHLKR
MNMG_NEIMA       RDIET-LKLPDGIDYGKVKGLSAEVQQKLNQHKPETVGQASRISGVTPAAVALLMVHLKR
MNMG_NEIMB       RDIET-LKLPDGIDYGKVKGLSAEVQQKLNQHKPETVGQASRISGVTPAAVALLMVHLKR
MNMG_NEIM0       RDIET-LKLPDDIDYSKVKGLSAEVQQKLNQHKPETVGQASRISGVTPAAVALLMVHLKR
MNMG_NEIMF       RDIET-LKLPDGIDYGKVKGLSAEVQQKLNQHKPETVGQASRISGVTPAAVALLMVHLKR
MNMG_CHRVO       DNLED-IRLPGDIDYGLVKGLSKEVQQKLNQQRPETLGQASRIQGITPAAVALLMVHLRR
MNMG_POLAQ       EHNET-FPLPEGLDYSQVLGLSKEVQQKLNLHKPETLGQAGRISGVTPAALSLLLVHLKK
MNMG_ACIBT       KRLEE-TKIPADFDYDVVSGLSREITQKLKTVRPETLAQASRIPGVTPAAVQLVMITIRK
MNMG_ACIBY       KRLEE-TKIPADFDYDVVSGLSREITQKLKTVRPETLAQASRIPGVTPAAVQLVMITIRK
MNMG_ACIAD       KRLEE-TKIPADFDYDIVSGLSREITQKLKTVRPETLAQAHRIPGVTPAAVQLVMITIRK
MNMG_PSYA2       KRLEN-TALPMDFDYSVVSGLSNEIVQKLAQVRPSTLAQAGRISGVTPAAIQLLAMTVKK
MNMG_PSYCK       KRLEN-TALPIDFDYSVVSGLSNEIVQKLAQVRPSTLAQAGRISGVTPAAIQLLAMTVKK
MNMG_PSYWF       KRLEN-TQLPADFDYKAVSGLSNEIVQKLNDIRPATLAQASRISGVTPAAIQLLGMTLKK
MNMG_PSEAE       RASED-TRLPVDIDYLGISGLSKEIQNKLNQARPETLGQASRIPGVTPAAISLLLIHLKK
MNMG_PSEAB       RASED-TRLPVDIDYLGISGLSKEIQNKLNQARPETLGQASRIPGVTPAAISLLLIHLKK
MNMG_PSEA7       RASED-TRLPVDIDYLGISGLSKEIQNKLNQARPETLGQASRIPGVTPAAISLLLIHLKK
MNMG_PSEPU       RASED-TRLPVDIDYTTISGLSKEIQGKLSQTRPQTLGQASRIPGVTPAAISLLLIHLKK
MNMG_PSEPK       RASED-TRLPVDIDYTTISGLSKEIQGKLSQTRPQTLGQASRIPGVTPAAISLLLIHLKK
MNMG_PSEP1       RASED-TRLPVDIDYTTISGLSKEIQGKLSQTRPETLGQASRIPGVTPAAISLMLIHLKK
MNMG_PSEPG       RASED-TRLPVDIDYSTISGLSKEIQGKLGQTRPETLGQASRIPGVTPAAISLLLIHLKK
MNMG_PSEPW       RASED-TCLPVDIDYTSISGLSKEIQGKLGQTRPQTLGQASRIPGVTPAAISLLLIHLKK
MNMG_PSEE4       RASED-TRLPVDIDYTTISGLSKEIQGKLEQTRPETLGQASRIPGVTPAAISLLLIHLKK
MNMG_PSEF5       RASED-TKLPVDIDYSGISGLSKEIQSKLGATRPETLGQASRIPGVTPAAISLLMIHLKK
MNMG_PSEPF       RASED-TKLPVDIDYTNISGLSKEIQSKLGATRPETLGQASRIPGVTPAAISLLMIHLKK
MNMG_PSE14       RASED-TRLPEDIDYAAISGLSKEIQSKLGITRPETLGQASRIPGVTPAAISLLMIHLKK
MNMG_PSEU2       RASED-TRLPEDIDYAAISGLSKEIQSKLGITRPETLGQASRIPGVTPAAISLLMIHLKK
MNMG_PSESM       RASED-TRLPEDIDYTGISGLSKEIQSKLGITRPETLGQASRIPGVTPAAISLLMIHLKK
MNMG_PSEMY       RASED-TKLPEDLDYSAISGLSKEIQFKLGNTRPATLGQAGRIPGVTPAAISLLLIHLKK
MNMG_PSEU5       RASEN-VALPADLDYATISGLSKEIQHKLGQARPQTLGQASRIPGVTPAAVSLLMIHLKK
MNMG_ALCBS       RAAET-TALPVEFDYGQVKGLSNEVKQKLSEIRPQTLGQAGRIPGVTPAAISLLMIYLKK
MNMG_HAHCH       RRNEN-MALPADLDYSGIQGLSNEIKQKLTEVRPETLAQASRIPGVTPAAVSLLLVHLKK
MNMG_MARMS       RRQEN-TELPDDLDYSKMEGLSNEIKQKLTQLRPATLAAASRIQGVTPAAVSLLLIHLKK
MNMG_SACD2       RQHEN-TVIPVEFDYMSVEGLSNELKQKLSEARPETLSRASRIPGVTPAAVSLILIYLKK
MNMG_CHRSD       RRHEA-LRLPEDLDYARIDGLSHEIRQKLEAARPETLAQAGRISGVTPAAVSLLLVHLKK
MNMG_MARHV       RKNEN-TALPLDLDYDVIGGLSNEIKQKLKDVRPETVAQASRIQGVTPAAVSQILVHLKK
MNMG_ALKEH       RRHEQ-LPLPEGLAYDRVAGLSSEVREKLAAHRPATVGQAARIPGVTPAAVSLLLVHLRR
MNMG_NITOC       QRHES-LRLPLDLNYHQVRGLSVEVQEKLARVQPATLGQATRIPGVTPAAISLLLVYLKR
MNMG_METCA       RRYEA-WQLPDSMDYGKVIGLSSEVREKLGRVRPATVGQAARIPGITPAAISLLLVHLRR
MNMG_XANAC       QRHET-TPIPDGFDYASVRGLSIEVQQKLERVRPQHIGQAQRIPGMTPAAISLLLVHLER
MNMG_XANC5       QRHET-TPIPEGFDYASVRGLSIEVQQKLERVRPQHIGQAQRIPGMTPAAISLLLVHLER
MNMG_XANOR       QRHET-TPIPEGFDYAGVRGLSIEVQQKLEHVRPQHIGQAQRIPGMTPAAISLLLVHLER
MNMG_XANOM       QRHET-TPIPEGFDYAGVRGLSIEVQQKLEHVRPQHIGQAQRIPGMTPAAISLLLVHLER
MNMG_XANCP       QRHET-TPIPEGFDYAGVRGLSMEVQQKLERVRPQSIGQAQRIPGMTPAAISLLLVHLER
MNMG_XANC8       QRHET-TPIPEGFDYAGVRGLSMEVQQKLERVRPQSIGQAQRIPGMTPAAISLLLVHLER
MNMG_XANCB       QRHET-TPIPEGFDYAGVRGLSMEVQQKLERVRPQSIGQAQRIPGMTPAAISLLLVHLER
MNMG_XYLFA       QRHEA-TAIPLEFDYAAVRGLSTEVLQKLQHIQPQTVGQAQRIPGMTPAAISLLLVHLER
MNMG_XYLFT       QRHEA-TAIPLEFDYAAVRGLSTEVLQKLQHIQPQTVGQAQRIPGMTPAAISLLLVHLER
MNMG_COXBU       KKYQT-AQIPSSLDYNQVTGLSNEVRQKLNETKPTTLGQASRIPGITPAAISLLLVHLKK
MNMG_COXBN       KKYQT-AQIPSSLDYNQVTGLSNEVRQKLNETKPTTLGQASRIPGITPAAISLLLVHLKK
MNMG_COXBR       KKYQT-AQIPSSLDYNQVTGLSNEVRQKLNETKPTTLGQASRIPGITPAAISLLLVHLKK
MNMG_LEGPC       RKHEN-TMLPETLDYNDVVGLSSEVIQKLNRIKPTSLAQAGRISGVTPAALSLLLVHLKK
MNMG_LEGPA       RKHEN-TMLPETLDYNDVVGLSSEVIQKLNRIKPTSLAQAGRISGVTPAALSLLLVHLKK
MNMG_LEGPL       RKHEN-TMLPETLDYNDVVGLSSEVIQKLNRIKPTSLAQAGRISGVTPAALSLLLVHLKK
MNMG_LEGPH       RKHEN-TLLPETLDYNDVVGLSSEVIQKLNRIKPTSLAQAGRISGVTPAALSLLLVHLKK
MNMG_NITEU       AQHEA-MILPKDMDYRAVRGLSNEVTQKLNQHQPETIGQAARISGITPAAISLLLVHLKR
MNMG_NITEC       TQHET-MVLPKNLDYSTVRGLSNEVTQKLNQHQPETIGQAARISGITPAAISLLLVHLKR
MNMG_FRATF       ATLEQ-KAIPTDFNYSQVKGLSNEVLQKLTEQKPTTLGEASRIPGITPAAISLLTIYMKK
MNMG_FRATH       ATLEQ-KAIPTDFNYSQVKGLSNEVLQKLTEQKPTTLGEASRIPGITPAAISLLTIYMKK
MNMG_FRATO       ATLEQ-KAIPTDFNYSQVKGLSNEVLQKLTEQKPTTLGEASRIPGITPAAISLLTIYMKK
MNMG_FRATW       ATLEQ-KAIPTDFNYSQVKGLSNEVLQKLTEQKPTTLGEASRIPGITPAAISLLTIYMKK
MNMG_FRATT       ATFEQ-KAIPTDFNYSQVKGLSNEVLQKLTEQKPTTLGEASRIPGITPAAISLLTIYMKK
MNMG_FRAT1       ATFEQ-KAIPTDFNYSQVKGLSNEVLQKLTEQKPTTLGEASRIPGITPAAISLLTIYMKK
MNMG_FRATN       ATLEQ-KAIPTDFNYSQVKGLSNEVLQKLTEQKPTTLGEASRIPGITPAAISLLTIYMKK
MNMG_FRAP2       STLES-KTIPESFDYSQVKGLSNEVLQKLSEQKPTTLGEASRIPGVTPAAVSLLTIYMKK
MNMG_VESOH       RKNEN-TVLSTNINYNSIKALSTEVRQKLELHKPETIGQASRIQGVTPASISILLVYLKT
MNMG_RUTMC       RKNEN-TILSVNIDYDSIKALSSEVRQKLELHKPETIGQASRIQGVTPASISILLVYLKT
MNMG_DICNV       QKNRA-QKLPVPFDYRKVTGLSAELAEKLQKVQPHDLDQAARIAGMTPAALSLLLIYFKK
MNMG_BLOFL       LYYEN-TLLPIDINYHDIAGLSKEVIDKFNDCRPYSIGQASRIPGVTPAAISNVLIWLKK
MNMG_BLOPB       IYNEN-TLLPTDIDFNIVSGLSQEVIDKLNNYKPYSIGQASRISGITPAAISNLLVWLKK
MNMG_BAUCH       LNYEQ-TLLPKNMDFSLVTGLSNEAISQLNNHQPYSIGQALRISGITPIAISLLLLWLKK
MNMG_BUCAI       LKNEN-TFLSSIYDYNKIRGLSSEVVKKLNDYKPISIGQASRISGITPAAISILLIHLKK
MNMG_BUCAP       LKNEN-TPLLPTYDYNKIKGLSHEAVLKLNDYKPVSVGQASRISGITPATISILLIHLKK
MNMG_BUCBP       LNNDY-IVLSKIKNYKVVKGLSNEVVSKLNFYKPYSLGQASRISGITPAAISILLIYLKK
MNMG_WIGBR       TYYDN-IILPNEINFKKISGLSKEVIEKLNIFKPTSIGQAIKISGITPAAISIILIWLKK
MNMG_BUCCC       KYYEN-KKLYCIKDYREILGLSNEAIIKLNKYRPSSIGQALRISGITPVTISILLIFLKK
MNMG_HALHL       QRYAQ-VRLPEALDYAAIDGLSTEVRERLTRMRPATVGQAARLPGVTPAAISLLLIHLRR
MNMG_RHIME       RRDEN-TSIPDDFDYEVLPGLSNELKQKLAQHKPRNLAQAMKVDGVTPAAISLILSWLRR
MNMG_SINMW       QREES-TAIPEAFDYESLPGLSNELKQKLAQQKPRNLSQAMKVDGVTPAAISLILSWLRR
MNMG_RHIEC       QRDEE-RRIPADFNYDALSGLSNELKAKLSAARPFNVAQAAIVEGMTPAAVALLLVHLRR
MNMG_RHIL3       QRDEE-RQIPLDFNYDALAGLSNELKVKLGTARPFNIAQAAIVEGMTPAAIALLLVHLRR
MNMG_AGRFC       KRDED-RKIPDDFDFQSLSGLSNELKQKLEKARPENIAQAARVDGMTPAAISLLLALLRK
MNMG_BARHE       QRDER-LEIPSSLDVQAISGLSNELKTKIQKISPRSIADAQKIDGMTPAALSLIITYIQR
MNMG_BARQU       QRDER-LEIPSSLDFQTISGLSNELKTKIQKISPRSIADAQKIDGMTPAALSLIITYIQR
MNMG_BART1       QRDER-LEIPSSLDIQAISGLSNELKSKIQEVSPRSIADAQKIDGMTPAALSLIITYIQR
MNMG_BARBK       QRDES-LEIPSSLNIQAIYGLSNELKTKIQKISPRSIADAQKIDGMTPAALSLIITYIQR
MNMG_BRUAB       EREER-LLIPSGLDFDAISGLSNELKQKLKQRKPETIAEAQRVDGMTPAAVALLIAQIRK
MNMG_BRUA2       EREER-LLIPSGLDFDAISGLSNELKQKLKQRKPETIAEAQRVDGMTPAAVALLIAQIRK
MNMG_BRUC2       EREER-LLIPSGLDFDAISGLSNELKQKLKQRKPETIAEAQRVDGMTPAAVALLIAQIRK
MNMG_BRUSU       EREER-LLIPSGLDFDAISGLSNELKQKLKQRKPETIAEAQRVDGMTPAAVALLIAQIRK
MNMG_BRUSI       EREER-LLIPSGLDFDAISGLSNELKQKLKQRKPETIAEAQRVDGMTPAAVALLIAQIRK
MNMG_BRUME       EREER-LLIPSGLDFDAISGLSNELKQKLKQRKPETIAEAQRVDGITPAAVALLIAQIRK
MNMG_BRUO2       EREER-LLIPSGLDFDAISGLSNELKQKLKQRKPETIAEAQRVDGMTPAAVALLIAQIRK
MNMG_BRUA4       EREEQ-LLIPAGLDIDGISGLSNELKHKLKQRRPETIAEAQRVDGMTPAALALLIAQIKK
MNMG_RHILO       RHEES-RLIPETVDFAGVPGLSNELKQKMQARRPRSIADAQRMEGMTPAALAIIVAHVRH
MNMG_CHESB       RREEG-RSIPDGIDFDSVPGLSNELKYKLRQRRPRTLAEAQRIDGMTPAALALILVAIRQ
MNMG_BRASB       RRDEG-LVLGD-IDYALVPGLSNEARAKLTAARPWTIGQAGRIDGMTPAALGILAAYLRR
MNMG_BRASO       RRDEG-LVLGD-IDYAIVPGLSNEARAKLTAAKPWTIGQAGRIDGMTPAALGILAAYLRR
MNMG_BRADU       RRDEG-LVLSE-VDYQLVPGLSNEVRAKLEKARPFTVGQAGRIDGMTPAALGILAAYLRR
MNMG_NITHX       RRDES-LVLAD-VDYDAVPGLSNEARARLERARPRTVGQAGRLDGITPAALGILAAYLRR
MNMG_NITWN       RRDEG-LVLTE-IDYSAVPGLSNEARNRLEKAQPLTVGQAGRLDGITPAALGILAAYLRR
MNMG_RHOPS       RRDEG-LLLTE-IDYAQVPGLSNEARNRLERHRPRTVGQAGRLDGITPAALGILAAYLRR
MNMG_RHOP2       RRDEG-LLLTD-VDYAQVPGLSNEARGRLERHRPRTVGQAGRLDGITPAALGILAAYLRR
MNMG_RHOPA       RRDES-LGLTD-VDYAAVPGLSNEARTRLERHRPHTVGQAGRLDGITPAALGILAAYLRR
MNMG_RHOP5       RRDEG-LVLTD-IDYSLVPGLSNEARGKLEKARPRTVGQAGRLDGITPAALGILAAYLRR
MNMG_RHOPB       RRDEG-LLLTE-IDYALVPGLSNEARGRLEKARPRTVGQAGRLDGLTPAALGILAAYLRR
MNMG_AZOC5       RRDED-LVLPDELGYDGLPGLSNELKAKLTRVRPRTIGQAGRMEGMTPAALALLVTYARR
MNMG_METPB       RRDEA-VRLPASLDYGTIAGLSNEMRVKLDGVRPTTLGQAARIEGVTPAALTLLAAHARR
MNMG_METRJ       RRDEA-VRLPPGLDYAAISGLSNEMRVKLETVRPGTLGQAARIEGVTPAALTLLAAHARR
MNMG_METS4       RRDEA-VRLPASLDYGRIAGLSNELRLKLDCVRPHTLGQAARIEGVTPAALTLLAAHARR
MNMG_BEII9       RRDEG-LALPTDLDYASMQGLSNEIRGRLAAIRPATLGQAGRIEGMTPTALTLLAARVRR
MNMG_PARL1       RRDEG-LRLPAEIDYASVLGLSHEVRQKLAKARPATLGQAARVDGVTPAALTTLMIHVKQ
MNMG_RHORT       RRDEA-LVLPADLAYDGLANLSAELRGKLTLARPATLGAAARIPGMTPAALTALLRHVKR
MNMG_MAGSA       RREEG-LALSADLDYDAIGSLSNEVRQKLKAARPETLAAAARIPGVTPAAVTALLGHVKK
MNMG_CAUVC       RKDED-LRLPADLDYAEIGSLSNEVRGKLARVRPLTLGQAARIEGVTPGALTALLAHVRR
MNMG_CAUSK       RREED-LRLPADLDYGLVGSLSNEVREKLARVKPLTLGQAARIEGVTPGALTALLAHVRR
MNMG_MARMM       RRDEA-VRLPRDLDYSGIGGLSNEAREKLERARPETLGQAARIEGVTPGALTAVLAHVKR
MNMG_HYPNA       RRDEA-LSIPSDLDYDLIGGLSNEVRQKLKSVRPGTLGQAGRIEGVTPGALTALLGHVRR
MNMG_GLUOX       ASESA-IALPADLDYTAIGGLSSEMRERFSQARPTSFAAAQRVRGVTPAALVALLAHVRT
MNMG_GLUDA       EAETR-ITLPADLDYRRIGGLSSEMQERLAAARPASFSAAQRVPGITPSALMALLSHVRQ
MNMG_GRABC       QQEDT-ILLSDHIDYSAIGGLSAEIRDKLQSLRPTSLGAASRMEGMTPAALAAISHFVRR
MNMG_ACICJ       AKDDA-VLIPPDFDFSVVGGLSAEIRARLERVRPETLGVAGRLEGMTPAALGALFAALRR
MNMG_RUEPO       KRDEA-LVIPIDFNFSALDGLSNELKQKLTSARPENIAQAGRVEGMTPAALALILARLRR
MNMG_RUEST       KRDEQ-YRIPRDFSY-EIDGLSMELRQKLERSRPESLAQAARIDGMTPAALALMLGSLKK
MNMG_ROSDO       KKDEG-HKIPADFDYDQLSGLSNELKSKLNSTRPTSLAQVGRIDGMTPAALTLILAKLRQ
MNMG_DINSH       KKDEE-IEFPPRFDFSGLSGLSNELKSKLTAVRPSTLGQAARIEGMTPAALTLLLASLRK
MNMG_RHOS1       KRDEA-IRIPADFDYAPLSGLSSELKAKLMRARPSTIAQAAQLEGMTPSALTLILARLRR
MNMG_CERS4       KRDEA-IRIPADFDYAPLSGLSSELKSKLMRARPSTIAQAAQLEGMTPSALTLILARLRR
MNMG_CERS5       KRDEA-VRIPSDFDYGSLSGLSHELTAKLLHARPATIAQAARLEGMTPSALMLILSRLRR
MNMG_PARDP       RKEEA-VAIPAEFDYDALSGLSNELKFKLNQHRPATLAAAANIEGMTPAALTLILAVIRA
MNMG_JANSC       KRDEA-KSIPADFPYSSVVGLSNELRMKLIKTRPSTLAQASRIDGMTPAALALILTKIRQ
MNMG_NOVAD       RASDA-VPLGDGFPFADVPGLSREMVERLERAQPDSLAAAGRIAGITPAALASLLVHARR
MNMG_ERYLH       KANEA-ITLAADFPFAEVPGLSSEMVERLTAARPETLAAAGRVPGVTPAALAAVLVHTRK
MNMG_SPHAL       AANEA-ILLDPALDYAAIGGLSREMVERLSKARPETLGQAARIDGVTPAALTAIMVHSRR
MNMG_SPHWW       RADER-IGLAVIVDYGAIAGLSNEMVERLNAARPADLAAAGRVRGVTPAALAAIMVHARR
MNMG_ZYMMO       AGHDN-MPLPAELDYATIAGLSNEMVEKFSAARPPDMASASRVRGVTPAALAAILIHAKK
MNMG_ANAMM       LEEEN-ASIPADIRYSEVHGLSKEAQEKLQRAQPFSIGAARRIPGITPAAIANIIIHLRC
MNMG_ANAPZ       LEEEN-LSIPKDILYSDVYGLSKEAQEKLQAVKPFSIGAARRIPGITPAAIANILIHLRC
MNMG_EHRCJ       IEEEN-THIPSNIEFSQIHGLSKEIQEKLAHIKPPSIGSARRIPGVTPAAITSILIYLRY
MNMG_EHRCR       LEEEN-THIPHNIEFSQIHGLSKEIQEKLEYIKPLSIGSARRIPGITPAAITNILIYLRY
MNMG_EHRRG       IAEEN-THIPHDIEFSQIHGLSTEIQEKLQYMKPPSIGSARRIPGVTPAAITNILFYLRY
MNMG_EHRRW       IAEEN-THIPHDIEFSQIHGLSTEIQEKLQYMKPPSIGSARRIPGVTPAAITNILFYLRY
MNMG_WOLPM       REEIN-TQIPINFNYSQVKGLSSEVIEKLQTIKPATIGIAKQIQGITPAAIVSILVYLRN
MNMG_WOLTR       REEMN-TQIPTNFNYSQIKGLSSEVIEKLQAIKPATIGIAKQIQGITPAAIVSILVYLRN
MNMG_NEOSM       RNNEK-VVIPSNFDFGAIKSLSSEVIEKLEAVRPETLAQAKRISGVTPAAIVSILIHLRR
MNMG_RICRO       QSEEA-QFIPKNIDYFKIPSISLEIQEKLSAHKPTTIGVARRIPGITPAAITAIIIYLKT
MNMG_RICRS       QSEEA-QFIPKNIDYFKIPSISLEIQEKLSAHKPTTIGVARRIPGITPAAITAIIIYLKT
MNMG_RICCN       QSEEA-QFIPKNIDYFKIPSISLEIQEKLSSHKPTTIGVARRIPGITPAAITAIIIYLKT
MNMG_RICM5       QSEEA-QLIPKNIDYFKIPSISLEIQEKLSSHKPTTIGVARRIPGITPAAITAIIIYLKT
MNMG_RICFE       QSEEA-QLIPKNIDYFKIPSISLEIQEKLSSHKPTTIGVARRISGITPAAITAIIIYLKT
MNMG_RICAH       QSEEA-QLIPKNIDYFKIPSISLEIQEKLSSHKPTTIGLARRIPGITPAAITSIIIYLKT
MNMG_RICCK       QNEEI-QLIPKNIDYFKIPSISLEIREKLSYYKPTTIGIARRIPGITPAAITAIIIYLKT
MNMG_RICB8       QSEEA-QLIPKNIDYFKIPSISLEIQEKLSYNKPITIVAARRIPGVTPAAITAIIIYLKT
MNMG_RICBR       QSEEA-QLIPKNIDYFKIPSISLEIQEKLSYNKPITIVAARRIPGVTPAAITAIIIYLKT
MNMG_RICPR       QSEEI-QLIPKNIDYFKIPSISLEIQEKLSYHKPATIGVARRISGITPASITAIIIYLKT
MNMG_RICTY       QSEEI-QLIPKNIDYFKIPSISLEIQEKLSYHKPTTIGVARRISGITPAAIMAIIIYLKT
MNMG_ORITB       KQEET-YQIPQDLNYDQIPSLSIEVREKLKQYQPETIRAAKHINGVTPSAIMAIIIFLKT
MNMG_PELUB       KRDEN-LVIPENVNYDDLSGLSNEVKAKFNQIKPKTMGQALRIDGITPAAVYILLSHVKR
MNMG_KORVE       KRSEQ-RVIPEWFDYASVSGLSREMCEKMQRVRPQTIGQASRIPGVTPAAVSLINVYIEI
MNMG_SOLUE       KDSER-RAIPHGFEYRGIPGLSREIQDKLDKVRPGTLGQAGRVPGVTPAAIAVLDCYLSL
MNMG_MAGMM       EKYRS-HVLPKEIDWSKVASLSSEVRLRLEKSDCRTVADVIATKGVTPASVVNILIYLGL
MNMG_CAMJE       KNLSE-LKIPENFDFKSVSGLSNEVVEKLNHHKPPTIFAASQISGITPAALDILQIYIKM
MNMG_CAMJJ       KNLSE-LKIPENFDFKSVSGLSNEVVEKLNHHKPPTIFAASQISGITPAALDILQIYIKM
MNMG_CAMJR       KNLSE-LKIPENFDFKSVSGLSNEVVEKLNHHKPPTIFAASQISGITPAALDILQIYIKM
MNMG_CAMJ8       KNLSE-LKIPENFDFKSVSGLSNEVVEKLNHHKPPTIFAASQISGITPAALDILQIYIKM
MNMG_CAMJD       KNLSE-LKIPENFDFKSVSGLSNEVVEKLNHHKPPTIFAASQISGITPAALDILQIYIKM
MNMG_CAMC1       KDMMD-VKIPENFDFRSISGLSNEVVEKLEKFAPPTLFAASEISGITPAAIDILHIYIKM
MNMG_CAMC5       KDMMS-VKIPENFSFRGISGLSNEVVEKLEKFAPPTLFAASEISGITPAAIDILHIYIKM
MNMG_CAMFF       KGLLD-IKIPKSLEFKSISGLSNEVVEKLNKFAPPTLAAASNISGITPVAIDILHIAIKY
MNMG_CAMHC       KNMLN-TKIPTELDFSKISGLSNEIIEKLNKFNPPTLFAASEISGVTPAAIDILHIYIKQ
MNMG_NITSB       HELMN-VKIPEDLDIDAISGLSNEVKEKLKAHKPPTLFAASQISGITPAAIEILHIYIKM
MNMG_SULDN       KKYLK-VEIPQNFAFRSISGLSKEIVEKLESFNPPTLQAASQISGITPAAIEILHIYIKI
MNMG_ARCB4       KKMLK-ATIPESFSYKGLPGLSNEVVEKLEKHRPPTIFNASLISGVTPAALDIIHLNLNI
MNMG_SULNB       KDMLK-IKIPEDFTYKNVSGLSNEIVEKLEKANPTTLFAASEISGVTPAALEIIHVYIKM
MNMG_HELPY       DSMLK-VSIPKGFVFKGIPGLSLEAVEKLEKFRPKSLFEASEISGITPANLDVLHLYIHL
MNMG_HELPH       DSMLK-VSIPKDFVFKGIPGLSLEAVEKLEKFRPKSLFEASEISGITPANLDVLHLYIHL
MNMG_HELPJ       DSMLK-VSIPKHFVFKGIPGLSLEAVEKLEKFRPKSLFEASEISGITPANLDVLHLYIHL
MNMG_HELAH       DSMLK-VSIPKDFVFKGIPGLSLEAVEKLEKFRPKSLFEASEISGITPANLDVLHLYIHL
MNMG_HELHP       RQMLQ-VEIPRDFIFDNIPGLSLEVIEKLKKFTPKSLFEANEISGITPASIDVLHLYIHL
MNMG_WOLSU       QEMLK-VKIPEGFIFDTVPGLSLEVIEKLKRFNPPTLFAASEISGITPASLDVLHLYIHL
MNMG_LEPIN       NKYLD-LAIPEDINYEMIAGLKKEAIQKLKSHKPMTLEKASQISGVDPSDVDLILYHIKG
MNMG_LEPIC       NKYLD-LAIPEDINYEMIAGLKKEAIQKLKSHKPMTLEKASQISGVDPSDVDLILYHIKG
MNMG_LEPBJ       NKYLD-LAIPEDINYESIAGLKKEAIQKLKTHKPMTLEKAGQISGVDPSDVDLLLYHIKG
MNMG_LEPBL       NKYLD-LAIPEDINYESIAGLKKEAIQKLKTHKPMTLEKAGQISGVDPSDVDLLLYHIKG
MNMG_LEPBA       KKFLN-FQIPIDFDYASVKGLKTEAIVKLEKHRPLNLENALHISGVDPSDVDLLLYHLVD
MNMG_LEPBP       KKFLN-FQIPIDFDYASVKGLKTEAIVKLEKHRPLNLENALHISGVDPSDVDLLLYHLVD
MNMG_GEOMG       RKLEG-TRVPAGFDYGALPGLSAEVREKLAKFRPDTLGQASRIQGVTPAAVGILSLALKA
MNMG_GEOSL       RKLEG-TRIPDDLDYTVIPGLSAEVREKLLRFLPDTLGQASRIQGVTPAAVGILSVAIKS
MNMG_GEOUR       RKLES-AKIPGDLEYAGLPGLSAEVREKLQQFRPDTLGQASRIPGVTPAAITILSIALKA
MNMG_PELPD       AKLEN-TPLPTDMDYAAINGLTTEVKEKLTKVRPDTLGQASRIPGVTPAAVSVLSIALKA
MNMG_PELCD       RRSEQ-IAIPSDMDYSPIEGLSIEVREKLQKVRPQNLGQAARIPGVTPAAVAILSVLLRR
MNMG_DESPS       KRMET-LKLPEDLNYAQLSGLSNEVVEKLSTIRPISLGQASRISGITPAAVSVLQVHLRK
MNMG_DESVH       ARMED-TVLPEDMDYTVIPGLTREIVEKLGKVRPHTLGQAARISGVTPAALTCLEIQLRK
MNMG_DESVV       ARMED-TVLPEDMDYTVIPGLTREIVEKLGKVRPHTLGQAARISGVTPAALTCLEIQLRK
MNMG_DESAG       ARHES-VVISEAADYAAVHGLTREAVEKLSKVRPRTLGQAARISGITPAALSCIEVYLKK
MNMG_LAWIP       AKLEH-SYLPKEIDYTKVAGLSSEVIEKLQIVRPQTLGQAGRISGVTPAAITCLEIYLKK
MNMG_SYNFM       RQLEQ-AAIPEDLMYDDIPGLSNELRQKLGAVRPLSLGQATRIPGMTPAAVSVLMVHLRR
MNMG_SYNAS       KALES-RRIPPGMDYSAIPGLSNELRMKLARVEPETIGQARRITGMTQAALAAVMIMIKK
MNMG_CHLTE       ARLDS-LHIPDNFNYDSLNSLSSEGREKLLKHRPATIGQASRILGVSPSDVSILMIRLGR
MNMG_CHLCH       QRLEA-HHIPALLDYHAIAGLSNEGREKLKKHRPENIGQASRILGVSPSDISILMVHLGR
MNMG_CHLPM       ARLES-LILPETFNYHSVTGLSSEGREKLLHFRPETLGQASRIMGVSPSDISVLMVRLGR
MNMG_CHLL3       ARLDA-LQIPSEYNYSCIKGLSSEGVEKLISHRPETLGQASRISGVSPSDISVLMVHIGR
MNMG_CHLPD       ARLES-HSIPGSFSYATVSGLSNEGREKLTLHKPETIGQASRIPGVSPSDISVLLIKIGR
MNMG_BACFR       ARLES-IKIKGKFDYDSLQSLSTEARQKLKKIDPETIAQASRIPGVSPSDINVLLVLSGR
MNMG_BACFN       ARLES-IKIKGKFDYDSLQSLSTEARQKLKKIDPETIAQASRIPGVSPSDINVLLVLSGR
MNMG_BACTN       ARLES-IKIKGKFDYASIQSLSTEARQKLVKIDPETIAQASRIPGVSPSDINVLLVLSGR
MNMG_PHOV8       HRLEA-IRIKGKFDYNSLNSLSTEARQKLMKIDPETLAQASRIPGISPSDINVLLVLLGR
MNMG_PARD8       NRLEN-IRIKGKFDYNSIQSLSTEARQKLTRIDPDTIAQASRIPGISPSDINILLVLLGR
MNMG_PORGI       NRLES-IRLPQHVDYMQMQSLSTEARQKLTSIRPETIAQASRIPGVSPHDVSILLVLCGR
MNMG_FLAJ1       NRLEE-VKIPENFDYNKIKSMSIEAKQKLSKIRPVTISQASRISGVSPSDISVLLIYMGR
MNMG_FLAPJ       TRLED-LKIPEKFDYHQIKSMSIEAKQKLSKIRPVTISQASRISGVSPSDISVLLVFLGR
MNMG_GRAFK       NRLED-MKIPKNFDYSNIKSMSYEAREKLKKVQPATVSQASRISGVSPNDISVLLVYMGR
MNMG_CYTH3       TQLEN-MALNPDFDYKKIQALSLEAREKLSKLKPATLGQASRISGVNPADISILMIYMGR
MNMG_SULMW       YRLET-IRIPNDFDYNQVKSISIEAREKLLNYKPNSIGEASRISGVSPSDIRILILFLIK
MNMG_SALRD       EEKER-WPIPDDFDYHALDNISIEARQKLSKVEPDNLGQASRVPGVRASDISVLMVLLKN
MNMG_BORAP       HNLEL-VKLPFDFNYGIIEGLSREAREKFSKVQPATLAQASRIPGIRNTDITVLFIYFSN
MNMG_BORBP       NNLEL-VKLPFDFNYEIIEGLSREAREKFSKVQPATLAQASRIPGIRNTDITVLFIYFSN
MNMG_BORBU       DNLEL-VKLPFDFNYEIIEGLSREAREKFSKIQPATLAQASRIPGIRSTDITVLLIYFSN
MNMG_TREDE       KRMEN-TKIPADFDYDAVSGLSTESRTRLKEVRPETIGQASRIRGIRPSDIMLLSILL--
MNMG_TREPA       EKMEG-IKIPAHFDYARISGLSVESRTRLEHVRPDTIGQVGRMRGIRPSDVMLLLAHLKR
MNMG1_FUSNN      KKLEH-MYIPENINYDEIKGISNIARAGLDEVRPLSIGEATRISGVTSNDITLIIAYMNI
MNMG2_FUSNN      KSMEN-KKIPVDIDYDDLKTIPKEAKDKLKRIKPINIGQASRISGVSPADIQAILIYLKM
MNMG_ENDTX       KKSKD-RKIPEDFDYNKLKSLSAETKQRLFEVRPQTIGQASRICAIKPSDIAILTVYLEK
MNMG_ONYPE       ARLEQ-KKIPSKINYADIKNLSKEAQEKLDLIKPQTLGQATRILGVNQVDISILLVYLEK
MNMG_AYWBP       ARLEQ-KKIPSKINYADIKNLSKEAKEKLDLIKPQTLGQATRILGVNQVDISILLVYLEK
MNMG_ACHLI       LRYES-RFIPNDINYHSIHNISAEAKEKLSKIKPETLGQATRILGVGPTDVSMLLVYLEA
MNMG_MYCCT       VKLER-KKIPLDINYSKVDNLATEAKDKLEKIRPLNIGQASRITGVNPADIQMLLFYLKK
MNMG_MYCMS       VKLER-KKIPLDINYSKVDNLATEAKDKLEKIRPLNIGQASRITGVNPADIQMLLFYLKK
MNMG_MESFL       VKLEK-KKIPSDIDYDKVENLATEARQKLKKVKPLNIGQASRITGVNPADIQMLLFYLKN
MNMG_MYCGE       DKLSK-IKIPHTFDYHKVKNLASEAIFKLSNFKPSNLAIASQIAGVNFNDIIAIKHFLKT
MNMG_MYCPN       NNLSS-VKIPLKLNYHKVPNLASEAIVKLSKIRPTDLSVASQVAGINFNDILAIKHFLDN
MNMG_MYCGA       KNLES-IKIPKDLIYDKVQNLSIEAIDKLNKIKPLNLAQAQRISGINLADIISLKTHLEQ
MNMG_UREPA       KRLNN-IKLHAIVDYKEVPNISLETIDKLNKIKPLDLEQASRISGVNLTDIAMIKYYLER
MNMG_UREP2       KRLNN-IKLHAIVDYKEVPNISLETIDKLNKIKPLDLEQASRISGVNLTDIAMIKYYLER
MNMG_MYCPE       KNIDN-IKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLEN
MNMG_MYCH7       IRLEK-LLIPGDLNYEKVANLSSEALDKFQKVRPKTIGEASRISGVNPADIQMLLFHIKV
MNMG_MYCHJ       IRLEK-LLIPGDLNYEKVANLSSEALDKFQKVRPKTIGEASRISGVNPADIQMLLFHIKV
MNMG_MYCH2       IRLEK-LLIPGELNYEKVANLSSEALDKFQKVRPKTIGEASRISGVNPADIQMLLFHIKV
MNMG_MYCPU       ERLEN-LKIPEKIDYSQILNLANEAREKFNKIRPQTIGQASRISGINPADIQMLLFYLDL
MNMG_MYCS5       KNLEK-IKIPNNINYDKVLNLASEAKDKLKIIKPETIAQAYRISGINPSDIQMLIFHLKT
MNMG_MYCMO       LRLEN-LKLPEDLNYDNVVNLAFEARQKLKMIKPLTIGQASRISGINPADIQMLMFHLNL
MNMG_MYCAP       VRLEN-LKIPEDLNYLDVKNIAIEARQKFEKIRPATIGQASRISGINPADIQMLMFHLES
MNMG_THEM4       EEYES-VDIS-KINLDKVPNLSTEAREKLKKVMPRSIGQAMRIPGVTPADIANIISYIEK
MNMG_FERNB       EEYEN-LPIV-NVIFSEVPNLSTEAREKLEKIKPLSIGQASRIPGVTPADILALLTYIKK
MNMG_THEMA       EKYEN-YEIPHDLDYDAVPNLSTEARDKLKKIRPRSIGQAMRIPGINPSDISNLIIYLDR
MNMG_THESQ       EKYEN-YEIPHDLDYDAVPNLSTEARDKLKKIRPRSIGQAMRIPGINPSDISNLIIYLDR
MNMG_THEP1       EKYEN-YEVPYDLDYDAVPNLSTEAKDKLKKIRPRSIGQAMRIPGINPSDISNLIIYLDK
MNMG_PETMO       KELEK-EKIPSDIEYDKINNIAYEAKEKLKKIKPETFGQLLRIPGINPADAINLRIYLKQ
MNMG_BDEBA       KRLEE-MLLPDDLAYAEIRGLSNEEKDKLLRVKPRTLGQAQRISGVNPSAIQAIMIHLKG
MNMG_ALKMQ       KKLEN-KILPQEIDYHGIDGLRLEARQKLSDIQPMSVGQASRISGVSPSDISVLMIYLEQ
MNMG_ALKOO       KKLEN-KKLREDIDYNEIDGLRIEARQKLNAIRPLSVGQASRISGVSPADISVLLIYLEQ
MNMG_CLOD6       KKLEN-KKLDEKINYSSIEGLRLEARQKLDDIKPISIGQASRISGVSPADISVLLIYLEQ
MNMG_FINM2       KKLEN-RKLDMIEDYKEVMGLSNEAVQKLNDIKPESLGQASRISGVSPSDINVLLIYMET
MNMG_CALS8       KKLEN-KKIPEWVDYNQISGLSTEAKQKLSQIRPASIGQASRISGVSPADISVLLIWLEQ
MNMG_ACET2       KKLEE-RKLDKDINYDEIKGLRLEARQKLNKIKPESVGQASRISGVSPADISVLLVYLEQ
MNMG1_CALS4      KAMEN-KKIPEDIDYYQISGLSNEAKEKLSKIRPTSVGQASRISGVSPADISVLLIYLQQ
MNMG2_CALS4      KAMEN-KKIPEDIDYYQVHGLSNEAKEKLSKIRPTSVGQASRISGVSPADISVLLIYLQQ
MNMG_THEP3       KALEN-KKIPEDIDYYQIHGLSNEAKEKLTKIRPTSIGQASRISGVSPADISVLLIYMQQ
MNMG_THEPX       KALEN-KKIPEDIDYYQIHGLSNEAKEKLTKIRPTSIGQASRISGVSPADISVLLIYMQQ
MNMG_CLOB1       KKYED-RLIPKSINYLDIKGLRLEAIQKLEKIKPINIGQASRISGVSPADISVLLIYMER
MNMG_CLOBH       KKYED-RLIPKSINYLDIKGLRLEAIQKLEKIKPINIGQASRISGVSPADISVLLIYMER
MNMG_CLOBL       KKYED-RLIPKSINYLDIKGLRLEAIQKLEKIKPINIGQASRISGVSPADISVLLIYMER
MNMG_CLOBK       KKYED-RLIPKSINYLDIKGLRLEAIQKLEKIKPINIGQASRISGVSPADISVLLIYMER
MNMG_CLOBM       KKYEN-RLIPKSINYSDIKGLRIEAIQKLEKIKPINIGQASRISGVSPADISVLLIYMER
MNMG_CLONN       KKLEN-RLIPKEFDYKLVKGLRTEAIQKLDKIKPVNIGQASRISGVSPADISVLLIVLEQ
MNMG_CLOAB       KKFEK-RVIPEDIDYNSIKNLRTEAIQKLSKLRPVNLGQASRISGVSPSDISVLMIYLDY
MNMG_CLOTE       KKFEN-KLLPNDIDYSKVYGLRIESVQKLSKIRPMNIGQASRISGVSPADISVLLIYLEH
MNMG_CLOK5       KKFEN-KFIPENIDYDEIKGLRIEANQKLKKIRPISIGQASRISGVSPADISVLLVYLEK
MNMG_CLOP1       KKFEK-KVLPEDLDYNDVNSLRIEAIQKLNKIRPLNIGQASRISGVSPADISVLLIFLEH
MNMG_CLOPS       KKFEK-KVLPEDLDYNDVNSLRIEAIQKLNKIRPLNIGQASRISGVSPADISVLLIFLEH
MNMG_CLOPE       KKFEK-KVLPEDLDYNDVNSLRIEAIQKLNKIRPLNIGQASRISGVSPADISVLLIFLEH
MNMG_CLOB8       KKFEK-KLLPKDINYSDIKGLRTEAIQKLSDIRPISIGQATRISGVSPADISVLLIYLEH
MNMG_LACP7       KKLEG-KKIPEDLDYSDVPSLRIEAKQKLNQIKPSSVGQASRISGVSPADISVLLVYLEQ
MNMG_NATTJ       EKLEA-RLIPDDIDYSQISGLSIEAREKLQTYRPRSVGQANRISGIDPSDISVLMVYLEQ
MNMG_BACVZ       KKMEN-KKIPDRIDYDAIKGIATEARQKLKEVRPLSVAQASRISGVNPADISILLVYLEQ
MNMG_BACSU       KKMEN-KKIPDRIDYDAIKGIATEARQKLKNVRPLSVAQASRISGVNPADISILLVYLEQ
MNMG_BACLD       KKMEN-KKIPDRIDYDAIKGIATEARQKLKEVRPLSVAQASRISGVNPADISILLVYLEQ
MNMG_BACP2       KKMEN-KKIPDRIDYDAIKGIATEAKQKLKEVRPLSVAQASRISGVNPADISILLVYLEQ
MNMG_BACAH       KKMEN-KKIPVDIDYDAISSLASEARQKLKDVRPLSMGQASRISGVNPADISILLVYIEQ
MNMG_BACHK       KKMEN-KKIPVDIDYDAISSLASEARQKLKDVRPLSMGQASRISGVNPADISILLVYIEQ
MNMG_BACAN       KKMEN-KKIPVDIDYDAISSLASEARQKLKDVRPLSMGQASRISGVNPADISILLVYIEQ
MNMG_BACCZ       KKMEN-KKIPVDIDYDAISSLASEARQKLKDVRPLSMGQASRISGVNPADISILLVYIEQ
MNMG_BACC1       KKMES-KKIPVDIDYDAISSLASEARQKLKDVRPLSVGQASRISGVNPADISILLVYIEQ
MNMG_BACCR       KKMES-KKIPVDIDYDAISSLASEARQKLKDVRPLSMGQASRISGVNPADISILLVYIEQ
MNMG_BACMK       KKMEN-KKIPVDIDYDAISSLASEARQKLKDVRPLSMGQASRISGVNPADVSILLIYIEQ
MNMG_BACCN       KKMES-KKIPVDIDYDAISGIASEARQKLKEVRPLSVGQASRISGVNPADISILLVYIEQ
MNMG_GEOKA       KKMEN-KKIPEDIDYDAIQGLATEARQKLKQVRPLSIAQASRISGVNPADISILLVYLEQ
MNMG_GEOTN       KKMEN-KKIPEDIDYDAIQGLATEARQKLKQVRPLSIAQASRISGVNPADISILLVYLEQ
MNMG_LYSSC       HKMEN-KKIPENIDYDAISGLATEARQKLKQVTPLSIAQASRISGVNPADISILLVYIEQ
MNMG_STAA2       KRMEE-KKIPEDLDYSKIDSLATEAREKLSEVKPLNIAQASRISGVNPADISILLIYLEQ
MNMG_STAA9       KRMEE-KKIPEDLDYSKIDSLATEAREKLSEVKPLNIAQASRISGVNPADISILLIYLEQ
MNMG_STAAR       KRMEE-KKIPEDLDYSKIDSLATEAREKLSEVKPLNIAQASRISGVNPADISILLIYLEQ
MNMG_STAAS       KRMEE-KKIPEDLDYSKIDSLATEAREKLSEVKPLNIAQASRISGVNPADISILLIYLEQ
MNMG_STAA1       KRMEE-KKIPEDLDYSKIDSLATEAREKLSEVKPLNIAQASRISGVNPADISILLIYLEQ
MNMG_STAAM       KRMEE-KKIPEDLDYSKIDSLATEAREKLSEVKPLNIAQASRISGVNPADISILLIYLEQ
MNMG_STAAW       KRMEE-KKIPEDLDYSKIDSLATEAREKLSEVKPLNIAQASRISGVNPADISILLIYLEQ
MNMG_STAAN       KRMEE-KKIPEDLDYSKIDSLATEAREKLSEVKPLNIAQASRISGVNPADISILLIYLEQ
MNMG_STAAB       KRMEE-KKIPEDLDYSKIDSLATEAREKLSEVKPLNIAQASRISGVNPADISILLIYLEQ
MNMG_STAA8       KRMEE-KKIPEDLDYSKIDSLATEAREKLSEVKPLNIAQASRISGVNPADISILLIYLEQ
MNMG_STAA3       KRMEE-KKIPEDLDYSKIDSLATEAREKLSEVKPLNIAQASRISGVNPADISILLIYLEQ
MNMG_STAAC       KRMEE-KKIPEDLDYSKIDSLATEAREKLSEVKPLNIAQASRISGVNPADISILLIYLEQ
MNMG_STAAE       KRMEE-KKIPEDLDYSKIDSLATEAREKLSEVKPLNIAQASRISGVNPADISILLIYLEQ
MNMG_STAAT       KRMEE-KKIPEDLDYSKIDSLATEAREKLSEVKPLNIAQASRISGVNPADISILLIYLEQ
MNMG_STAES       KRMEA-KKIPEDLDYSKVDSLASEAREKLAEVKPLNIAQASRISGVNPADISILLVYLEQ
MNMG_STAEQ       KRMEA-KKIPEDLDYSKVDSLASEAREKLAEVKPLNIAQASRISGVNPADISILLVYLEQ
MNMG_STAHJ       KRMEE-KKIPEDLDYSKVDSLATEAREKLAEVKPLNIAQASRISGVNPADISILLVYLEQ
MNMG_STAS1       KRMEE-KKIPEDLDYSKVDSLATEAREKLAEVKPLNIAQASRISGVNPADISILLVYLEQ
MNMG_LISMO       KRMED-KKIPENIDYDAISGLATEALEKLKKIEPLSIAQASRISGVNPADISILLVYIEQ
MNMG_LISMF       KRMED-KKIPENIDYDAISGLATEALEKLKKIEPLSIAQASRISGVNPADISILLVYIEQ
MNMG_LISIN       KRMED-KKIPENIDYDAISGLATEALEKLKKIEPLSIAQASRISGVNPADISILLVYIEQ
MNMG_LISW6       KRMED-KKIPENIDYDAISGLATEALEKLKKIEPLSIAQASRISGVNPADISILLVYIEQ
MNMG_OCEIH       LKMED-KKIPEDIDYDAINGIATEAVEKLKKVRPLSVGQASRISGVNPADVSILLVYIEQ
MNMG_BACSK       KKMEQ-KRIPEDLDYDAIQGIATEARQKLKQVRPLSVGQASRVSGVNPADISILLVYLEQ
MNMG_ALKHC       KKMND-KKIPEDLDYDAINGLATEAKQKLSEVRPLSVGQASRVSGVNPSDISILLVYLEQ
MNMG_EXIS2       MRMEK-KRIPERLDYDVISGLAIEAKQKLNQVRPLSIGQASRISGVNPSDISILLVYIEQ
MNMG_LEVBA       KRMEA-KAIPAQIDYDAIDGLATEAHQKLKKIQPETLAQASRISGVNPADIAILSVYIEQ
MNMG_LACPL       KKMEA-KKIPDRIDYDAIDGLATEAHQKLKKIQPTTIAQASRISGVNPADIAILSVYIQQ
MNMG_PEDPA       KRMEE-KAIPDRIDYEAINGLATEGRQKLEKIRPTTIAQASRISGVTPADIAILSVYIQQ
MNMG_LACS1       KRMEA-KKIPARIDYSRIEGIATEAQQKLAKIQPETLAQAGRISGVNPADLSILAVYIEQ
MNMG_ENTFA       KRMEA-KRIPENIDYQAINGLATEAKQKLQKIQPETIAQASRISGVNPADISILMVYIEQ
MNMG_LACSS       KRMEA-KKIPANIDYDAIEGLATEGRQKLQKIQPETLAQASRIGGVNPADIGILSVYIQQ
MNMG_LACP3       KRLEG-KKIPLRINYAAINGLATEARQKLVKIQPETIAQASRISGVNPADVAILSVYIEQ
MNMG_LACAC       KRQEA-KKIPADIDYNMIEGLATEARQKFEKIRPETLAQAERISGVNPADLAILSVYIQN
MNMG_LACH4       KRQEA-KKIPADIDYEMIEGLATEARQKFEKIRPETLAQAERISGVNPADLAILSVYIQN
MNMG_LACJO       HRLES-KKIPVDIDYNAIPSLATEARQKFEKIRPESIAQAERISGVNPADLAILTAYIQQ
MNMG_LACGA       HRLES-KKIPVDIDYNAIPSLATEARQKFEKIRPESIAQAERISGVNPADLAILTAYIQQ
MNMG_LACDA       RRQEA-KKIPKDIDYDQIEGLATEAREKLAKIRPETLAQAERISGVNPADLAILSVYVQN
MNMG_LACDB       RRQEA-KKIPKDIDYDQIEGLATEAREKLAKIRPETLAQAERISGVNPADLAILSVYVQN
MNMG_LACLM       HRLEA-KRIPKNMDWDKLDSIATEARQKFKKINPETLGQASRISGVNPADISILMVYLEG
MNMG_LACLS       HRLEA-KRIPKNMDWDKLDSIATEARQKFKKINPETLGQASRISGVNPADISILMVYLEG
MNMG_LACLA       HRLEA-KRIPKNMDWDKLDSIATEARQKFKKINPETLGQASRISGVNPADISILMVYLEG
MNMG_STRA3       KRMEE-KRIPPHIDWDDIDSIATEARQKFKKINPETLGQASRISGVNPADISILMVYLEG
MNMG_STRA5       KRMEE-KRIPPHIDWDDIDSIATEARQKFKKINPETLGQASRISGVNPADISILMVYLEG
MNMG_STRA1       KRMEE-KRIPPHIDWDDIDSIATEARQKFKKINPETLGQASRISGVNPADISILMVYLEG
MNMG_STRP1       KRMEE-KRIPTNIDWDAIDSIATEARQKFKKINPETIGQASRISGVNPADISILMIYLEG
MNMG_STRPD       KRMEE-KRIPANIDWDAIDSIATEARQKFKKINPETIGQASRISGVNPADISILMIYLEG
MNMG_STRPB       KRMEE-KRIPANIDWDAIDSIATEARQKFKKINPETIGQASRISGVNPADISILMIYLEG
MNMG_STRPC       KRMEE-KRIPANIDWDAIDSIATEARQKFKKINPETIGQASRISGVNPADISILMIYLEG
MNMG_STRPG       KRMEE-KRIPANIDWDAIDSIATEARQKFKKINPETIGQASRISGVNPADISILMIYLEG
MNMG_STRP8       KRMEE-KRIPANIDWDAIDSIATEARQKFKKINPETIGQASRISGVNPADISILMIYLEG
MNMG_STRPF       KRMEE-KRIPANIDWDAIDSIATEARQKFKKINPETIGQASRISGVNPADISILMIYLEG
MNMG_STRPM       KRMEE-KRIPANIDWDAIDSIATEARQKFKKINPETIGQASRISGVNPADISILMIYLEG
MNMG_STRP3       KRMEE-KRIPANIDWDAIDSIATEARQKFKKINPETIGQASRISGVNPADISILMIYLEG
MNMG_STRP6       KRMEE-KRIPANIDWDAIDSIATEARQKFKKINPETIGQASRISGVNPADISILMIYLEG
MNMG_STRT2       KRMEE-KKIPENIDWDAIDSIATEARQKFKKINPETIGQASRISGVNPADISILMVYLEG
MNMG_STRT1       KRMEE-KKIPENIDWDAIDSIATEARQKFKKINPETIGQASRISGVNPADISILMVYLEG
MNMG_STRTD       KRMEE-KKIPENIDWDAIDSIATEARQKFKKINPETIGQASRISGVNPADISILMVYLEG
MNMG_STRMU       KRMEE-KRIPKNIDWDAIDSIATEARQKFKKINPETIGQASRISGVNPADISILMVYLEG
MNMG_STRGC       KRMEE-KRIPANIDWDDIDSIATEARQKFKKINPETIGQASRISGVNPADISILMVYLEG
MNMG_STRSV       KRMEE-KRIPANIDWDDIDSIATEARQKFKKINPETIGQASRISGVNPADISILMVYLEG
MNMG_STRR6       KRMEE-KRIPANIDWDDIDSIATEARQKFKLINPETIGQASRISGVNPADISILMVYLEG
MNMG_STRP2       KRMEE-KRIPANIDWDDIDSIATEARQKFKLINPETIGQASRISGVNPADISILMVYLEG
MNMG_STRPN       KRMEE-KRIPANIDWDDIDSIATEARQKFKLINPETIGQASRISGVNPADISILMVYLEG
MNMG_STRPI       KRMEE-KRIPANIDWDDIDSIATEARQKFKLINPETIGQASRISGVNPADISILMVYLEG
MNMG_STRSY       KRMEE-KRIPADIDWDDIDSIATEARQKFKLISPETIGQASRISGVNPADISILMVYLEG
MNMG_STRS2       KRMEE-KRIPADIDWDDIDSIATEARQKFKLISPETIGQASRISGVNPADISILMVYLEG
MNMG_DESRM       EKLEG-RILNIDIDYEMIKGLSLEARQKLKKFKPTSIGQASRISGVSPADISVLLIWLEQ
MNMG_PELTS       RRLEE-KKIPQDIDYGRVRGLSVEAREKLEMIRPASIGQASRIAGVTPADVSVLLIYLER
MNMG_CARHZ       NKYEG-KKLPPDFDYSKVKGLSAEAVQKLNAIKPENIGQASRVSGVTPADISVLLIYLES
MNMG_MOOTA       AKLEA-RVLPADLNYSEIRGLSRESIDHLERVKPRSLGQALRIPGVTPADISVLLVYLEQ
MNMG_HELMI       NKLEN-KRLPADLDYKRVHGLSNEGRQKLIARKPVSIGQASRISGVSPADISILLVYLEQ
MNMG_SYNWW       EKLEN-KMIPPDINYDEVYGLSQEAVQKLKIILPASVGQASRIAGVNPADINVLLIFLEK
MNMG_DESAP       EKLEA-RRIPADLDYSEVRGLSNEAAQKLAEIRPVSVGQAGRISGVSPADIAVLLVYLEK
MNMG_SYMTH       RRMEA-RRIPPTLDYQALTGLSMEAREKLSRIRPETLGQASRISGVSPADVAVLMVHLDR
MNMG_DESHY       AKMEE-RMIPEEIVYDQIKGLSTEGRQRLKEVAPANMGQATRITGVTPADISVLLVYLEQ
MNMG_ROSCS       RRMEA-RRIPPDFDFTALRGLRNEARQTLQRFRPATVGQAARLAGINPADVAILIVALER
MNMG_ROSS1       RRMES-RRIPPDFDFAALRGLRNEARQTLQRFRPATIGQAARLAGINPADIALLLVALER
MNMG_CHLAA       QKMEH-RRIPPDFDYTSLPGLRNEARQVLMRFRPATLGQAGRLAGINPADVAIILFALER
MNMG_DEIRA       AKARE-LSL-SGVNFAGITALSNEAREKLTRLQPQTVEQASRISGVRHADISALLVHLKG
MNMG_DEIGD       DRARE-LSL-RGVAFGEIASLSNEAREKLERVRPLTVAQAAGIPGVRHADISALLVHLRR
MNMG_THET2       RDLEA-FRIPEGMDFPKVPGLSREAAEKLSRHRPKSLAEAARIPGVRDSDLTALAVHLRR
MNMG_THET8       KDLEA-FRIPEGMDFPKVPGLSREAAEKLSRHRPKSLAEAARIPGVRDSDLTALAVHLRR
MNMG_MYXXD       AESTDRWRIPEGYCFHEVRGLSSEAVEKLTAHRPGTVGQARRIPGLTPAAVSLLLVALKR
                         .        :  :       :               .:       :      

MNMG_NOSS1       RQSK-----------HQKGLAVLP--------------
MNMG_TRIV2       RQTK-----------HQTGLAALP--------------
MNMG_TRIEI       QYRQ-----------FQLTSANV---------------
MNMG_SYNY3       QLRR-----------SVSP-------------------
MNMG_SYNP2       QHRQ-----------KNAQEAVTS--------------
MNMG_MICAN       RQMS-----------AVKS-------------------
MNMG_ACAM1       LARL-----------SPVS-------------------
MNMG_SYNP6       QERQ-----------RSQVETALVR-------------
MNMG_SYNE7       QERQ-----------RSQVETALVR-------------
MNMG_THEEB       QQQR-----------QSLTAVGG---------------
MNMG_SYNJB       RQRQ-----------RAADPVCSSL-------------
MNMG_SYNJA       RQRQ-----------KTAAAAPVGA-------------
MNMG_PROM1       EKMK-----------KVKRKDSLQITN-----------
MNMG_PROMT       EKMK-----------KVKRKDSLQITN-----------
MNMG_PROMA       QNRKSHAAKIRNNEAKIKLHSNLGVDF-----------
MNMG_PROM3       QKRR-----------TLAASGHDR--------------
MNMG_PROMM       QKRR-----------TLAASGHDR--------------
MNMG_SYNSC       QQRERQ---------PLAPTAEAR--------------
MNMG_SYNPX       RKRE-----------ALAPPAEAR--------------
MNMG_SYNS9       QKRQ-----------PLAPTTQAR--------------
MNMG_SYNPW       QQRRSQPSAS-----HLAPTGQAR--------------
MNMG_SYNS3       QKRRSQKSE------SLASSTNSR--------------
MNMG_SYNR3       QDRQ------------AATTTLARP-------------
MNMG_PROMS       REIKKE---------KANIFVEKKLSS-----------
MNMG_PROM0       REIKKE---------KANIFIEKKLSSKKHSV------
MNMG_PROM9       REIKKE---------KANIFVKKSYHLKSNPSEH----
MNMG_PROM2       REINKE---------KTNIFCQKKLSS-----------
MNMG_PROM5       KEIKKE---------KTNSFVEKKLSS-----------
MNMG_PROMP       KELKNE---------KKTSFAEKKLSS-----------
MNMG_CHLTR       DAH-----------------------------------
MNMG_CHLTA       DAH-----------------------------------
MNMG_CHLT2       DAH-----------------------------------
MNMG_CHLTB       DAH-----------------------------------
MNMG_CHLMU       DAY-----------------------------------
MNMG_CHLAB       HAHQ----------------------------------
MNMG_CHLCV       HAHQ----------------------------------
MNMG_CHLFF       HAHK----------------------------------
MNMG_CHLPN       HAHH----------------------------------
MNMG_PARUW       YQEPIEKERLTSDCSEA---------------------
MNMG_RHOBA       NSLSQTKSSASVDKRASSDNESSRPTSSASDSL-----
MNMG_OPITP       GKTPSLPDTATTDGRDVP--------------------
MNMG_AQUAE       LD------------------------------------
MNMG_ECOLI       QGMLRRSA------------------------------
MNMG_ECOL6       QGMLRRSA------------------------------
MNMG_ECO24       QGMLRRSA------------------------------
MNMG_ECODH       QGMLRRSA------------------------------
MNMG_ECOL5       QGMLRRSA------------------------------
MNMG_ECOHS       QGMLRRSA------------------------------
MNMG_ECOLC       QGMLRRSA------------------------------
MNMG_SHIBS       QGMLRRSA------------------------------
MNMG_SHISS       QGMLRRSA------------------------------
MNMG_ECOUT       QGMLRRSA------------------------------
MNMG_ECOK1       QGMLRRSA------------------------------
MNMG_ECOSM       QGMLRRSA------------------------------
MNMG_ECO57       QGMLRRSA------------------------------
MNMG_SHIDS       QGMLRRSA------------------------------
MNMG_SHIFL       QGMLRRSA------------------------------
MNMG_SHIF8       QGMLRRSA------------------------------
MNMG_SALCH       QGMLRRSA------------------------------
MNMG_SALTY       QGMLRRSA------------------------------
MNMG_SALPB       QGMLRRSA------------------------------
MNMG_SALPA       QGMLRRSA------------------------------
MNMG_SALTI       QGMLRRSA------------------------------
MNMG_CITK8       QGMLRRSA------------------------------
MNMG_SALAR       QGMLRRSA------------------------------
MNMG_ENT38       QGMLRRSA------------------------------
MNMG_KLEP7       QGMLRRSA------------------------------
MNMG_CROS8       QGLLRRSA------------------------------
MNMG_PECAS       QGLLRRSA------------------------------
MNMG_YERPE       QGLLRRSA------------------------------
MNMG_YERPY       QGLLRRSA------------------------------
MNMG_YERPA       QGLLRRSA------------------------------
MNMG_YERPN       QGLLRRSA------------------------------
MNMG_YERPP       QGLLRRSA------------------------------
MNMG_YERPS       QGLLRRSA------------------------------
MNMG_YERP3       QGLLRRSA------------------------------
MNMG_YERE8       QGLLRRSA------------------------------
MNMG_SERP5       QGLLRRSA------------------------------
MNMG_PHOLL       QGLLRRSS------------------------------
MNMG_SODGM       QGLRHRSP------------------------------
MNMG_VIBCH       HGMLKKGEAA----------------------------
MNMG_VIBC3       HGMLKKGEAA----------------------------
MNMG_VIBCB       HGLLKKGEEE----------------------------
MNMG_VIBPA       HGLLKKGEEE----------------------------
MNMG_VIBVU       IGMLKVGEENA---------------------------
MNMG_VIBVY       IGMLKVGEENA---------------------------
MNMG_ALIF1       HGLLKKGE------------------------------
MNMG_PHOPR       HGMLKKGE------------------------------
MNMG_AERHH       HGLLRKTA------------------------------
MNMG_AERS4       HGLLRKTA------------------------------
MNMG_COLP3       HGLLRKLA------------------------------
MNMG_PSEA6       HGLLRKTERKTA--------------------------
MNMG_IDILO       QGLLRKSA------------------------------
MNMG_PSET1       QGLLRKSA------------------------------
MNMG_SHEB5       RGLLRKSA------------------------------
MNMG_SHEB8       RGLLRKSA------------------------------
MNMG_SHEB9       RGLLRKSA------------------------------
MNMG_SHEPC       RGLLRKSA------------------------------
MNMG_SHESW       RGLLRKSA------------------------------
MNMG_SHESM       RGLLRKSA------------------------------
MNMG_SHESR       RGLLRKSA------------------------------
MNMG_SHESA       RGLLRKSA------------------------------
MNMG_SHEON       RGLLRKSA------------------------------
MNMG_SHEDO       RGLLRKTA------------------------------
MNMG_SHEFN       RGLLRKIA------------------------------
MNMG_SHEHH       RGLLRKSA------------------------------
MNMG_SHEPA       RGLLRKSA------------------------------
MNMG_SHESH       RGLLRKNPSKS---------------------------
MNMG_SHEWM       RGLLRKKAS-----------------------------
MNMG_SHELP       RGLLRKSA------------------------------
MNMG_SHEAM       RGLLRKSA------------------------------
MNMG_PSYIN       NALRRKVL------------------------------
MNMG_ACTP2       QGMLKRGEL-----------------------------
MNMG_ACTPJ       QGMLKRGEL-----------------------------
MNMG_HAEDU       QGMLKRGEI-----------------------------
MNMG_HAEIN       QGMLKRGE------------------------------
MNMG_HAEIG       QGMLKRGE------------------------------
MNMG_HAEIE       QGMLKRGE------------------------------
MNMG_HAEI8       QGMLKRGE------------------------------
MNMG_HAES1       QGMLKRGE------------------------------
MNMG_HISS2       QGMLKRGE------------------------------
MNMG_MANSM       QGMLKRGE------------------------------
MNMG_PASMU       QGMLKRGE------------------------------
MNMG_ACTSZ       QGMLKRGE------------------------------
MNMG_HYDCU       LRKTSQSVG-----------------------------
MNMG_ACIAC       GGFRGFTAQQADEVAA----------------------
MNMG_ACISJ       GGFKGFAPQPADGVETVA--------------------
MNMG_VEREI       GGFKGFMSANADAQA-----------------------
MNMG_POLNA       NLWKNTTPLKSAEAEA----------------------
MNMG_POLSJ       NLWKNTVPLKTTDTSTEKAQA-----------------
MNMG_RHOFT       SNFKGFAAAGKVTAPSESGDVQQGVI------------
MNMG_LEPCP       GRFKGFTGNDKVAAGPISADAVNTDINDNPAHAATDAA
MNMG_METPP       GRHRGFGAD---AAEPGSAAA-----------------
MNMG_BURCA       RGLGRRNGT-AAEAAEQGDGAVPTQQ------------
MNMG_BURCH       RGLGRRNGT-AAEAAEQGDGAVPTQQ------------
MNMG_BURCC       RGLGRRNGK-AAEAAEQGGGAVPTQQ------------
MNMG_BURCM       RGLGRRNGT-AAEATEQGDGTVPTQQ------------
MNMG_BURA4       RGLGRRNGA-AAEATEQGDGTVPTQQ------------
MNMG_BURL3       RGLGRRNGT-AEAATEQGDGAVPTQQ------------
MNMG_BURVG       RGLGRRNGA-AAETTEQGGDTVPTQQ------------
MNMG_BURMA       RGLGRRKGADSVPGADVQADNTAAQQ------------
MNMG_BURM9       RGLGRRKGADSVPGADVQADNTAAQQ------------
MNMG_BURP0       RGLGRRKGADSVPGADVQADNTAAQQ------------
MNMG_BURM7       RGLGRRKGADSVPGADVQADNTAAQQ------------
MNMG_BURMS       RGLGRRKGADSVPGADVQADNTAAQQ------------
MNMG_BURP1       RGLGRRKGADSVPGADVQADNTAAQQ------------
MNMG_BURPS       RGLGRRKGADSVPGADVQADNTAAQQ------------
MNMG_BURP6       RGLGRRKGTDSVPGADVQADNTAAQQ------------
MNMG_BURTA       RGLGRRKGADSAPGADAETNSAATQQ------------
MNMG_PARXL       RGLGRR----PTKPAESGTDSAPVTQ------------
MNMG_CUPNH       KGLGRTRAESGAP--SGNSEEAA---------------
MNMG_CUPPJ       KGLGRTR--------SGNSQEAA---------------
MNMG_CUPMC       KGMGRAAAQTSATPVAGNGQEAA---------------
MNMG_RALSO       GVLRGKVG-------PRSEGEAA---------------
MNMG_JANMA       GGFKEFAALPPTSEAAA---------------------
MNMG_HERAR       GGFKEFAALPPNTEAAA---------------------
MNMG_BORBR       LHYGSRKQAA----------------------------
MNMG_BORPA       LHYGSRKQAA----------------------------
MNMG_BORPE       LHYGSRKQAA----------------------------
MNMG_BORPD       LHYGSRKQAA----------------------------
MNMG_BORA1       LHYGKRAI------------------------------
MNMG_AZOSB       RDLAARSERRSA--------------------------
MNMG_AROAE       RDLAAAAGADDTGLPATDGEGEAATRMRGV--------
MNMG_DECAR       HNLSQAA-------------------------------
MNMG_METFK       KSRKAGNTADQVA-------------------------
MNMG_THIDA       GFKPDEQKKSA---------------------------
MNMG_NITMU       GFSSANTKKSA---------------------------
MNMG_NEIG1       GFKDAK--------------------------------
MNMG_NEIMA       GFKDAK--------------------------------
MNMG_NEIMB       GFKDAK--------------------------------
MNMG_NEIM0       GFKDAK--------------------------------
MNMG_NEIMF       GFKDAK--------------------------------
MNMG_CHRVO       GFTDAKTA------------------------------
MNMG_POLAQ       GLGRTQETI-----------------------------
MNMG_ACIBT       NNMTKKTA------------------------------
MNMG_ACIBY       NNMTKKTA------------------------------
MNMG_ACIAD       NAQTKKIA------------------------------
MNMG_PSYA2       QKKVQAALNAS---------------------------
MNMG_PSYCK       QKKVKAALNAS---------------------------
MNMG_PSYWF       QKKAKAALDI----------------------------
MNMG_PSEAE       RASGRQLEQSA---------------------------
MNMG_PSEAB       RASGRQLEQSA---------------------------
MNMG_PSEA7       RASGRQLEQSA---------------------------
MNMG_PSEPU       RGAGRELEQSA---------------------------
MNMG_PSEPK       RGAGRELEQSA---------------------------
MNMG_PSEP1       RGAGRELEQSA---------------------------
MNMG_PSEPG       RGAGRELEQSA---------------------------
MNMG_PSEPW       RGAGRELEQSA---------------------------
MNMG_PSEE4       RGAGRELEQSA---------------------------
MNMG_PSEF5       RGAGRQLEQSA---------------------------
MNMG_PSEPF       RGAGRQLEQSA---------------------------
MNMG_PSE14       RGAGRQLEQSA---------------------------
MNMG_PSEU2       RGAGRQLEQSA---------------------------
MNMG_PSESM       RGAGRQLEQSA---------------------------
MNMG_PSEMY       RSAGQKLEQSA---------------------------
MNMG_PSEU5       RSAGQQLEQSA---------------------------
MNMG_ALCBS       HHHQKKAAQQA---------------------------
MNMG_HAHCH       RGSLQRKSA-----------------------------
MNMG_MARMS       R-AIARKSA-----------------------------
MNMG_SACD2       RGLLKNKAALA---------------------------
MNMG_CHRSD       RRLIEDQDVQAVNA------------------------
MNMG_MARHV       RDLLKKQSA-----------------------------
MNMG_ALKEH       QGLLRESA------------------------------
MNMG_NITOC       ARFLEETGV-----------------------------
MNMG_METCA       TGAA----------------------------------
MNMG_XANAC       ARRSQVA-------------------------------
MNMG_XANC5       ARRSQVA-------------------------------
MNMG_XANOR       ARRHRVA-------------------------------
MNMG_XANOM       ARRHRVA-------------------------------
MNMG_XANCP       ARRSQVA-------------------------------
MNMG_XANC8       ARRSQVA-------------------------------
MNMG_XANCB       ARRSQVA-------------------------------
MNMG_XYLFA       MRRNRVA-------------------------------
MNMG_XYLFT       MRRNRVA-------------------------------
MNMG_COXBU       KELYP---------------------------------
MNMG_COXBN       KELYP---------------------------------
MNMG_COXBR       KELYP---------------------------------
MNMG_LEGPC       SRLPV---------------------------------
MNMG_LEGPA       SRLPV---------------------------------
MNMG_LEGPL       SRLPV---------------------------------
MNMG_LEGPH       SRLPV---------------------------------
MNMG_NITEU       GMARQAVKREEMHESGKTVA------------------
MNMG_NITEC       GMARQAAKQEETHESGKTVA------------------
MNMG_FRATF       TGFIK---------------------------------
MNMG_FRATH       TGFIK---------------------------------
MNMG_FRATO       TGFIK---------------------------------
MNMG_FRATW       TGFIK---------------------------------
MNMG_FRATT       TGFIK---------------------------------
MNMG_FRAT1       TGFIK---------------------------------
MNMG_FRATN       TGFIK---------------------------------
MNMG_FRAP2       TGFIK---------------------------------
MNMG_VESOH       RIS-----------------------------------
MNMG_RUTMC       YQSK----------------------------------
MNMG_DICNV       HTQPLSNSEKGGDCVGEKL-------------------
MNMG_BLOFL       QGLLKKNVKCT---------------------------
MNMG_BLOPB       QGLLEHNTC-----------------------------
MNMG_BAUCH       NNLLANKINK----------------------------
MNMG_BUCAI       E-SYKHTL------------------------------
MNMG_BUCAP       E-YYKNHLS-----------------------------
MNMG_BUCBP       K-LYST--------------------------------
MNMG_WIGBR       NNLMYNK-------------------------------
MNMG_BUCCC       RKKKKFYFKK----------------------------
MNMG_HALHL       RGWLRTPTGGEDAA------------------------
MNMG_RHIME       QVRQAQRVGG----------------------------
MNMG_SINMW       EDRRSKRVGG----------------------------
MNMG_RHIEC       QQGFERQSADTRSESL----------------------
MNMG_RHIL3       LSSAERNSA-----------------------------
MNMG_AGRFC       GTATRSEQLRMHQ-------------------------
MNMG_BARHE       QRREKAKSA-----------------------------
MNMG_BARQU       QRREKAESA-----------------------------
MNMG_BART1       QRREKAKKA-----------------------------
MNMG_BARBK       QRREKGKLA-----------------------------
MNMG_BRUAB       FGGRQKLAAETLEGKGAA--------------------
MNMG_BRUA2       FGGRQKLAAETLEGKGAA--------------------
MNMG_BRUC2       FGGRQKLAAETLEGKGAA--------------------
MNMG_BRUSU       FGGRQKLAAETLEGKGAA--------------------
MNMG_BRUSI       FGGRQKLAAETLEGKGAA--------------------
MNMG_BRUME       FGGRQKLAAETLEGKGAA--------------------
MNMG_BRUO2       FGGRQKLAAETLEGKGAA--------------------
MNMG_BRUA4       FGYRQRAASELSEGQGAA--------------------
MNMG_RHILO       YENAQRDVA-----------------------------
MNMG_CHESB       -GEKIRGAA-----------------------------
MNMG_BRASB       EARRSKAMV-----------------------------
MNMG_BRASO       EARRNKAAS-----------------------------
MNMG_BRADU       EARKTSKAIA----------------------------
MNMG_NITHX       EARKKTATASA---------------------------
MNMG_NITWN       EARQRTAASA----------------------------
MNMG_RHOPS       EARKRPATVSGER-------------------------
MNMG_RHOP2       EARKRPAVVDGEG-------------------------
MNMG_RHOPA       EQRKRKSTG-----------------------------
MNMG_RHOP5       EARRRPATA-----------------------------
MNMG_RHOPB       DQRRKPAGSAAG--------------------------
MNMG_AZOC5       TGSKKDEVRTA---------------------------
MNMG_METPB       GRTQATA-------------------------------
MNMG_METRJ       GARAPSAPADRHPA------------------------
MNMG_METS4       ADAAAPAEA-----------------------------
MNMG_BEII9       AGAHA---------------------------------
MNMG_PARL1       KRSA----------------------------------
MNMG_RHORT       RERDSVEECFT---------------------------
MNMG_MAGSA       MVLDWAEGPVP---------------------------
MNMG_CAUVC       GRAA----------------------------------
MNMG_CAUSK       AKAA----------------------------------
MNMG_MARMM       RTQGAS--------------------------------
MNMG_HYPNA       VRKAG---------------------------------
MNMG_GLUOX       LS------------------------------------
MNMG_GLUDA       VA------------------------------------
MNMG_GRABC       KQCFT---------------------------------
MNMG_ACICJ       PRPLAA--------------------------------
MNMG_RUEPO       GDRARSA-------------------------------
MNMG_RUEST       LSRGESKAS-----------------------------
MNMG_ROSDO       SSKKRSA-------------------------------
MNMG_DINSH       AEKRRSA-------------------------------
MNMG_RHOS1       AGRDAAAV------------------------------
MNMG_CERS4       AGRDAAAV------------------------------
MNMG_CERS5       ASRSAAAG------------------------------
MNMG_PARDP       GNRRSA--------------------------------
MNMG_JANSC       TQRLSA--------------------------------
MNMG_NOVAD       RASAAVVA------------------------------
MNMG_ERYLH       RGRAAA--------------------------------
MNMG_SPHAL       RAA-----------------------------------
MNMG_SPHWW       LAA-----------------------------------
MNMG_ZYMMO       VTL-----------------------------------
MNMG_ANAMM       RGRASHQNS-----------------------------
MNMG_ANAPZ       KHKSSHKSL-----------------------------
MNMG_EHRCJ       HKNKKIS-------------------------------
MNMG_EHRCR       YKSKKTS-------------------------------
MNMG_EHRRG       HKNKKIL-------------------------------
MNMG_EHRRW       HKNKKIL-------------------------------
MNMG_WOLPM       RKTKVAASFA----------------------------
MNMG_WOLTR       RKTKVAANSA----------------------------
MNMG_NEOSM       LGAEGSQPFPKDLDQALRQLN-----------------
MNMG_RICRO       KYSDGSST------------------------------
MNMG_RICRS       KYSDGSST------------------------------
MNMG_RICCN       KYSDGSST------------------------------
MNMG_RICM5       KYSDGSST------------------------------
MNMG_RICFE       KYSDGSST------------------------------
MNMG_RICAH       KYSDGSFT------------------------------
MNMG_RICCK       KYNDGSFISNN---------------------------
MNMG_RICB8       KYNDRRST------------------------------
MNMG_RICBR       KYNDRRST------------------------------
MNMG_RICPR       KYSDESSK------------------------------
MNMG_RICTY       KYSDGSSK------------------------------
MNMG_ORITB       KYLNSSITDKK---------------------------
MNMG_PELUB       KSIKLIA-------------------------------
MNMG_KORVE       QGRKQKATT-----------------------------
MNMG_SOLUE       HIGPN---------------------------------
MNMG_MAGMM       K-------------------------------------
MNMG_CAMJE       QKKKA---------------------------------
MNMG_CAMJJ       QKKKA---------------------------------
MNMG_CAMJR       QKKKV---------------------------------
MNMG_CAMJ8       QKKKA---------------------------------
MNMG_CAMJD       QKKKA---------------------------------
MNMG_CAMC1       SEKKA---------------------------------
MNMG_CAMC5       SQR-----------------------------------
MNMG_CAMFF       HCQKTK--------------------------------
MNMG_CAMHC       FKGK----------------------------------
MNMG_NITSB       HQKRRVTK------------------------------
MNMG_SULDN       DIKNRNK-------------------------------
MNMG_ARCB4       FVTNTKK-------------------------------
MNMG_SULNB       SQKGKI--------------------------------
MNMG_HELPY       RKNS----------------------------------
MNMG_HELPH       RKNS----------------------------------
MNMG_HELPJ       RKNS----------------------------------
MNMG_HELAH       RKNS----------------------------------
MNMG_HELHP       HHKKKSQILV----------------------------
MNMG_WOLSU       RGKESVD-------------------------------
MNMG_LEPIN       KKKQEVEIF-----------------------------
MNMG_LEPIC       KKKQEVEIF-----------------------------
MNMG_LEPBJ       KRKQEAEAS-----------------------------
MNMG_LEPBL       KRKQEAEAS-----------------------------
MNMG_LEPBA       RH------------------------------------
MNMG_LEPBP       RH------------------------------------
MNMG_GEOMG       RG------------------------------------
MNMG_GEOSL       RSASS---------------------------------
MNMG_GEOUR       RNGR----------------------------------
MNMG_PELPD       HAGARKQG------------------------------
MNMG_PELCD       N-------------------------------------
MNMG_DESPS       LNYLKSNDKI----------------------------
MNMG_DESVH       MGQR----------------------------------
MNMG_DESVV       MGQR----------------------------------
MNMG_DESAG       NGWL----------------------------------
MNMG_LAWIP       IHAFR---------------------------------
MNMG_SYNFM       RAQGGPFLAPVLDPGVNMHSQKKKLA------------
MNMG_SYNAS       KEQDTRGQSPLPAQSE----------------------
MNMG_CHLTE       --------------------------------------
MNMG_CHLCH       --------------------------------------
MNMG_CHLPM       --------------------------------------
MNMG_CHLL3       --------------------------------------
MNMG_CHLPD       --------------------------------------
MNMG_BACFR       --------------------------------------
MNMG_BACFN       --------------------------------------
MNMG_BACTN       --------------------------------------
MNMG_PHOV8       --------------------------------------
MNMG_PARD8       --------------------------------------
MNMG_PORGI       --------------------------------------
MNMG_FLAJ1       --------------------------------------
MNMG_FLAPJ       --------------------------------------
MNMG_GRAFK       --------------------------------------
MNMG_CYTH3       --------------------------------------
MNMG_SULMW       K-------------------------------------
MNMG_SALRD       EGVEPMPKDRDLNLDAMGGDGQSFGVSRETAVEVG---
MNMG_BORAP       PKNKVVLNFSV---------------------------
MNMG_BORBP       PKNKVVLNFSL---------------------------
MNMG_BORBU       PKNKVVINFSL---------------------------
MNMG_TREDE       --------------------------------------
MNMG_TREPA       --------------------------------------
MNMG1_FUSNN      KL------------------------------------
MNMG2_FUSNN      RGN-----------------------------------
MNMG_ENDTX       QKKERKQKKHNKIK------------------------
MNMG_ONYPE       HHALL---------------------------------
MNMG_AYWBP       HHALL---------------------------------
MNMG_ACHLI       KNA-----------------------------------
MNMG_MYCCT       QYPLESIDD-----------------------------
MNMG_MYCMS       QYPLENIDN-----------------------------
MNMG_MESFL       NYATEQK-------------------------------
MNMG_MYCGE       YE------------------------------------
MNMG_MYCPN       HE------------------------------------
MNMG_MYCGA       NA------------------------------------
MNMG_UREPA       IKND----------------------------------
MNMG_UREP2       IKND----------------------------------
MNMG_MYCPE       KKKQT---------------------------------
MNMG_MYCH7       LKMQKVSKI-----------------------------
MNMG_MYCHJ       LKMQKVSKI-----------------------------
MNMG_MYCH2       LKMQKVSKI-----------------------------
MNMG_MYCPU       KKSKHEN-------------------------------
MNMG_MYCS5       YKKYDN--------------------------------
MNMG_MYCMO       KVVKNEN-------------------------------
MNMG_MYCAP       RNKKNYDQN-----------------------------
MNMG_THEM4       --------------------------------------
MNMG_FERNB       K-------------------------------------
MNMG_THEMA       KKQ-----------------------------------
MNMG_THESQ       KKQ-----------------------------------
MNMG_THEP1       KKQ-----------------------------------
MNMG_PETMO       KDKIR---------------------------------
MNMG_BDEBA       HKKIKEMGLEGQSGAGSTDSILAH--------------
MNMG_ALKMQ       RRRQKNGGGT----------------------------
MNMG_ALKOO       KRRKKGEVE-----------------------------
MNMG_CLOD6       IRRTRGGKGE----------------------------
MNMG_FINM2       RKK-----------------------------------
MNMG_CALS8       AKKGSK--------------------------------
MNMG_ACET2       RKRQKS--------------------------------
MNMG1_CALS4      MRKKKSNESRIS--------------------------
MNMG2_CALS4      MRRKRSDEAKIN--------------------------
MNMG_THEP3       LRRNKEDEEQIG--------------------------
MNMG_THEPX       LRRNKEDEEQIG--------------------------
MNMG_CLOB1       KNREN---------------------------------
MNMG_CLOBH       KNREN---------------------------------
MNMG_CLOBL       KNREN---------------------------------
MNMG_CLOBK       KDREN---------------------------------
MNMG_CLOBM       KNREN---------------------------------
MNMG_CLONN       YNRNKGHKEEEF--------------------------
MNMG_CLOAB       YFKNK---------------------------------
MNMG_CLOTE       KYK-----------------------------------
MNMG_CLOK5       KHREKLL-------------------------------
MNMG_CLOP1       YRKTGKNTDN----------------------------
MNMG_CLOPS       YRKTGKNTDN----------------------------
MNMG_CLOPE       YRKTGKNTDN----------------------------
MNMG_CLOB8       YYNK----------------------------------
MNMG_LACP7       IRRKK---------------------------------
MNMG_NATTJ       LKQRADRNQASHDDSNTETGENDD--------------
MNMG_BACVZ       GRIAKVAE------------------------------
MNMG_BACSU       GRIAKIAE------------------------------
MNMG_BACLD       GRIAKVAE------------------------------
MNMG_BACP2       GRIAKIAE------------------------------
MNMG_BACAH       GKIARVSNQ-----------------------------
MNMG_BACHK       GKIARVSNQ-----------------------------
MNMG_BACAN       GKIARVSNQ-----------------------------
MNMG_BACCZ       GKIARVSNQ-----------------------------
MNMG_BACC1       GKIARVSNQ-----------------------------
MNMG_BACCR       GKIARVSNQ-----------------------------
MNMG_BACMK       GKIARVSNQ-----------------------------
MNMG_BACCN       GKIARVSNQ-----------------------------
MNMG_GEOKA       GRIARVSNE-----------------------------
MNMG_GEOTN       GRIARVSNE-----------------------------
MNMG_LYSSC       GKIAKISG------------------------------
MNMG_STAA2       GKLQRVSD------------------------------
MNMG_STAA9       GKLQRVSD------------------------------
MNMG_STAAR       GKLQRVSD------------------------------
MNMG_STAAS       GKLQRVSD------------------------------
MNMG_STAA1       GKLQRVSD------------------------------
MNMG_STAAM       GKLQRVSD------------------------------
MNMG_STAAW       GKLQRVSD------------------------------
MNMG_STAAN       GKLQRVSD------------------------------
MNMG_STAAB       GKLQRVSY------------------------------
MNMG_STAA8       GKLQRVSD------------------------------
MNMG_STAA3       GKLQRVSD------------------------------
MNMG_STAAC       GKLQRVSD------------------------------
MNMG_STAAE       GKLQRVSD------------------------------
MNMG_STAAT       GKLQRVSD------------------------------
MNMG_STAES       GKLQRVKQ------------------------------
MNMG_STAEQ       GKLQRVKQ------------------------------
MNMG_STAHJ       GKLQRVKN------------------------------
MNMG_STAS1       GKIQRVNN------------------------------
MNMG_LISMO       GKIAKISK------------------------------
MNMG_LISMF       GKIAKRDKEKA---------------------------
MNMG_LISIN       GKIAKVSK------------------------------
MNMG_LISW6       GKIAKISK------------------------------
MNMG_OCEIH       GSIAKVAND-----------------------------
MNMG_BACSK       GRLAKTSS------------------------------
MNMG_ALKHC       GRLAKLGKKTV---------------------------
MNMG_EXIS2       GQYALTAE------------------------------
MNMG_LEVBA       GKIAKVQ-------------------------------
MNMG_LACPL       GRIAKVQ-------------------------------
MNMG_PEDPA       GKIAKIAE------------------------------
MNMG_LACS1       GKIARVDD------------------------------
MNMG_ENTFA       GKIAKVQG------------------------------
MNMG_LACSS       GKIAKVK-------------------------------
MNMG_LACP3       GRISKVAQ------------------------------
MNMG_LACAC       GRYSRVNK------------------------------
MNMG_LACH4       GRYSKVKKYEAEDLKPSSYFAEKYGLEADAETGASQY-
MNMG_LACJO       GRIAKVKNK-----------------------------
MNMG_LACGA       GRIAKIKK------------------------------
MNMG_LACDA       GKYAKVQK------------------------------
MNMG_LACDB       GKYAKVQK------------------------------
MNMG_LACLM       K-------------------------------------
MNMG_LACLS       K-------------------------------------
MNMG_LACLA       K-------------------------------------
MNMG_STRA3       RQKGRKNIN-----------------------------
MNMG_STRA5       RQKGRKNIN-----------------------------
MNMG_STRA1       RQKGRKNIN-----------------------------
MNMG_STRP1       NGKAHRKY------------------------------
MNMG_STRPD       NGKAHRKY------------------------------
MNMG_STRPB       NGKAHRKY------------------------------
MNMG_STRPC       NGKAHRKY------------------------------
MNMG_STRPG       NGKAHRKY------------------------------
MNMG_STRP8       NGKAHRKY------------------------------
MNMG_STRPF       NGKAHRKY------------------------------
MNMG_STRPM       NGKAHRKY------------------------------
MNMG_STRP3       NGKAHRKY------------------------------
MNMG_STRP6       NGKAHRKY------------------------------
MNMG_STRT2       NNKARRKVD-----------------------------
MNMG_STRT1       NNKARRKVD-----------------------------
MNMG_STRTD       NNKARRKVD-----------------------------
MNMG_STRMU       KNRSRTR-------------------------------
MNMG_STRGC       KARSISKNKEKQNHV-----------------------
MNMG_STRSV       KSRSISKNQAK---------------------------
MNMG_STRR6       KNRSISKTLQKSK-------------------------
MNMG_STRP2       KNRSISKTLQKSK-------------------------
MNMG_STRPN       KNRSISKTLQKSK-------------------------
MNMG_STRPI       KNRSISKTLQKSK-------------------------
MNMG_STRSY       RSRSISKNKSKDSH------------------------
MNMG_STRS2       RSRSISKNKSKDSH------------------------
MNMG_DESRM       ERRKIAGGDA----------------------------
MNMG_PELTS       ARREGRKEN-----------------------------
MNMG_CARHZ       RKSEDNNGSEA---------------------------
MNMG_MOOTA       KKREGAKACAG---------------------------
MNMG_HELMI       QRRLAPGEGGVD--------------------------
MNMG_SYNWW       KRRK----------------------------------
MNMG_DESAP       RRRREEESDGSRIGHLPSERSGELGSGTG---------
MNMG_SYMTH       LARARDRAEEA---------------------------
MNMG_DESHY       KRRGGQIHAT----------------------------
MNMG_ROSCS       RGRRDMALDVRSGA------------------------
MNMG_ROSS1       QTRQATPVETPHPSLPHTG-------------------
MNMG_CHLAA       RQGDQVAR------------------------------
MNMG_DEIRA       QRVGS---------------------------------
MNMG_DEIGD       TGNVSRET------------------------------
MNMG_THET2       GA------------------------------------
MNMG_THET8       GA------------------------------------
MNMG_MYXXD       GTEAPAVCAQPED-------------------------