CLUSTAL format seed alignment for MF_00130

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RECU_GEOKA      MALKYPSGKEY---------RGNKPN--AAR-----------RP---AADYANRGMTLED
RECU_GEOTN      MALKYPGGKEY---------RGNRLN--AAR-----------QPM--AADYANRGMTLEE
RECU_BACVZ      -MIRYPNGKTF---------QPNKTV--SSQ-----------NSQKRSHSYSNRGMTLED
RECU_BACSU      -MIRYPNGKTF---------QPKHSV--SSQ-----------NSQKRAPSYSNRGMTLED
RECU_BACLD      -MIRYPNGKSY---------QPKTAA--SSL-----------Q---KKPSYSNRGMTLED
RECU_BACP2      -MIRYPNGKSY---------QPIQPI--GTK-----------KRISGESSYSNRGMTLEA
RECU_BACAN      MTIRYPNGKRY---------NQASQP--HKT-----------PI--KKHTYSNRGMSLEE
RECU_BACHK      MTIRYPNGKRY---------NQASQP--HKT-----------PI--KKHTYSNRGMSLEE
RECU_BACCZ      MTIRYPNGKRY---------NQASQP--HKT-----------PI--KKHTYSNRGMSLEE
RECU_BACC1      MTIRYPNGKRY---------NQASQP--HKT-----------PI--KKHTYSNRGMSLEE
RECU_BACAH      MTIRYPNGKRY---------NQASQP--HKT-----------PI--KKHTYSNRGMSLEE
RECU_BACCR      MTIRYPNGKRY---------NQASQP--QKT-----------PI--KTHTYSNRGMSLEE
RECU_BACHD      MTIRYPNGRPF---------QPAKAS--STH-----------KR--EKIDYSNRGMTLES
RECU_BACSK      MPIRYPNGQPY---------SRSPKQ--GQA-----------KKPLPADTYSGRGMTLEQ
RECU_LISMO      MAIGYPNGKKY---------AASHEVLPQQK-----------R--KAPVTYGKRGMSLED
RECU_LISMF      MAIGYPNGKKY---------AASHEVLPQQK-----------R--KAPVTYGKRGMSLED
RECU_LISIN      MAIGYPGGKKY---------TASHEGLPSKK-----------R--KTPVTYGKRGMSLED
RECU_LISW6      MAIGYPNGKKY---------AASHEGIPQKK-----------R--KAPVTYGKRGMSLED
RECU_STAAC      --MNYPNGKPY---------RKNSAIDGGKK-----------TAAFSNIEYGGRGMSLEK
RECU_STAAS      --MNYPNGKPY---------RKNSAIDGGKK-----------TAAFSNIEYGGRGMSLEK
RECU_STAA1      --MNYPNGKPY---------RKNSAIDGGKK-----------TAAFSNIEYGGRGMSLEK
RECU_STAAM      --MNYPNGKPY---------RKNSAIDGGKK-----------TAAFSNIEYGGRGMSLEK
RECU_STAAW      --MNYPNGKPY---------RKNSAIDGGKK-----------TAAFSNIEYGGRGMSLEK
RECU_STAAN      --MNYPNGKPY---------RKNSAIDGGKK-----------TAAFSNIEYGGRGMSLEK
RECU_STAA3      --MNYPNGKPY---------RKNSAIDGGKK-----------TAAFSNIEYGGRGMSLEK
RECU_STAAU      --MNYPNGKPY---------RKNSAIDGGKK-----------TAAFSNIEYGGRGMSLEK
RECU_STAAB      --MNYPNGKPY---------RKNSAIDGGKK-----------TAAFSNIEYGGRGMSLEK
RECU_STAAR      --MNYPNGKPY---------RKNSAIDGGKK-----------TAAFSNIEYGGRGMSLEK
RECU_STAES      --MNYPNGKPY---------SKNKPLDGRKS-----------SPFSSNIEYGGRGMTLEK
RECU_STAEQ      --MNYPNGKPY---------SKNKPLDGRKS-----------SPFSSNIEYGGRGMTLEK
RECU_STAS1      --MNYPNGKPF---------NRNKSQVGRTH-----------KGQTSKIDYGGRGMSLEK
RECU_OCEIH      --MNYPNGQQK---------VTTNHVVQKQD-----------NRMFSN-----RGMSLED
RECU_LACBA      MTIRYPNGHAY--------RAPAKKIGSQFS-----------STN---TNYGKRGMTLEE
RECU_PEDPA      MKFNYPTGS----------KATTPKMSQAKV-----------SMP---PIYGKRGMSLEE
RECU_LACS1      MVFHYPNGRAYDYHKNENHPSLVNKVNHRSI-----------NHNRSKTIYGNRGMSLEE
RECU_LACP3      MTIHYPNGNPY--------KDGTQFSSQA---------------ISRPTIYGGRGMTLEE
RECU_LACSS      MAFHYPNGQPY--------SNHETKQPKKQG-----------RHTSPTTLYGKRGMSLEE
RECU_LACPL      MTIRYPNGQVY--------RQPGPTKSKSS--------------KFANVNFGDRGMSLEQ
RECU_LACRD      MTIHYPNGQQP--------VQHYNTHNELP--------------TPHQSIYAKRGMSLED
RECU_LACDA      -MVKYPTGSVMPLRAAQ--------RQGKK-------------ALLKKASFSDRGMTLEQ
RECU_LACDB      -MVKYPTGSVMPLRAAQ--------RQGKK-------------ALLKKASFSDRGMTLEQ
RECU_LACAC      -MVKYPSGSLAAFRKPVT--TQKKMRTGKRS-----------YTHKKGVNFSDRGMTLEQ
RECU_LACLM      -MVNYPNGRSQ---------SYSAVPKKQKTLTGLSVAKKGAPKSKSLVAFGKRGMNFEA
RECU_LACLS      -MVNYPNGRSQ---------SYSAVPKKQKTLTELSVAKKSAPKSKSLVAFGKRGMNFEA
RECU_LACLA      -MVNYPNGRSR---------AYSTVPKKKKSLTELSVTKKSTSKTKGMVAFGKRGMNFEA
RECU_STRA1      -MVNYPHQLIR---------KTTVTKSK-----------------KKKIDFANRGMSFEA
RECU_STRA3      -MVNYPHQLIR---------KTTVTKSK-----------------KKKIDFANRGMSFEA
RECU_STRA5      -MVNYPHQLIR---------KTTVTKSK-----------------KKKIDFANRGMSFEA
RECU_STRPB      -MVNYPHNLIR---------QKVSSVQKQT--------------KQNKVDFANRGMSFEA
RECU_STRPC      -MVNYPHNLIR---------QKVSSVQKQT--------------KQNKVDFANRGMSFEA
RECU_STRP8      -MVNYPHNLIR---------QKVSSVQKQT--------------KQNKVDFANRGMSFEA
RECU_STRPD      -MVNYPHNLIR---------QKVSSVQKQT--------------KQNKVDFANRGMSFEA
RECU_STRPM      -MVNYPHNLIR---------QKVSSVQKQT--------------KQNKVDFANRGMSFEA
RECU_STRP3      -MVNYPHNLIR---------QKVSSVQKQT--------------KQNKVDFANRGMSFEA
RECU_STRPF      -MVNYPHNLIR---------QKVSSVQKQT--------------KQNKVDFANRGMSFEA
RECU_STRP6      -MVNYPHNLIR---------QKVSSVQKQT--------------KQNKVDFANRGMSFEA
RECU_STRPG      -MVNYPHNLIR---------QKVSSVQKQT--------------KQNKVDFANRGMSFEA
RECU_STRP1      -MVNYPHNLIR---------QKVSSVQK-----------------QNKVDFANRGMSFEA
RECU_STRMU      -MVNYPHHFIR---------KQSKPSQI-----------------SKTINFANRGMSFEA
RECU_STRT2      -MVNYPHQISR---------KIAQVRTK----------------KSNRVDFANRGMNFES
RECU_STRTD      -MVNYPHQISR---------KIAQVRTK----------------KSNRVDFANRGMNFES
RECU_STRT1      -MVNYPHQISR---------KIAQVRTK----------------KSNRVDFANRGMNFES
RECU_STRSY      -MVNYPHKVSK---------KINRTSPI----------------SSQRVNFANRGMSFEA
RECU_STRS2      -MVNYPHKVSK---------KINRTSPI----------------SSQRVNFANRGMSFEA
RECU_STRSV      -MVNYPHKLKA---------KSSINRPV----------------PGI-VNFANRGMSFEK
RECU_STRPN      -MVNYPHKVSS---------QKRQTSLS------------------QPKNFANRGMSFEK
RECU_STRR6      -MVNYPHKVSS---------QKRQTSLS------------------QPKNFANRGMSFEK
RECU_STRP2      -MVNYPHKVSS---------QKRQTSLS------------------QPKNFANRGMSFEK
RECU_STROR      -MVNYPHKISS---------QKRQAPPS------------------QTKNFANRGMSFEK
RECU_LEUMM      MTINYPVGTHH---------GKTLKNNTLRT-----------GKTTKKVLFGKRGMGLED
RECU_OENOB      -MVNYPSGVRA---------GGYPQK-----------------KKNQNIRYGKRGMGLEE
RECU_MYCGE      ------------------------------------------------MINANRGMLLET
RECU_UREPA      ------------------------------------------------MNNKNNGMHLEV
RECU_MYCPU      ------------------------------------------------MIKKNRGMFLEK
                                                                     .** :* 

RECU_GEOKA      DLNATNEYYRERGIAVIHKKPTPVQIVRVDYPKRSAAVITEAYFRQASTTDYNGVYRGKY
RECU_GEOTN      DLNATNEYYRERGIAVVYKKPTPVQIVRVDYPKRSAAVIKEAYFRQASTTDYNGVYRGKY
RECU_BACVZ      DLNETNKYYLANQIAVIHKKPTPVQIVNVHYPKRSAAVIKEAYFKQSSTTDYNGIYKGRY
RECU_BACSU      DLNETNKYYLTNQIAVIHKKPTPVQIVNVHYPKRSAAVIKEAYFKQSSTTDYNGIYKGRY
RECU_BACLD      DLNETNMYYQSHSIAVIHKKPTPVQIVQVDYPKRSAAVIKEAYFKQSSTTDYNGVYKGRY
RECU_BACP2      DLNETNQYYLVNGIAVIHKKPTPVQIVNVDYPKRSAAVIKEAYFKQSSTTDYNGVYRGRY
RECU_BACAN      ELNETNEYYLTHNIACVHKKPTPLQIVKVDYPARSAAVVKEAYFKQPSTTDYNGVYKGKY
RECU_BACHK      ELNETNEYYLTHNIACVHKKPTPLQIVKVDYPARSAAVVKEAYFKQPSTTDYNGVYKGKY
RECU_BACCZ      ELNETNEYYLTHNIACVHKKPTPLQIVKVDYPARSAAVVKEAYFKQPSTTDYNGVYKGKY
RECU_BACC1      ELNETNEYYLTHNIACVHKKPTPLQIVKVDYPARSAAVVKEAYFKQPSTTDYNGVYKGKY
RECU_BACAH      ELNETNEYYLTHNIACVHKKPTPLQIVKVDYPARSAAVVKEAYFKQPSTTDYNGVYKGKY
RECU_BACCR      ELNETNQYYLTHNIACVHKKPTPLQIVKVDYPARSAAVVKEAYFKQPSTTDYNGVYKGKY
RECU_BACHD      DINETNSYYLTHGRAVIHKKPTPVQIVNVDYPKRSAAVIKEAYFKQPSTTDYNGVYRGKY
RECU_BACSK      DIDEANLYYLSQQRAVVHKKPTPVQIVKVDYPKRSAAVIREAYFKQASTTDYNGVYRGAY
RECU_LISMO      DLNDTIAYYLTHEIAVIHKKPTPVQIVSVDYPKRSSAKIKEAYFKTPSTTDYNGVYKGKY
RECU_LISMF      DLNDTIAYYLTHEIAVIHKKPTPVQIVSVDYPKRSSAKIKEAYFKTPSTTDYNGVYKGKY
RECU_LISIN      DLNDTIAYYLAHDIAVIHKKPTPVQIVSVDYPKRSSAKIKEAYFKTPSTTDYNGVYKGKY
RECU_LISW6      DLNDTIAYYLAQDIAVIHKKPTPVQIVSVDYPKRSSAKIKEAYFKTPSTTDYNGVYKGKY
RECU_STAAC      DIEHSNTFYLKSDIAVIHKKPTPVQIVNVNYPKRSKAVINEAYFRTPSTTDYNGVYQGYY
RECU_STAAS      DIEHSNTFYLKSDIAVIHKKPTPVQIVNVNYPKRSKAVINEAYFRTPSTTDYNGVYQGYY
RECU_STAA1      DIEHSNTFYLKSDIAVIHKKPTPVQIVNVNYPKRSKAVINEAYFRTPSTTDYNGVYQGYY
RECU_STAAM      DIEHSNTFYLKSDIAVIHKKPTPVQIVNVNYPKRSKAVINEAYFRTPSTTDYNGVYQGYY
RECU_STAAW      DIEHSNTFYLKSDIAVIHKKPTPVQIVNVNYPKRSKAVINEAYFRTPSTTDYNGVYQGYY
RECU_STAAN      DIEHSNTFYLKSDIAVIHKKPTPVQIVNVNYPKRSKAVINEAYFRTPSTTDYNGVYQGYY
RECU_STAA3      DIEHSNTFYLKSDIAVIHKKPTPVQIVNVNYPKRSKAVINEAYFRTPSTTDYNGVYQGYY
RECU_STAAU      DTEHSNTFYLKSDIAVIHKKPTPVQIVNVNYPKRSKAVINEAYFRTPSTTDYNGVYQGYY
RECU_STAAB      DIEHSNAFYLKSDIAVIHKKPTPVQIVNVNYPKRSKAVINEAYFRTPSTTDYNGVYQGYY
RECU_STAAR      DIEHSNAFYLKSDIAVIHKKPTPVQIVNVNYPKRSKAVINEAYFRTPSTTDYNGVYQGYY
RECU_STAES      DIEQSNTFYLKSGIAVIHKKPTPVQIVNVHYPKRSKAVINEAYFRTPSTTDYNGVYNGYY
RECU_STAEQ      DIEQSNTFYLKSGIAVIHKKPTPVQIVNVHYPKRSKAVINEAYFRTPSTTDYNGVYNGYY
RECU_STAS1      DIELSNDYYLNRGIAVIHKKPTPIQIVNVHYPMRSKAVINEAYFRTPSTTDYNGIYHGRY
RECU_OCEIH      DINATNEFYLETNQAVIHKKPTPVQIVNVHYPKRSAAVITEAYFKQASTTDYNGIYKGKY
RECU_LACBA      ELNESNTYYEVNGVAVVHKKPTPIRIVKVDYPKRSAAVIKEAYFSTASTTDYNGVYRGHY
RECU_PEDPA      ELNESNAYYLSHGVAVIHKKPTPIQIVKVDYPKRSAAQIKEAYFSKASTTDYNGVYRGKY
RECU_LACS1      EINESNQYYLSQGIAVIHKKPIPIQIVSVDYPKRSAAVIKEAYFKQASTTDYNGVYKGKY
RECU_LACP3      ELNISNQYYRSIDKAVVYKKPTPVQIVKVDYPKRSQAVIREAYFKTPSTTDYNGVYRGFY
RECU_LACSS      EINDSNQYYRLRDAAVIYKKPTPIQIVKVDYPARSQAVIKEAYFKQASTTDYNGIYQGHY
RECU_LACPL      EINDSNAYYLENNIAVIHKKPTPIQIVKVDYPKRSAAVIREAYFKQASTTDYNGVYRGKY
RECU_LACRD      EINHSNQYYLARHIAVIHKKPTPIQLVKVDYPKRSAAVIKEAYFRRPSTTDYNGVYRGYY
RECU_LACDA      QINESNQYYLDAGIAVVHKKPTPIQIVKVDYPKRSRAVIREAYFRQASTTDYNGVYQGYY
RECU_LACDB      QINESNQYYLDAGIAVVHKKPTPIQIVKVDYPKRSRAVIREAYFRQASTTDYNGVYQGYY
RECU_LACAC      QINESNKYYLTEEIAVVHKKPTPIQIVKVDYPKRSKAVIREAYFRQASTTDYNGVYKGYY
RECU_LACLM      EINATNDYYLSRGLAVIHKKPTPIQIVKVDYPQRSRAKITEAYFRQASTTDYSGVYKGHY
RECU_LACLS      EINATNDYYLSRGLAVIHKKPTPIQIVKVDYPQRSRAKITEAYFRQASTTDYSGVYKGHY
RECU_LACLA      EINATNEYYLSRGLAVIHKKPTPIQIVKVDYPQRSRAKITEAYFRQASTTDYSGVYKGHY
RECU_STRA1      AINATNDYYLSHELAVIHKKPTPVQIVKVDYPKRSRAKIVEAYFRQASTTDYSGVYKGYY
RECU_STRA3      AINATNDYYLSHELAVIHKKPTPVQIVKVDYPKRSRAKIVEAYFRQASTTDYSGVYKGYY
RECU_STRA5      AINATNDYYLSHELAVIHKKPTPVQIVKVDYPKRSRAKIVEAYFRQASTTDYSGVYKGYY
RECU_STRPB      AINATNDYYLSRQIAVIHKKPTPVQIVKVDYPKRSRAKIVEAYFRQASTTDYCGVYKGHY
RECU_STRPC      AINATNDYYLSRQIAVIHKKPTPVQIVKVDYPKRSRAKIVEAYFRQASTTDYCGVYKGHY
RECU_STRP8      AINATNDYYLSRQIAVIHKKPTPVQIVKVDYPKRSRAKIVEAYFRQASTTDYCGVYKGHY
RECU_STRPD      AINATNDYYLSRQIAVIHKKPTPVQIVKVDYPKRSRAKIVEAYFRQASTTDYCGVYKGHY
RECU_STRPM      AINATNDYYLSRQIAVIHKKPTPVQIVKVDYPKRSRAKIVEAYFRQASTTDYCGVYKGHY
RECU_STRP3      AINATNDYYLSRQIAVIHKKPTPVQIVKVDYPKRSRAKIVEAYFRQASTTDYCGVYKGHY
RECU_STRPF      AINATNDYYLSRQIAVIHKKPTPVQIVKVDYPKRSRAKIVEAYFRQASTTDYCGVYKGHY
RECU_STRP6      AINATNDYYLSRQIAVIHKKPTPVQIVKVDYPKRSRAKIVEAYFRQASTTDYCGVYKGHY
RECU_STRPG      AINATNDYYLSRQIAVIHKKPTPVQIVKVDYPKRSRAKIVEAYFRQASTTDYCGVYKGHY
RECU_STRP1      AINATNDYYLSRQIAVIHKKPTPVQIVKVDYPKRSRAKIVEAYFRQASTTDYCGVYKGHY
RECU_STRMU      AINATNNYYLSQKIAVIHKKPTPIQIVRVDYPRRSRAKIVEAYFRQASTTDYSGVYKGYY
RECU_STRT2      AINATNDYYLSRGLAVIHKKPTPVQIVKVDYPKRSRAKIVEAYFRQASTTDYSGVYKGYY
RECU_STRTD      AINATNDYYLSRGLAVIHKKPTPVQIVKVDYPKRSRAKIVEAYFRQASTTDYSGVYKGYY
RECU_STRT1      AINATNDYYLSRGLAVIHKKPTPVQIVKVDYPKRSRAKIVEAYFRQASTTDYSGVYKGYY
RECU_STRSY      AINDSNQYYLAHDIAVIHKKPTPVQIVKVDYPKRSRAKIVEAYFRQASTTDYSGVFKRHY
RECU_STRS2      AINDSNQYYLAHDIAVIHKKPTPVQIVKVDYPKRSRAKIVEAYFRQASTTDYSGVFKRHY
RECU_STRSV      MINESNSYYLSRGLAVIHKKPTPIQIVKVDYPHRSRAKIVEAYFRQASTTDYSGVYKGHY
RECU_STRPN      MINATNDYYLSQGLAVIHKKPTPIQIVQVDYPQRSRAKIVEAYFRQASTTDYSGVYNGYY
RECU_STRR6      MINATNDYYLSQGLAVIHKKPTPIQIVQVDYPQRSRAKIVEAYFRQASTTDYSGVYNGYY
RECU_STRP2      MINATNDYYLSQGLAVIHKKPTPIQIVQVDYPQRSRAKIVEAYFRQASTTDYSGVYNGYY
RECU_STROR      MINATNDYYLSHGLAVIHKKPTPIQIVRVDYPQRSRAKIVEAYFRQASTTDYSGVYDGYY
RECU_LEUMM      EINLANDYYLANRLAVVHKKPTPITIVKVDYPARSAAKITEAYFKQASTTDYNGVYQGKY
RECU_OENOB      MINQANDYYLVNHQAVIHKKPTPITVVHVDYPDRSMAKITEAYYVQPSTTDYNGVVSGKY
RECU_MYCGE      IVNQTIARLKDHPDIWLEKRFLPIKPIAFRHAH------VSGNVSQKSKTDYYGIYKGMY
RECU_UREPA      LINKSISLFNLQYQAFFKKRCVDIIIKNIDNSY------VQGKIKQKSETDYYGFYKGDY
RECU_MYCPU      VINQSIDFYNLNDLALFEKKATP-----------KVSKTSGVIIHKKSTVDYIGIYQGIF
                  : :           . *:                           * .** *.    :

RECU_GEOKA      IDFEAKETKNKTAFPLKNFHAHQIRHMEQVVAHGGICFAILRFSLLNETYLLDASHLIAW
RECU_GEOTN      IDFEAKETKNKTAFPLKNFHAHQIRHMEQVMAHGGICFAILRFSVLNETYLLDAFHLIAR
RECU_BACVZ      IDFEAKETKNKTAFPLQNFHDHQIEHMKQVVRQDGICFVII--SAFGKVYFLEADKLFVF
RECU_BACSU      IDFEAKETKNKTSFPLQNFHDHQIEHMKQVKAQDGICFVII--SAFDQVYFLEADKLFYF
RECU_BACLD      IDFEAKETKSRTSFPLQNFHDHQIEHMKQVVAQDGICFVII--SAFEEIYFLEAEKLFYF
RECU_BACP2      IDFEAKETKSTTSFPLKNFHEHQIEHMKQVEKQGGICFVII--SAFGSVYYLPASDLFFF
RECU_BACAN      IDFEAKETKNKTSFPLQNFHLHQIEHMKQVIAHNGIAFVIIKFTLFDELYLLDAKHIITF
RECU_BACHK      IDFEAKETKNKTSFPLQNFHLHQIEHMKQVIAHNGIAFVIIKFTLFDELYLLDAKHIITF
RECU_BACCZ      IDFEAKETKNKTSFPLQNFHLHQIEHMKQVIAHNGIAFVIIKFTLFDELYLLDAKHIITF
RECU_BACC1      IDFEAKETKNKTSFPLQNFHLHQIEHMKQVIAHNGIAFVIIKFTLFDELYLLDAKHIIAF
RECU_BACAH      IDFEAKETKNKTSFPLQNFHLHQIEHMKQVIAHNGIAFVIIKFTLFDELYLLDAKHIIAF
RECU_BACCR      IDFEAKETKNKTSFPLQNFHLHQIEHMKQVVAHNGIAFVIIKFTLFDEFYLLDAKHIIAF
RECU_BACHD      LDFEAKETRNKTSFPIQNFHEHQMEHMKKVLAQDGICFVIVRFTTFDETYLLDASHVIKA
RECU_BACSK      IDFEAKETKNKTSFPLKNIHPHQVDHMREVSKHGGICFVLIRFFQSAEVFLLDAKHLIDY
RECU_LISMO      VDFEAKETQNTTSFPLSNFHDHQMTHMANVLKQDGIVFVIIAFQKLGETHFIPFEKFYPF
RECU_LISMF      VDFEAKETQNTTSFPLSNFHDHQMTHMANVLKQDGIVFVIIAFQKLGETHFIPFEKFYPF
RECU_LISIN      VDFEAKETQNTTSFPLSNFHDHQMTHMANVLKQDGIVFVIIAFQKLGETHFIPFEKFYPF
RECU_LISW6      IDFEAKETQNTTSFPLSNFHDHQMIHMANVLKQDGIVFVIIAFQKIGETYFIPFEKFYPF
RECU_STAAC      IDFEAKETKNKTSFPLNNIHDHQVEHMKNAYQQKGIVFLMIRFKTLDEVYLLPYSKFEVF
RECU_STAAS      IDFEAKETKNKTSFPLNNIHDHQVEHMKNAYQQKGIVFLMIRFKTLDEVYLLPYSKFEVF
RECU_STAA1      IDFEAKETKNKTSFPLNNIHDHQVEHMKNAYQQKGIVFLMIRFKTLDEVYLLPYSKFEVF
RECU_STAAM      IDFEAKETKNKTSFPLNNIHDHQVEHMKNAYQQKGIVFLMIRFKTLDEVYLLPYSKFEVF
RECU_STAAW      IDFEAKETKNKTSFPLNNIHDHQVEHMKNAYQQKGIVFLMIRFKTLDEVYLLPYSKFEVF
RECU_STAAN      IDFEAKETKNKTSFPLNNIHDHQVEHMKNAYQQKGIVFLMIRFKTLDEVYLLPYSKFEVF
RECU_STAA3      IDFEAKETKNKTSFPLNNIHDHQVEHMKNAYQQKGIVFLMIRFKTLDEVYLLPYSKFEVF
RECU_STAAU      IDFEAKETKNKTSFPLNNIHDHQVEHMKNAYQQKGIVFLMIRFKTLDEVYLLPYSKFEVF
RECU_STAAB      IDFEAKETKNKTSFPLNNIHDHQVEHMKNAYQQKGIVFLMIRFKTLDEVYLLPYSKFEIF
RECU_STAAR      IDFEAKETKNKTSFPLNNIHDHQVEHMKNAYQQKGIVFLMIRFKTLDEVYLLPYSKFEIF
RECU_STAES      IDFEAKETKNKTSFPLNNIHAHQVEHMKNTYHQKGIVFLMIRFKSLDEVYLLPYSKFEKY
RECU_STAEQ      IDFEAKETKNKTSFPLNNIHAHQVEHMKNTYHQKGIVFLMIRFKSLDEVYLLPYSKFEKY
RECU_STAS1      LDFEAKETKNKTSFPLNNMHEHQVRHMEACYQQQGVVFLLIRFKSLDEVYLLPYANFKKF
RECU_OCEIH      IDFEAKETKNKTSFPLANIHEHQINHMQKVIDQQGICFMLIRFTAHDETYLLDAKALLTF
RECU_LACBA      LDFDAKETRNTTSFPLQNFHQHQIDHMRACTTQGGICFAIIKFVTRQEIYLYRAQDLFTF
RECU_PEDPA      IDFDAKETTNSTSFPLSNFHEHQINHMKDCEKVGGICFTIIKFVKLNKIFLLKTKDLFQF
RECU_LACS1      LDFEAKETTNISSFPLRNFHAHQVEHMRACQKQGGICFTIVKFTKTDELFILPADLLFKY
RECU_LACP3      LDFEAKETKNKASFPLKNFHQHQIEHFRRCLKQSGICFVVIRFATLKRLFVFPAGRLIDC
RECU_LACSS      VDFEAKETKNKTSFPFQNFHQHQIDHFRACLQQGGVCFVIMKFVPLQRLFVYPASLLITQ
RECU_LACPL      LDFEAKETKNKTAFPLKNFHEHQIKHMRQCLAQSGICFVIIRFASLGRLFLLTASDLFTY
RECU_LACRD      IDFDAKETRNKNSFPLKNFHPHQIQHMRECVAQGGICFAFIKFTELDLLYLLPASNLFKY
RECU_LACDA      LDFEAKETRNKTSFPLKNFHEHQILHLEQCLDQEGICFALIGFMTLERYFVTPASFLIQA
RECU_LACDB      LDFEAKETRNKTSFPLKNFHEHQILHLEQCLDQEGICFALIGFMTLERYFVTPASFLIQA
RECU_LACAC      LDFEAKETKNKTNFPLKNFHEHQIFHLAECLKQQGICFTIIRFASLERYFVTPASFVINA
RECU_LACLM      VDFEAKETHQKTVFPLKNFHEHQIVHMSNVLAQRGIAFILLHFAALDETYLLPSSYLITF
RECU_LACLS      VDFEAKETHQKTVFPLKNFHEHQIVHMSNVLAQRGIAFVLLHFADLEETYLLPSSYLITF
RECU_LACLA      IDFEAKETQQKTVFPLKNFHEHQIVHMSNVLAQGGIAFVLLHFARLNETYLLPSSCLITF
RECU_STRA1      IDFEAKETRQKTAMPMKNFHAHQIEHMANVLQQKGICFVLLHFSTLKETYLLPANELISF
RECU_STRA3      IDFEAKETRQKTAMPMKNFHAHQIEHMANVLQQKGICFVLLHFSTLKETYLLPANELISF
RECU_STRA5      IDFEAKETRQKTAMPMKNFHAHQIEHMANVLQQKGICFVLLHFSTLKETYLLPANELISF
RECU_STRPB      VDFEAKETRQKTAMPMKNFHLHQIEHMACVLHQKGICFVLLHFSTLKETYYLPAQALISF
RECU_STRPC      VDFEAKETRQKTAMPMKNFHLHQIEHMACVLHQKGICFVLLHFSTLKETYYLPAQALISF
RECU_STRP8      VDFEAKETRQKTAMPMKNFHLHQIEHMACVLHQKGICFVLLHFSTLKETYYLPAQALISF
RECU_STRPD      VDFEAKETRQKTAMPMKNFHLHQIEHMACVLHQKGICFVLLHFSTLKETYYLPAQALISF
RECU_STRPM      VDFEAKETRQKTAMPMKNFHLHQIEHMACVLHQKGICFVLLHFSTLKETYYLPAQALISF
RECU_STRP3      VDFEAKETRQKTAMPMKNFHLHQIEHMACVLHQKGICFVLLHFSTLKETYYLPAQALISF
RECU_STRPF      VDFEAKETRQKTAMPMKNFHLHQIEHMACVLHQKGICFVLLHFSTLKETYYLPAQALISF
RECU_STRP6      VDFEAKETRQKTAMPMKNFHLHQIEHMACVLHQKGICFVLLHFSTLKETYYLPAQALISF
RECU_STRPG      VDFEAKETRQKTAMPMKNFHLHQIEHMTCVLHQKGICFVLLHFSTLKETYYLPAQALISF
RECU_STRP1      VDFEAKETRQKTAMPMKNFHLHQIEHMACVLHQKGICFVLLHFSTLKETYYLPAQALISF
RECU_STRMU      IDFEAKETRHKTSIPMKNFHAHQIKHMSQVLDQKGICFVLLHFSTLRETYLLPASHLIHF
RECU_STRT2      IDFEAKETRQKTSMPMKNFHAHQIKHMSQVINQDGICFVLLHFSTLKETYLLPAKDLIAF
RECU_STRTD      IDFEAKETRQKTSMPMKNFHAHQIKHMSQVINQDGICFVLLHFSTLKETYLLPAKDLIAF
RECU_STRT1      IDFEAKETRQKTSMPMKNFHAHQIKHMSQVINQDGICFVLLHFSTLKETYLLPAKDLIAF
RECU_STRSY      IDFEAKETRQKASMPMKNFHAHQIEHMKQVVKQGGICFVLLHFSTLKETYLLPATHLIEF
RECU_STRS2      IDFEAKETRQKASMPMKNFHAHQIEHMKQVVKQGGICFVLLHFSTLKETYLLPATHLIEF
RECU_STRSV      IDFEAKETRQKKSMPMKNFHSHQIEHMEAVLEQKGICFVLLHFSSLRETYLLPASYLIEF
RECU_STRPN      IDFEVKETKQKRAIPMKNFHPHQIQHMEQVLAQQGICFVLLHFSSQQETYLLPAFDLIRF
RECU_STRR6      IDFEVKETKQKRAIPMKNFHPHQIQHMEQVLAQQGICFVLLHFSSQQETYLLPAFDLIRF
RECU_STRP2      IDFEVKETKQKRAIPMKNFHPHQIQHMEQVLAQQGICFVLLHFSSQQETYLLPAFDLIRF
RECU_STROR      IDFEAKETRQKHAIPMKNFHHHQIQHMEQVLAQRGICFVLLHFASQQETYLLPAVDLIRF
RECU_LEUMM      IDFDAKETKNKTSFPLKNFHEHQISHLASILSQGGIGFVIIKFTSLNENYVYPASELIQQ
RECU_OENOB      IDFDAKETKNKTNMPLKNFHQHQITHLKNVLENGGIGFLVLGFTTLSEYYIFPASLLIKI
RECU_MYCGE      FDFEAKQTN-KSNFPIAQIAEHQLNHLKRIDQIGGVSFLLIYFQTKDQIFAFHTKDLLET
RECU_UREPA      FDFEAKQTN-KNSFLIKQIQPHQLAHLYLIHKNSGFSFLIICFINYNLYFIITFQQLINY
RECU_MYCPU      IAFEAKSFSGKN-FSLSNIKNHQHEYLEKINKHKGLGFYFFFHEDEEKFYLMESKKLNNL
                . *:.*.      : : ::  **  ::       *. * ..        .      .   

RECU_GEOKA      WNKQEAGGRKSIPKQEIERHGHSIPLGYQPRIDYISVVDNVYFTR--------
RECU_GEOTN      WNEQEAGGRKSIPKREIEQYGHYIPLGYQPRIDYISVVEKVYFTV--------
RECU_BACVZ      WERKENNGRKSIRKDELEDASFPISLGYSPRIDYISIIEQLYFSQEQ------
RECU_BACSU      WDRKEKNGRKSIRKDELEETAYPISLGYAPRIDYISIIEQLYFSPSSGAKG--
RECU_BACLD      WERKKQNGRKSIRKDELQEAAHPISLGYSPRIDYIKIIDQLYFSPS-------
RECU_BACP2      WERQKLNGRKSISKDELMEAGHLMTLGYSPRIDYIKVVETLHFSDESEYQ---
RECU_BACAN      WNRQNTGGRKSITKEEIVEHGSLLSCGYHPRIDYIRVLDTVYFS---------
RECU_BACHK      WNRQNTGGRKSITKEEIVEHGSLLSCGYHPRIDYIRVLDTVYFS---------
RECU_BACCZ      WNRQNTGGRKSITKEEIVEHGSLLSCGYHPRIDYIRVLDTVYFS---------
RECU_BACC1      WNRQNTGGRKSITKEEIVEHGSLLSCGYHPRIDYIRVLDTVYFS---------
RECU_BACAH      WNRQNTGGRKSITKEEIVEHGSLLSCGYHPRIDYIRVLDTVYFS---------
RECU_BACCR      WNRQNTGGRKSITKEEIEEHGSLLSCGYHPRIDYIRVLDMVYFS---------
RECU_BACHD      FETKETK-RKSIPKSYIDSYGHLIKIGYHPRVDYLHVVDQVYFS---------
RECU_BACSK      YD--NQDVRKSIKKTEIERLGHQVKTGLHPPIDYLRTLDAVYFNGDAKERT--
RECU_LISMO      WERMQSGGRKSVTIAEIQDVSDQIPYGLNPRLDFLQSIDKLYF----------
RECU_LISMF      WERMQSGGRKSVTIAEIQDVSDQIPYGLNPRLDFLQSIDKLYF----------
RECU_LISIN      WERMQSGGRKSVTISEIQDVSDQVPYGLNPRLDFLQSIDKLYF----------
RECU_LISW6      WQRMQSGGRKSVTIAEIQDVSDQIPYGLNPRLDFLKSIEKLYF----------
RECU_STAAC      WKRYKDNIKKSITVDEIRKNGYHIPYQYQPRLDYLKAVDKLILDESEDRV---
RECU_STAAS      WKRYKDNIKKSITVDEIRKNGYHIPYQYQPRLDYLKAVDKLILDESEDRV---
RECU_STAA1      WKRYKDNIKKSITVDEIRKNGYHIPYQYQPRLDYLKAVDKLILDESEDRV---
RECU_STAAM      WKRYKDNIKKSITVDEIRKNGYHIPYQYQPRLDYLKAVDKLILDESEDRV---
RECU_STAAW      WKRYKDNIKKSITVDEIRKNGYHIPYQYQPRLDYLKAVDKLILDESEDRV---
RECU_STAAN      WKRYKDNIKKSITVDEIRKNGYHIPYQYQPRLDYLKAVDKLILDESEDRV---
RECU_STAA3      WKRYKDNIKKSITVDEIRKNGYHIPYQYQPRLDYLKAVDKLILDESEDRV---
RECU_STAAU      WKRYKDNIKKSITVDEIRKNGYHIPYQYQPRLDYLKAVDKLILDESEDRV---
RECU_STAAB      WKRYKDNIKKSITVDEIRKNGYHIPYQYQPRLDYLKAVDKLILDESEDRV---
RECU_STAAR      WKRYKDNIKKSITVDEIRKNGYHIPYQYQPRLDYLKAVDKLILDESEDRV---
RECU_STAES      WQRYINNIKKSITVEEIRKNGYHIPYQYQPRLNYLKAVDKLILDESEDRV---
RECU_STAEQ      WQRYINNIKKSITVEEIRKNGYHIPYQYQPRLNYLKAVDKLILDESEDRV---
RECU_STAS1      WERHIQEIKKSVTVEEIRKNGYYIPYQYQPRLNYLKTVDKLILDESEDRV---
RECU_OCEIH      WNLKQDGGKKSIPYDMIRNQSQLIPFHYQKRVDYLAAVDKLYF----------
RECU_LACBA      WDAQQQGGRKSIPYATIAQDGIQIPAELQLPVPYLKAVDQLLS----------
RECU_PEDPA      WDSKENGGRKSIPLSVFEEQGYQLEYQMNPLIPYLKAVDKIIENL--------
RECU_LACS1      WDEQDKS-RKSIPKAEIEQLGYKLNYSISPRIPFLKGVDLLIANS--------
RECU_LACP3      WDRQPDGGRKSIPLKDIVTNGFELHPQLQPVIPFLDGVDWLIETKVGNVRG--
RECU_LACSS      WDNQATGGRKSIPLAAIVADGFEIQYQLNPSIPYLEAVDQLIARHHKGV----
RECU_LACPL      WDHQGDGGRKSIPLTDIEHLAAELHYQINPRIPYLDALDHIIDETSSIH----
RECU_LACRD      WDQQQNGGRKSILRTDIAKEGYQIHYQLNPRLPYLNAVDKIIAAKA-------
RECU_LACDA      WQNWKAAGKSSMTLAEIEANSFEIKSGFCPALPYLEAVDRIIADRKQEHGNK-
RECU_LACDB      WQNWKAAGKSSMTLAEIEANSFEIKSGFCPALPYLEAVDRIIADRKQEHGNK-
RECU_LACAC      WRK---AEKSSMTLKEIESHSYEIKSGFRPTLPYLKAVDNFIADRKRE-----
RECU_LACLM      YYEKN--GLKSIPLAYIRENGYKIETNHIPRIPYLEIVNKLCEVQ--------
RECU_LACLS      YYEKN--GLKSIPLAYIRENGYKIETNHIPRIPYLEIVNKLCEVQ--------
RECU_LACLA      YYEKG--GLKSIPLSHIRENGYKIETNHIPRIPYLEIVNKLCEVQ--------
RECU_STRA1      YQIDK--GNKSMPIDYIRKNGFFVKESAFPQVPYLDIIEEKLLGGDYN-----
RECU_STRA3      YQIDK--GNKSMPIDYIRKNGFFVKESAFPQVPYLDIIEEKLLGGDYN-----
RECU_STRA5      YQIDK--GNKSMPIDYIRKNGFFVKESAFPQVPYLDIIEEKLLGGDYN-----
RECU_STRPB      YQIDN--GSKSMPIDYIRKNGFKVAFGAFPQVPYLNIIEQNFLGGDYN-----
RECU_STRPC      YQIDN--GSKSMPIDYIRKNGFKVAFGAFPQVPYLNIIEQNFLGGDYN-----
RECU_STRP8      YQIDN--GSKSMPIDYIRKNGFKVAFGAFPQVPYLNIIEQNFLGGDYN-----
RECU_STRPD      YQIDN--GSKSMPIDYIRKNGFKVAFGAFPQVPYLNIIEQNFLGGDYN-----
RECU_STRPM      YQIDN--GSKSMPIDYIRKNGFKVAFGAFPQVPYLNIIEQNFLGGDYN-----
RECU_STRP3      YQIDN--GSKSMPIDYIRKNGFKVAFGAFPQVPYLNIIEQNFLGGDYN-----
RECU_STRPF      YQIDN--GSKSMPIDYIRKNGFKVAFGAFPQVPYLNIIEQNFLGGDYN-----
RECU_STRP6      YQIDN--GSKSMPIDYIRKNGFKVAFGAFPQVPYLNIIEQNFLGGDYN-----
RECU_STRPG      YQIDN--GSKSMPIDYIRKNGFKVAFGAFPQVPYLNIIEQNFLGGDYN-----
RECU_STRP1      YQIDN--GSKSMPIDYIRKNGFKVAFGAFPQVPYLNIIEQNFLGGDYN-----
RECU_STRMU      YRIDN--GGKSMPLDYIKKNGYQVNVSAFPQVPYLDIIDKNILGGD-------
RECU_STRT2      YQIDK--GTKSMPLDYIKKRGYAIAESAYPQVPYLEIIEK-LLGGNT------
RECU_STRTD      YQIDK--GTKSMPLDYIKKRGYAIAESAYPQVPYLEIIEK-LLGGNT------
RECU_STRT1      YQIDK--GTKSMPLDYIKKRGYAIAESAYPQVPYLEIIEK-LLGGNT------
RECU_STRSY      YQVDM--GSKSMPLTFIRQYGFEIQMGRFPSIPYLEIVEKNLLGGESFENYNN
RECU_STRS2      YQVDM--GSKSMPLTFIRQYGFEIQMGRFPSIPYLEIVEKNLLGGESFENYNN
RECU_STRSV      YKIDK--GGKSMPLTYIQEHGYPIEMQQLPSIPYLEIIEQKLLGGIINE----
RECU_STRPN      YHQDK--GQKSMPLEYIREYGYEIKAGAFPQIPYLNVIKEHLLGGKTR-----
RECU_STRR6      YHQDK--GQKSMPLEYIREYGYEIKAGAFPQIPYLNVIKEHLLGGKTR-----
RECU_STRP2      YHQDK--GQKSMPLEYIREYGYEIKAGAFPQIPYLNVIKEHLLGGKTR-----
RECU_STROR      YHQDK--GQKSMPLGYIRENGYRIELGAFPQIPYLDIIKEHLLGGKTR-----
RECU_LEUMM      WQHLN--GKQSISYQEIVDKSFVVPESLNPSLDYLTAVDKMLEALH-------
RECU_OENOB      WDKAKAGGEKSLPYKIVSKQGIKINSKMIPSLDYLPALKKLFNI---------
RECU_MYCGE      IKNQE---SKTIKRELIEQKSQKVPLLYPGIIDLISIIQSFKNY---------
RECU_UREPA      YQKTK---RKSIPFQWFKDQCIELEIIFPGVINFKKMINDLKLKYYDD-----
RECU_MYCPU      TK-------KSISIEQIKKNALQIELSFPGIVDFLPWVKSLINN---------
                         .::    .      :       :     :.