CLUSTAL format seed alignment for MF_00133

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

TRPB1_WOLSU      -------------------------------MMHKPYLKSFPNKEGYFGK-------YGG
TRPB2_VIBPA      --------------------------------MKNSFDHNMPNNEGYFGE-------YGG
TRPB_CALS4       -------------------------------------------MKGRFG-------RFGG
TRPB_CLOAB       -------------------------------------------MNGRFG-------KFGG
TRPB_CLOB8       -------------------------------------------MKGRFN-------EFGG
TRPB_FUSNN       --------------------------------------MTTENKKGYFG-------EFGG
TRPB_CLONN       -------------------------------------------MKKQFG-------KFGG
TRPB_LACP3       -------------------------------MKTLNETTQQSTRAGRYGK------DFGG
TRPB_LACCA       -------------------------------MKTLNETTQQSTRAGRYGK------DFGG
TRPB_LACPL       -------------------------------------MIKNQSQAGRYG-------DFGG
TRPB_CAMJR       -------------------------------------------MKKAYYG------DFGG
TRPB_CAMJE       -------------------------------------------MKKAYYG------DFGG
TRPB_CAMJ8       -------------------------------------------MKKAYYG------DFGG
TRPB_CAMJJ       -------------------------------------------MKKAYYG------DFGG
TRPB_CAMJD       -------------------------------------------MKKAYYG------DFGG
TRPB_THET2       --------------------------------MLTLPDFPLPDARGRFGP-------YGG
TRPB_THET8       ------------------MGVVLARGAFRERSMLTLPDFPLPDARGRFGP-------YGG
TRPB_DEIRA       ------------------MSTAKLGCPKLRIMPLSIPSFPLPDARGRYGR-------FGG
TRPB_CHLTE       --------------------------------MKQKVIYSAPDEFGHFGT-------FGG
TRPB1_AQUAE      -------------------------------------MYNYPDERGYFGP-------FGG
TRPB_BRASB       -----------------------------MTTARPNSYRSGPDERGHFGI-------FGG
TRPB_BRASO       -----------------------------MTTAIPNSYRSGPDERGHFGI-------FGG
TRPB_BRADU       -----------------------------MNIAKPNSYRSGPDERGHFGI-------FGG
TRPB_PARL1       -----------------------------MSVNKANSFRSGPDERGRFGI-------FGG
TRPB_CAUVC       ----------------------------MNAPAKPNDYSAYPDAEGRFGG-------FGG
TRPB_ACICJ       -----------------------------MNKPIPNSLRTLPDDRGRFGE-------FGG
TRPB_NOVAD       -----------------------------MTAQTPNSFRNLPDERGHFGQ-------FGG
TRPB_RHOS4       -----------------------------MAEDGINSYMTGPDEQGRFGI-------FGG
TRPB_RUEST       -----------------------------MAEDLINSFMNGPDENGRFGI-------FGG
TRPB_RUEPO       -----------------------------MANDLFNSFMSGPDEQGRFGI-------FGG
TRPB_DINSH       -----------------------------MPDDLINSFMTGPDENGRFGD-------FGG
TRPB_ROSDO       -----------------------------MANDLFNSFMTGPDENGRFGD-------FGG
TRPB_JANSC       -----------------------------MPDDLLNSFMTGPDEKGRFGD-------FGG
TRPB_PARDP       -----------------------------MAEDLINSFMTGPDEQGRFGI-------FGG
TRPB_BRUSU       ----------------------------MNKPVAPNSYKTGPDEEGMFGI-------FGG
TRPB_BRUC2       ----------------------------MNKPVAPNSYKTGPDEEGMFGI-------FGG
TRPB_BRUSI       ----------------------------MNKPVAPNSYKTGPDEEGMFGI-------FGG
TRPB_BRUAB       ----------------------------MNKPVAPNSYKTGPDEEGMFGI-------FGG
TRPB_BRUA2       ----------------------------MNKPVAPNSYKTGPDEEGMFGI-------FGG
TRPB_BRUME       ----------------------------MNKPVAPNSYKTGPDEEGMFGI-------FGG
TRPB_OCHA4       ----------------------------MNKPVAPNSYKTGPDEEGMFGI-------FGG
TRPB_RHILO       ----------------------------MDQPATPNSFRTGPDEQGMFGI-------FGG
TRPB_RHIEC       ----------------------------MNETPKPNSFRSGPDEDGRFGI-------YGG
TRPB_RHIL3       ----------------------------MNETPKPNSFRSGPDEDGRFGI-------YGG
TRPB_SINMW       ----------------------------MNQPPKPNSFRSGPDEEGRFGI-------FGG
TRPB_RHIME       ----------------------------MNQPPKPNSFRSGPDEEGRFGI-------FGG
TRPB_AGRFC       ----------------------------MNDAPTPNSFRAGPDEDGRFGI-------YGG
TRPB_CHESB       ----------------------------MNKPVEPNSFRTGPDEQGMFGI-------FGG
TRPB_PSEPF       ----------------------------MTQTSNNSDLRNGPDANGLFGS-------FGG
TRPB_PSESY       ----------------------------MTQS--QTDLRNGPDATGMFGA-------FGG
TRPB_PSEF5       ----------------------------MTQS----QLRNGPDDNGLFGA-------FGG
TRPB_PSEAE       ----------------------------MTSY------RNGPDAKGLFGR-------FGG
TRPB_PSESH       ----------------------------MTQT----NFRSGPDVNGLFGS-------FGG
TRPB_PSE14       ----------------------------MTQT----NFRSGPDVNGLFGS-------FGG
TRPB_PSEU2       ----------------------------MTQT----NFRSGPDANGLFGS-------FGG
TRPB_PSESM       ----------------------------MTQT----NFRSGPDANGLFGS-------FGG
TRPB_PSEPU       ----------------------------MTQS----QYRPGPDANGLFGS-------FGG
TRPB_PSEPG       ----------------------------MTQS----QYRPGPDANGLFGS-------FGG
TRPB_PSEPK       ----------------------------MTQS----QYRPGPDANGLFGS-------FGG
TRPB_PSEP1       ----------------------------MTQS----QYRPGPDANGLFGS-------FGG
TRPB_PSEE4       ----------------------------MTQT----QYRAGPDANGLFGS-------FGG
TRPB_ACICA       ----------------------------------MIDYTQYPDARGHFGI-------HGG
TRPB_ACIAD       ----------------------------------MIDYTQYPDARGHFGI-------HGG
TRPB_LEGPA       -----------------------------------MIKKELPDEFGHFGP-------YGG
TRPB_LEGPL       -----------------------------------MIKKELPDEFGHFGP-------YGG
TRPB_LEGPH       -----------------------------------MIKKELPDEFGHFGP-------YGG
TRPB_LEGPC       -----------------------------------MIKKELPDEFGHFGP-------YGG
TRPB_BORBR       -----------------------------------MKPYDLPDARGHFGP-------YGG
TRPB_BORPA       -----------------------------------MKPYDLPDARGHFGP-------YGG
TRPB_BORPE       -----------------------------------MKPYDLPDARGHFGP-------YGG
TRPB_RALSO       -------------------------------MPREIAMYNLPDAHGHFGP-------YGG
TRPB_POLNA       -----------------------------------MYDYHQPDLAGHFGI-------YGG
TRPB_POLSJ       -----------------------------------MFDYHQPDPTGHFGI-------YGG
TRPB_ACIAC       -----------------------------------MLSYQQPDASGHFGR-------YGG
TRPB_METPP       -----------------------------------MLNYQQPDASGHFGR-------YGG
TRPB_METFK       -----------------------------------MQLYDMPDKRGHFGP-------YGG
TRPB_NITEU       -------------------------------------MYDLPDKRGHFGP-------YGG
TRPB_NITEC       -----------------------------------MKMYDLPDKRGHFGP-------YGG
TRPB_NITMU       -----------------------------------MKVYDLPDSHGHFGP-------YGG
TRPB_METCA       -----------------------------MIMQDEIQPYDLPDELGHFGP-------YGG
TRPB_XANAC       -----------------------------MSAQPISDFYAYPDAAGHFGQ-------FGG
TRPB_XANC5       -----------------------------MSAQPISDFYAYPDAAGHFGK-------FGG
TRPB_XANOM       -----------------------------MSAQPISDFYAYPDAAGHFGK-------FGG
TRPB_XANCP       -----------------------------MSAQPISDFHAYPDAAGHFGK-------FGG
TRPB_XANC8       -----------------------------MSAQPISDFHAYPDAAGHFGK-------FGG
TRPB_XYLFA       -----------------------------MSDVTVANYHAFPDARGHFGR-------YGG
TRPB_XYLFT       -----------------------------MSDITVANYHAFPDARGHFGR-------YGG
TRPB_VESOH       -----------------------------------MSNYNLPDDNGHFDK-------YGG
TRPB_RUTMC       -----------------------------------MSSYNLPDDKGHFEQ-------YGG
TRPB_NEIG1       -----------------------------------MKNYHAPDEKGFFGE-------HGG
TRPB_NEIGO       -----------------------------------MKNYHAPDEKGFFGE-------HGG
TRPB_NEIMF       -----------------------------------MKNYHAPDEKGFFGE-------HGG
TRPB_NEIMA       -----------------------------------MKNYHAPDEKGFFGE-------HGG
TRPB_NEIMB       -----------------------------------MKNYHAPDEKGFFGE-------HGG
TRPB_NEIM0       -----------------------------------MKNYHAPDEKGFFGE-------HGG
TRPB_CHRVO       -----------------------------------MDRYDFPDAQGHFGP-------YGG
TRPB_RHOBA       ---------------------------MSTAPSQQHASAQVPDPRGRFGD-------FGG
TRPB_GEOSE       -------------------------------------MERVPNEHGRFGD-------FGG
TRPB_GEOTN       -------------------------------------MEHVPNEHGRFGD-------FGG
TRPB_BACVZ       -------------------------------------MYPYPNEIGRYGE-------FGG
TRPB_BACSU       -------------------------------------MYPYPNEIGRYGD-------FGG
TRPB_BACLD       -------------------------------------MYSYPNEQGRFGD-------FGG
TRPB_BACP2       -------------------------------------MYAYPNELGRYGE-------FGG
TRPB_BACHD       ------------------------------------MTVTYPDERGRFGT-------FGG
TRPB_BACSK       ------------------------------------MQETIPDSRGRFGE-------FGG
TRPB_BACAN       ------------------------------------MNYAYPDEKGHYGI-------YGG
TRPB_BACHK       ------------------------------------MNYAYPDEKGHYGI-------YGG
TRPB_BACAH       ------------------------------------MNYAYPDEKGHYGI-------YGG
TRPB_BACCZ       ------------------------------------MNYAYPDEKGHYGI-------YGG
TRPB_BACCR       ------------------------------------MNYAYPDEKGHYGI-------YGG
TRPB_BACC1       ------------------------------------MNYAYPDEKGHYGI-------YGG
TRPB_OCEIH       -----------------------------------MTTYSFPNTKGKYGE-------FGG
TRPB_LACLS       ------------------------------------MTYNQPNNQGFYGQ-------FGG
TRPB_LACLM       ------------------------------------MTYNQPNNQGFYGQ-------FGG
TRPB_LACLA       ------------------------------------MTYNQPNNKGFYGQ-------FGG
TRPB_STRR6       ------------------------------------MAYQEPNKDGFYGK-------FGG
TRPB_STRP2       ------------------------------------MAYQEPNKDGFYGK-------FGG
TRPB_STRPN       ------------------------------------MAYQEPNKDGFYGK-------FGG
TRPB_STRT2       ------------------------------------MTYQQPDAKGFYGK-------FGG
TRPB_STRT1       ------------------------------------MTYQQPDAKGFYGK-------FGG
TRPB_STRTD       ------------------------------------MTYQQPDAKGFYGK-------FGG
TRPB_STRMU       ------------------------------------MTYNQPNNNGFYGN-------FGG
TRPB_LISMF       ------------------------------------MTYQAPDENGFYGK-------FGG
TRPB_LISMO       ------------------------------------MTYQAPDENGFYGK-------FGG
TRPB_LISIN       ------------------------------------MTYQAPDENGFYGK-------FGG
TRPB_LISW6       ------------------------------------MTYQAPDENGFYGK-------FGG
TRPB_STAAN       ---------------------------------MNKQIQTEADELGFFGE-------YGG
TRPB_STAA1       ---------------------------------MNKQIQTEADELGFFGE-------YGG
TRPB_STAAM       ---------------------------------MNKQIQTEADELGFFGE-------YGG
TRPB_STAA9       ---------------------------------MNKQIQTEADELGFFGE-------YGG
TRPB_STAA2       ---------------------------------MNKQIQTEADELGFFGE-------YGG
TRPB_STAAR       ---------------------------------MNKQIQTEADELGFFGE-------YGG
TRPB_STAAB       ---------------------------------MNKQIQTEADELGFFGE-------YGG
TRPB_STAAE       ---------------------------------MNKQIQTEADELGFFGE-------YGG
TRPB_STAA8       ---------------------------------MNKQIQTEADELGFFGE-------YGG
TRPB_STAA3       ---------------------------------MNKQIQTEADELGFFGE-------YGG
TRPB_STAAW       ---------------------------------MNKQIQTEADELGFFGE-------YGG
TRPB_STAAT       ---------------------------------MNKQIQTEADELGFFGE-------YGG
TRPB_STAAC       ---------------------------------MNKQIQTEADELGFFGE-------YGG
TRPB_STAAS       ---------------------------------MNKQIQTEADELGFFGE-------YGG
TRPB_STAS1       ---------------------------------MVENIQTEADAFGFFGN-------YGG
TRPB_STAEQ       -----------------------------------MKIQTEVDELGFFGE-------YGG
TRPB_STAES       -----------------------------------MKIQTEVDELGFFGE-------YGG
TRPB_LEPIC       -----------------------------------MGKENQ---QGYFGE-------FGG
TRPB_LEPIN       -----------------------------------MGKENQ---QGYFGE-------FGG
TRPB_LEPBJ       -----------------------------------MGKVRHSPKEGYFGE-------FGG
TRPB_LEPBL       -----------------------------------MGKVRHSPKEGYFGE-------FGG
TRPB2_NOSS1      -------------------------MTTTPLSPSTPSNVQVPDIQGRFGR-------FGG
TRPB_TRIV2       -------------------------MTTTPLSPSTPSNAQVPDIQGRFGR-------FGG
TRPB1_NOSS1      ----------------------------MVSTPEIKNQLARPDALGRFGK-------FGG
TRPB_TRIEI       ----------------------------MTITPLNPTSTQQPDSLGRFGK-------FGG
TRPB_THEEB       ---------------------------MTVAPSAALSAAARPDARGRFGR-------FGG
TRPB_SYNY3       ---------------------------MNITSPLSAPSHQYPDALGRFGN-------YGG
TRPB_SYNJB       --------------------MTSASFAFSPRVLDPLDPQVRPDPQGRFGP-------FGG
TRPB_GLOVI       ----------------------MSFTIQTVTFTAPQPLGALPDSRGRFGR-------FGG
TRPB_PROM1       --------------------MTGTLP--TQFKDSDLSPLTRPNALGRFGK-------YGG
TRPB_PROMT       --------------------MTGTLP--TQFKDSDLSPLTRPNTLGRFGK-------YGG
TRPB_PROMA       --------------------MTGTIP--SNSQDPDLVLSARPSAHGRFGR-------FGG
TRPB_SYNPW       --------------------MTSTLP--SQPSASDLAVSSRPAAAGRFGR-------YGG
TRPB_PROMM       MLLGVILSIPRLVLFLPGVPVTSTLP--SQPKDADLAVSARPSAQGRFGR-------YGG
TRPB_SYNSC       --------------------MTSTLPNASTPDPSSLQPAVRPGAHGRFGR-------FGG
TRPB_SYNPX       --------------------MTSTLPNASTPDPASLQPSVRPGAHGRFGR-------FGG
TRPB_SYNS9       --------------------MTSTLPKASQPDPSSLQPSARPGAHGRFGR-------FGG
TRPB_SYNS3       --------------------MTSTLPTANTPDPASLMPSVRPEAHGRYGR-------YGG
TRPB_PROMP       --------------------MVSTIS--RQDQN-NNDDLNQPSKEGRFGK-------YGG
TRPB_PROM5       --------------------MVSTIS--RHDQNKNNDYLNQPSKEGRFGK-------YGG
TRPB_PROMS       --------------------MVSTFS--RKDQNYKNDDLNQPSIEGRFGK-------YGG
TRPB_PROM0       --------------------MVSTFS--RKDQNYKNDDLNQPSKEGRFGK-------YGG
TRPB_PROM9       --------------------MVSTFS--RQDQNYKNDDLNQPSKEGRFGK-------YGG
TRPB_PROM2       --------------------MVSTFS--RKNQNYKKDDLNQPSKDGRFGK-------YGG
TRPB_MYCTU       -----------------MMTDLSTPDLPRMSAAIAEPTSHDPDSGGHFGGPS----GWGG
TRPB_MYCBO       -----------------MMTDLSTPDLPRMSAAIAEPTSHDPDSGGHFGGPS----GWGG
TRPB_MYCLE       ----------------------MMPNLSCFSVAISEPTCHDPDSGGHFGGPD----GYGG
TRPB_MYCIT       ----------------MDISPRTRPDLPLPSAAIAEPTRHEPDAGGHFG-------VYGG
TRPB_STRAW       ---------------------------MSSEFFIPDPEGQVPTAEGYFGA-------FGG
TRPB_STRCO       ---------------------------MPSNFFIPDPEGQVPSAEGYFGA-------FGG
TRPB_LEIXX       -------------------------------MPLRSEEG------PYFGD-------FGG
TRPB_SHIFL       ---------------------------------------MTTLLNPYFGE-------FGG
TRPB_ECOLC       ---------------------------------------MTTLLNPYFGE-------FGG
TRPB_SHIF8       ---------------------------------------MTTLLNPYFGE-------FGG
TRPB_ECOLI       ---------------------------------------MTTLLNPYFGE-------FGG
TRPB_ECO24       ---------------------------------------MTTLLNPYFGE-------FGG
TRPB_ECOHS       ---------------------------------------MTTLLNPYFGE-------FGG
TRPB_SHISS       ---------------------------------------MTTLLNPYFGE-------FGG
TRPB_ECO57       ---------------------------------------MTTLLNPYFGE-------FGG
TRPB_SHIBS       ---------------------------------------MTTLLNPYFGE-------FGG
TRPB_ECOK1       ---------------------------------------MTTLLNPYFGE-------FGG
TRPB_ECOUT       ---------------------------------------MTTLLNPYFGE-------FGG
TRPB_SHIDS       ---------------------------------------MTTLLNPYFGE-------FGG
TRPB_ECOL5       ---------------------------------------MTTLLNPYFGE-------FGG
TRPB_ECOL6       ---------------------------------------MTTLLNPYFGE-------FGG
TRPB_CITK8       ---------------------------------------MTTLLNPYFGE-------FGG
TRPB_SALTY       ---------------------------------------MTTLLNPYFGE-------FGG
TRPB_SALPB       ---------------------------------------MTTLLNPYFGE-------FGG
TRPB_SALTI       ---------------------------------------MTTLLNPYFGE-------FGG
TRPB_SALPA       ---------------------------------------MTTLLNPYFGE-------FGG
TRPB_SALCH       ---------------------------------------MTTLLNPYFGE-------FGG
TRPB_SALAR       ---------------------------------------MTTLLNPYFGE-------FGG
TRPB_CROS8       ---------------------------------------MSTLLNPYFGE-------FGG
TRPB_KLEP7       ---------------------------------------MSTLLNPYFGE-------FGG
TRPB_ENT38       ---------------------------------------MTTLLNPYFGE-------FGG
TRPB_PECAS       ----------------------------------------MTLLNPYFGE-------FGG
TRPB_YERPA       ----------------------------------------MTTLNPYFGE-------FGG
TRPB_YERPS       ----------------------------------------MTTLNPYFGE-------FGG
TRPB_YERPN       ----------------------------------------MTTLNPYFGE-------FGG
TRPB_YERPP       ----------------------------------------MTTLNPYFGE-------FGG
TRPB_YERP3       ----------------------------------------MTTLNPYFGE-------FGG
TRPB_YERPE       ----------------------------------------MTTLNPYFGE-------FGG
TRPB_YERE8       ----------------------------------------MTTLNPYFGE-------FGG
TRPB_SERP5       ----------------------------------------MTLLNPYFGE-------FGG
TRPB_SODGM       ----------------------------------------MTRLNPYFGE-------FGG
TRPB_PHOLL       ----------------------------------------MSKLNPYFGD-------FGG
TRPB_HAEIN       --------------------------------------MSDTLLNPYFGE-------FGG
TRPB_HAEIE       --------------------------------------MSDTLLNPYFGE-------FGG
TRPB_HAEIG       --------------------------------------MSDTLLNPYFGE-------FGG
TRPB_HAEI8       --------------------------------------MSDTLLNPYFGE-------FGG
TRPB_ACTSZ       --------------------------------------MSDTILNPYFGE-------FGG
TRPB_HISS2       --------------------------------------MMGTILNPYFGE-------FGG
TRPB_ACTP2       --------------------------------------MSDTLLNPYFGE-------FGG
TRPB_PASMU       --------------------------------------MSETLLNPYFGE-------FGG
TRPB_MANSM       --------------------------------------MTDTILDPYFGE-------FGG
TRPB_BUCAP       ----------------------------------------MTLLNPYFGK-------FGG
TRPB_BUCAI       ----------------------------------------MTLLNPYFGE-------FGG
TRPB_BUCDN       ----------------------------------------MTLLNPYFGK-------FGG
TRPB_BUCMH       ----------------------------------------MTLLNSYFGD-------FGG
TRPB_BUCSC       ----------------------------------------MTLLNSYFGS-------FGG
TRPB_BUCBP       ----------------------------------------MTLLKSYFGE-------FGG
TRPB_BLOPB       ----------------------------------------MIKLKSYFGE-------FGG
TRPB_BLOFL       ---------------------------------------MTQQLHSYFGE-------FGG
TRPB1_VIBPA      ----------------------------------------MAKLNAYFGE-------YGG
TRPB_VIBCB       ----------------------------------------MAKLNAYFGE-------YGG
TRPB_VIBVU       ----------------------------------------MTKLNAYFGE-------YGG
TRPB_VIBVY       ----------------------------------------MTKLNAYFGE-------YGG
TRPB_ALIF1       ----------------------------------------MAKLDAYFGE-------YGG
TRPB_VIBC3       ----------------------------------------MAKLNAYFGE-------FGG
TRPB_VIBCH       ----------------------------------------MAKLNAYFGE-------FGG
TRPB_VIBME       ----------------------------------------MAKLNAYFGE-------YGG
TRPB_PHOPR       ----------------------------------------MSKLDAYFGE-------FGG
TRPB_FRAT1       ----------------------------------------MSKLNAYFGE-------YGG
TRPB_FRATT       ----------------------------------------MSKLNAYFGE-------YGG
TRPB_FRATH       ----------------------------------------MSKLNAYFGE-------YGG
TRPB_FRATF       ----------------------------------------MSKLNAYFGE-------YGG
TRPB_FRATO       ----------------------------------------MSKLNAYFGE-------YGG
TRPB_FRATW       ----------------------------------------MSKLNAYFGE-------YGG
TRPB_FRATN       ----------------------------------------MSKLNAYFGE-------YGG
TRPB_FRAP2       ----------------------------------------MSKLNAYFGE-------YGG
TRPB_AERHH       ----------------------------------------MTLLNPFFGE-------FGG
TRPB_AERS4       ----------------------------------------MTLLNPFFGE-------FGG
TRPB_PSYIN       ----------------------------------------MEKLNPYFGQ-------FGG
TRPB_SHEPA       ----------------------------------------MSKLNPYFGE-------YGG
TRPB_SHEHH       ----------------------------------------MSKLNPYFGE-------YGG
TRPB_SHELP       ---------------------------------------MMTKLDPYFGE-------YGG
TRPB_SHESM       --------------------------------------MSQLKLNPYFGE-------YGG
TRPB_SHESA       --------------------------------------MSQLKLNPYFGE-------YGG
TRPB_SHESR       --------------------------------------MSQLKLNPYFGE-------YGG
TRPB_SHEON       --------------------------------------MSQLKLNPYFGE-------YGG
TRPB_SHEB8       --------------------------------------MSKLKLNPYFGE-------YGG
TRPB_SHEB5       --------------------------------------MSKLKLNPYFGE-------YGG
TRPB_SHESW       --------------------------------------MSTLKLNPYFGE-------YGG
TRPB_SHEPC       --------------------------------------MSTLKLNPYFGE-------YGG
TRPB_SHEB9       --------------------------------------MSKLKLNPYFGE-------YGG
TRPB_SHEFN       --------------------------------------MTELKLNPYFGE-------YGG
TRPB_SHEDO       --------------------------------------MTELKLDPYFGE-------YGG
TRPB_SHEAM       --------------------------------------MSELKLDPYFGE-------YGG
TRPB_PSEA6       ----------------------------------------MNHLESKFGQ-------FGG
TRPB_HELPY       -----------------------------------------MNKKAYFGE-------FGG
TRPB_HELPJ       -----------------------------------------MNQKAYFGE-------FGG
TRPB_CORGL       -------------------------------MTEKENLGGSTLLPAYFGE-------FGG
TRPB_CORGB       -------------------------------MTEKENLGGSTLLPAYFGE-------FGG
TRPB1_COREF      -------------------------------MTDNKNLGGSTLLPAYFGE-------FGG
TRPB2_COREF      -------------------------------MTTPATPTRQTLLDAYFGE-------YGG
TRPB_METJA       ------------------------------MSILKKYKDMYPDENGKFGI-------YGG
TRPB_METKA       -------------------------------------MDRYPDENGYFGE-------YGG
TRPB1_METTH      -----------------------------------------MIMDGKFGK-------YGG
TRPB2_METTM      -------------------------------------------MDGKFGK-------YGG
TRPB1_METMA      ---------------------------------MAAAIISELQVKGKYGK-------YGG
TRPB1_METAC      ---------------------------------MTETKVSEFQLKGKYGK-------YGG
TRPB_HALVD       -----------------------------------------MSADGKFGD-------YGG
TRPB_HALSA       ---------------------------------MSTNTDDTTRTDGTFGD-------YGG
TRPB1_THEMA      -------------------------------------------MKGYFGP-------YGG
TRPB_METVO       -----------------------------------MKCNTKCDKNGYFGE-------FGG
TRPB_META3       -------------------------------------------MEYKFGE-------YGG
TRPB1_PYRFU      ---------------------------------------------MWFGE-------FGG
TRPB1_PYRAB      ---------------------------------------------MWFGK-------FGG
TRPB1_THEKO      ------------------------------------------MDDMFFGR-------FGG
TRPB1_ARCFU      --------------------------------MRCWLENLSGGRKMKFGE-------FGG
TRPB2_CHLCV      --------------------------------------------MKHPYP-------FGG
TRPB1_CHLCV      ------------------------MYTCDTCEEDLDLSLDLGETYEELET-------YGG
TRPB2_WOLSU      -----------------------------MTMFMPTPSQFDPDERGHFGK-------FGG
TRPB_BACTN       ------------------------------------MKSFLVDQDGYYGE-------FGG
TRPB_HELHP       ----------------------------------MKKKIFTESKNGYFGEAKGGNHAFGG
TRPB2_AQUAE      ----------------------MRKFLLSEGEIPKKWLNILPLLPEPLEP--PLDPETME
TRPB2_ARCFU      -----------------MLSWCMKKIMLDESEMPKEWYNVLPDLPEPLPP--PLHPATQE
TRPB2_METMA      ----------MYRNVTQEIFMEQTKIILDENEMPKRWYNVLSDLPSPIDP--PLDPRTWQ
TRPB2_METAC      ----------MYRNDVKEISMEQTKIILDENEMPKKWYNVLADLPSPIDP--PLDPRTWQ
TRPB2_THEMA      ---------------------MRIVVNLKPEEIPKHWYNVLADLPFKLDP--PLDPETKQ
TRPB2_METTH      ---------------------MMNKIVLDENEIPKKWYNINPDLPSPLPE--PKNPEGGK
TRPB2_PYRAB      -----------------------MKVVLPDGRIPRRWYNILPDLPEPLDP--PLDPETEE
TRPB2_PYRFU      -----------------------MKVVLPDGRIPRRWYNILPDLPEPLAP--PLDPETNE
TRPB_PYRHO       ------------MIVFGSKAEIHAKSILKDGEIPKRWYNILPDLPEPLSP--PLDPETNE
TRPB2_THEKO      -----------------------MKAVLPDSKIPKRWYNILPDLPEPLAP--PLDPETDE
TRPB2_AERPE      ------------------MDLARYRFDLSIEEVPTSWYNILPDLPEEVPP--PLNPKTGE
TRPB1_SACS2      -------------------------MVKEDEILPKYWYNIIPDLPKPLPP--PRDPQGAY
TRPB1_SULTO      -------------------------MVNKD-LIPKYWYNIIPDLPKPLPP--PRDPPDAE
TRPB_PICTO       -------------------MSEEFKSLLSSDIIPENWYNVTPDLPEPLPP--PRD-TKSD
TRPB2_SACS2      -------------------MAMRIRIDLPQDEIPAQWYNILPDLPEELPP--PQDPTGKS
TRPB2_SULTO      -------------------MLEKVRFDLPQDEIPTEWYNILPDLPEPLPE--PQDPTGKS
TRPB_THEAC       ----------------------MIRIDLKQDEMPDHWYNILPDLPEELPT--PRDETGEA
TRPB_THEVO       ----------------------MIRIDLKQDDMPDHWYNILPDLPEELPT--PRDETGEA
TRPB1_AERPE      -----------------------------MVSVPLRWYNIAADLPEPLPP--LRDPEGLR
TRPB_PYRAE       -----------------------------MVD---RWYNIAADLPSVLAP--PRDPD--E
                                                                             

TRPB1_WOLSU      AYLPPLLIEHFKEIGEAYLKISQSFD--FIQELKSIRKHYQGRPTPLYYARRLSQKAGG-
TRPB2_VIBPA      SFVPPELEQIMRDINAAYEECCQDPE--FKDELARLYKHFVGRPSPIFHAANLSKKYG--
TRPB_CALS4       QYVPETVMNALIELEREFEEAKKDEK--FMEEYRYYLKEYSGRPTPLYYAENLTKRLGG-
TRPB_CLOAB       QYVPETLMNAINELEVEFNKAINDEK--FMMEYKYYLEKYVGRETPLYFAENMTKNLGG-
TRPB_CLOB8       QYVPETVMNALIELEDAYNKVIDDKE--FMDEYMYYLNYYTGRPSPLYYAENMTKDLGG-
TRPB_FUSNN       SYVPEVVQKALDKLEEAYNKYKDDEE--FLKEYHHYLKNYSGRETPLYFAESLTNYLGG-
TRPB_CLONN       QYVSKELTSTLKNLEENFFKYCNDDD--FKKEYIYYLNNYIGRPSLLYYAKRLTKSLGG-
TRPB_LACP3       QYIPETLMTELEKVTKAFNDLKDNPE--FKAELNDLLVNYANRPSLLYYAKNMTEDLGG-
TRPB_LACCA       QYIPETLMTELEKVTKAFNDLKDNPE--FKAELNDLLVNYANRPSLLYYAKNMTEDLGG-
TRPB_LACPL       QYVPETLMTELQRLDRAFQHYRQDAH--FQEELTDLLNNYANRPSLLYHAQRLSDQLGG-
TRPB_CAMJR       QFLPESAMFALNELEGAFLKFSKDKL--FKKELNELLKTYVGRPTPLYFARNLSKKYQ--
TRPB_CAMJE       QFLPESAMFALNELEGAFLKFSKDKL--FKKELNELLKTYVGRPTPLYFARNLSKKYQ--
TRPB_CAMJ8       QFLPESAMFALNELEGAFLKFSKDKL--FKKELNELLKTYVGRPTPLYFARNLSKKYQ--
TRPB_CAMJJ       QFLPESAMFALNELEGAFLKFSKDKL--FKKELNELLKTYVGRPTPLYFARNLSKKYQ--
TRPB_CAMJD       QFLPESAMFALNELENAFLKFSKDKF--FKKELSELLKTYVGRPTPLYFARNLSKKYQ--
TRPB_THET2       RYVPETLIPALEELEAAYREAKKDPA--FLEELDHYLRQFAGRPTPLYHAKRLSEYW---
TRPB_THET8       RYVPETLIPALEELEAAYREAKKDPA--FLEELDHYLRQFAGRPTPLYHAKRLSEYW---
TRPB_DEIRA       RYVPETLIPALDELEQAYEAAKQDPE--FLDELDRLLREFVGRPNSLYLAERLTEHA---
TRPB_CHLTE       KFIPETLVKNAADLEEEYLKAKNDPE--FHQTLDNLLRHYVGRPTPLYHASRLSEKQ---
TRPB1_AQUAE      KFVPETLMYALEELEEKYRELKSDPE--FQKELDYYLREYAGRPTPLYFAEKLTKYV---
TRPB_BRASB       RFVAETLMPLILDLEKAYADAKADPA--FQAEMNSYRTHYVGRPSPLYYAERLTQHL---
TRPB_BRASO       RFVAETLMPLILDLEKAYADAKADPA--FQGEMNSYRTHYVGRPSPLYYAERLTEHL---
TRPB_BRADU       RFVAETLMPLILDLEKAYTAAKADPA--FQAEMNGYLKNYVGRPSPLYFAERLTEHL---
TRPB_PARL1       RFVAETLMPLVLELDKAYAAAKADPA--FQAEIDFMQRDYVGRPSPLYLAARLTEHF---
TRPB_CAUVC       RYVAETLMPLVLDLGKAYADAKADPE--FQAQLKSYNTHYAGRPSPLYFAERLTEHF---
TRPB_ACICJ       RFVAETLMPLILELEAAYEAAKDDPD--FMREFQYYLQHYVGRPSPLWFAERLTKEL---
TRPB_NOVAD       RYVAETLMPLILDLEREYNAAKADPA--FKAEFDDLLEHYVGRPSPLYFAPRLTEEL---
TRPB_RHOS4       RFVSETLMPLILDLEARYEHAKTDPD--FWAEMDDLWKNYVGRPSPLYFAPRLTEHL---
TRPB_RUEST       RFVSETLMPLILSLEEEYEKAKVDPD--FWAEMDDLWKNYVGRPSPLYFAERLTNHL---
TRPB_RUEPO       RFVSETLMPLILSLEEEYEKAKTDPS--FWAEMDDLWTNYVGRPSPLYFAERLTEHL---
TRPB_DINSH       RFVSETLMPLILELERQYEFAKTDQA--FWDEMHHLWTHYVGRPSPLYFAERLTERL---
TRPB_ROSDO       RFVSETLMPLILELEEQYENAKTDES--FWAEMNDLWTHYVGRPSPLYFAERLTDHL---
TRPB_JANSC       RFVSETLMPLILELEQQYEHAKTDDS--FWAEMQDLWTHYVGRPSPLYFAKRLTERL---
TRPB_PARDP       RFVSETLMPLILDLEAEYERAKDDAS--FWAEMDDLWKHYVGRPSPLYFAPRLTEEL---
TRPB_BRUSU       RFVAETLMPLILELQQAYETAKNDPE--FKAELNALSTFYAGRPSKLYYAEGLSKHL---
TRPB_BRUC2       RFVAETLMPLILELQQAYETAKNDPE--FKAELNALSTFYAGRPSKLYYAEGLSKHL---
TRPB_BRUSI       RFVAETLMPLILELQQAYETAKNDPE--FKAELNALSTFYAGRPSKLYYAEGLSKHL---
TRPB_BRUAB       RFVAETLMPLILELQQAYETARNDPE--FKAELNALSTFYAGRPSKLYYAEGLSKHL---
TRPB_BRUA2       RFVAETLMPLILELQQAYETARNDPE--FKAELNALSTFYAGRPSKLYYAEGLSKHL---
TRPB_BRUME       RFVAETLMPLILELQQAYETAKNDPE--FKAELNALSTFYAGRPSKLYYAEGLSKHL---
TRPB_OCHA4       RFVAETLMPLILELQEAYETAKNDPE--FKAELNALSTYYAGRPSKLYYAEGLTKHL---
TRPB_RHILO       RFVAETLMPLILDLERHWNEVKNDPD--FRAELTDLSTHYAGRPSKLYFAEGLTKHLREV
TRPB_RHIEC       RFVAETLMPLILDLQDEWNKAKSDPA--FQAELKHLGAHYIGRPSPLYFAERLTAELG--
TRPB_RHIL3       RFVAETLMPLILDLQDEWNRAKNDPA--FQAELKHLGAHYIGRPSPLYFAERLTAEL---
TRPB_SINMW       RFVAETLMPLILDLQDEWARAKNDPA--FKAELENLGRHYIGRPSPLYFAERLTAEL---
TRPB_RHIME       RFVAETLMPLILDLQDEWARAKNDPA--FKAELENLGTHYIGRPSPLYFAERLTAEL---
TRPB_AGRFC       RFVAETLMPLILDLQAEWDKAKSDPE--FQAELKYLGTHYTGRPSPLYFAERLTAEL---
TRPB_CHESB       RFVAETLMPLILELEEHWNAAKNDPA--FKAELQQLGAHYTGRPSPLYFAERLTEHL---
TRPB_PSEPF       RYVAETLMPLILDLAREYEAAKEDPA--FKEELAYFQRDYVGRPSPLYFAERLTEFC---
TRPB_PSESY       RYVAETLMPLILDLAREYEAAKEDPA--FKEELAYFQRDYVGRPSPLYFAERLTEFC---
TRPB_PSEF5       RYVAETLMPLILDLAREYEKAKEDPE--FLKELAYFQRDYVGRPSPLYFAERLTEHC---
TRPB_PSEAE       QYVAETLMPLILDLAREYEKAKDDPA--FQEELAYFQRDYVGRPSPLYFAERLTEHC---
TRPB_PSESH       RYVAETLMPLVLDLNREYEAAKADPE--FAKEMAYFQRDYVGRPNPLYFAERLTEFC---
TRPB_PSE14       RYVAETLMPLVLDLNREYEAAKADPE--FAKEMAYFQRDYVGRPNPLYFAERLTEFC---
TRPB_PSEU2       RYVAETLMPLVLDLNREYEAAKADPE--FIKEMAYFQRDYVGRPNPLYFAERLTEFC---
TRPB_PSESM       RYVAETLMPLVLDLNREYEAAKADPE--FIKEMAYFQRDYIGRPNPLYFAERLTEFC---
TRPB_PSEPU       RYVAETLMPLVLDLAREYEAAKADPK--FLEELAYFQRDYIGRPNPLYFAERLTEHC---
TRPB_PSEPG       RYVAETLMPLVLDLAREYEAAKADPK--FLEELAYFQRDYIGRPNPLYFAERLTEHC---
TRPB_PSEPK       RYVAETLMPLVLDLAREYEAAKADPK--FLEELAYFQRDYIGRPNPLYFAERLTEHC---
TRPB_PSEP1       RYVAETLMPLVLDLAREYEAAKADPK--FLEELAYFQRDYIGRPNPLYFAERLTEHC---
TRPB_PSEE4       RYVAETLMPLVLDLAREYEAAKADPK--FLEELAYFQRDYIGRPNPLYFAERLTEHC---
TRPB_ACICA       RFVSETLMAALEDLENLYNRMKNDEQ--FLAEFDRDLAYYVGRPSPLYYAERWSKKL---
TRPB_ACIAD       RFVSETLMAALEDLENLYNRMKNDEQ--FLAEFDRDLAYYVGRPSPLYYAERWSKKL---
TRPB_LEGPA       MFVADTLVHALKQLEHAYTKYRNDQD--FLSELHTELKDYVGRPNPLYHAVHLSKKI---
TRPB_LEGPL       MFVADTLVHALKQLEHAYTKYRNDQD--FLSELHTELKDYVGRPNPLYHAVHLSKKI---
TRPB_LEGPH       MFVADTLVHALKQLEHAYTKYRNDQD--FLSELHTELKDYVGRPNPLYHAVHLSKKI---
TRPB_LEGPC       MFVADTLVSALKQLEHAYTKYRNDQD--FLSELHTELKDYVGRPNPLYHAVHLSKKI---
TRPB_BORBR       VFVAETLMHALDELRAAYDQCRVDPS--FIDEFNYELKHFVGRPSPVYHASRWSQRL---
TRPB_BORPA       VFVAETLMHALDELRAAYDQCRVDPS--FIDEFNYELKHFVGRPSPVYHASRWSQRL---
TRPB_BORPE       VFVAETLMHALDELRAAYDQCRVDPS--FIDEFNYELKHFVGRPSPVYHASRWSQRL---
TRPB_RALSO       TFVAETLSHALDELRDAYARYQHDPE--FIKEYEYELKHFVGRPSPIYHARRLTEHC---
TRPB_POLNA       SFVSETLTHAINELKDAYARYQNDPK--FLAEFNYELKHFVGRPSPIYHAARMSREQ---
TRPB_POLSJ       SFVSETLTHAINELKDAYAKYQNDPE--FLAEFHSELAHFVGRPSPIYHAARMSREQ---
TRPB_ACIAC       SFASETLTHALTELREAYARYQNDPE--FLKEFHSELAHFVGRPSPIYHAARMSREM---
TRPB_METPP       SFVAETLIHALDELKAAYARYRDDPE--FVAEFKSELAHFVGRPSPIYHAARMSREL---
TRPB_METFK       IFVAETLVEALEELRVMYERYRHDPD--FLAEFAYDLKHFVGRPSPVYYAERLTQKA---
TRPB_NITEU       TFVAETLISALDELCKQYEYYRDDAE--FQAEFFHELKHYVGRPSPIYHAKRWSEHL---
TRPB_NITEC       TFVAETLISALDELCKQYEYYRGDAE--FQTEFFRELKHYVGRPSPIYHARRWSDHL---
TRPB_NITMU       IFVAETLISALEDLRIQYERYRSDAD--FQAEFAHELKHYVGRPTPIYHAKRWSAQL---
TRPB_METCA       IFVAETLMEPLEELKAAYHRYLKDPE--FLAELDHDLNHYVGRPSPIYHAERLSREL---
TRPB_XANAC       RFVAETLIGPLQELSAAYDQARQDPS--FIAEYDKDLKHYVGRPSPIYHAERLSREV---
TRPB_XANC5       RFVAETLIGPLQELSAAYDQARQDPS--FIAEYDKDLKHYVGRPSPIYHAERLSREV---
TRPB_XANOM       RFVAETLIGPLQELSAAYDQARQDPS--FIAEYDKDLKHYVGRPSPIYHAERLSREV---
TRPB_XANCP       RFVAETLIAPLQELSAAYDLARQDPA--FIAEYDKDLKHYVGRPSPIYHAERLSREV---
TRPB_XANC8       RFVAETLIAPLQELSAAYDLARQDPA--FIAEYDKDLKHYVGRPSPIYHAERLSREV---
TRPB_XYLFA       RFVAETLIGPLQELAQAYDAARHDPD--FIAAYNKDLKDYVGRPSPIYHAERLSRKV---
TRPB_XYLFT       RFVAETLIGPLQELAQAYDAARHDPD--FIAAYNKDLKDYVGRPSPIYHAERLSRKV---
TRPB_VESOH       IFIAETLMTAVFELKDAYARFKNDSK--FICEFEQDLKHYAGRETPLYYAKNLSKKL---
TRPB_RUTMC       IFTAETLMIAVTELKDAYAKFKDDED--FIREFEQDLKHYVGRETPLYHAQNLSKKL---
TRPB_NEIG1       LYVSETLIPALKELEQAYNEAKNDPE--FWAEFRRDLKHYVGRPSPVYHAARLSEHL---
TRPB_NEIGO       LYVSETLIPALKELEQAYNEAKNDPE--FWAEFRRDLKHYVGRPSPVYHAARLSEHL---
TRPB_NEIMF       LFVSETLIPALQELADAYKAAKNDPE--FWEAFRHDLKHYVGRPSPVYHAARLSEHL---
TRPB_NEIMA       LFVSETLIPALQELADAYKAAKNDPE--FWEAFRHDLKHYVGRPSPVYHAARLSEHL---
TRPB_NEIMB       LYVSETLIPALQELADAYKAAKNDPE--FWEAFRHDLKHYVGRPSPVYHAARLSEHL---
TRPB_NEIM0       LYVSETLIPALQELADAYKAAKNDPE--FWAEFRCDLKHYVGRPSPVYHAARLSEHL---
TRPB_CHRVO       VYVAETLMVALDQLKEEYARVKADPT--FWQEFHHELKHYVGRPSPVYHAKRWSEQL---
TRPB_RHOBA       RFVPETLTRALDELSEEYEKAKRDPE--FQRELDGLLKTFVGRPSPLYHAKRLSSAV---
TRPB_GEOSE       KFVPETLMLPLEEIEAELDKALADES--FKQEYIRILQHYSGRPTPLTFAPNLTRQL---
TRPB_GEOTN       KFVPETLMLPLEEIETELDKALADES--FRQEYIRILQHYSGRPTPLTFAPNLTRQL---
TRPB_BACVZ       KFVPETLMRPLEEIETAFKELKNDPV--FHAEYKKLLFDYSGRPTALTFADRVSEYL---
TRPB_BACSU       KFVPETLMQPLDEIQTAFKQIKDDPA--FREEYYKLLKDYSGRPTALTYADRVTEYL---
TRPB_BACLD       KFVPETLMQPLEEIEKAFLELKDDPS--FQKDYQKLLNDYSGRPTALTFADQLTKQL---
TRPB_BACP2       KFVPETLMQPLKEIEQAFNELKEDPA--FEQEYLSLLHNYSGRPTALTYADQLSAYL---
TRPB_BACHD       KYVPETLMSAIEELELALNDAMNDEA--FIHDYKEHLREYAGRPTALTYAKNMSETL---
TRPB_BACSK       KYVPETLMSAIEELEAGLAKAMVDPA--FIGELKADLAEYAGRETPLTFAKNISAKL---
TRPB_BACAN       RYVPETLMQSVLELEEAYKEAMEDEA--FQKELNHYLKTYVGRETPLYFAENMTEYC---
TRPB_BACHK       RYVPETLMQSVLELEEAYKEAMEDEA--FQKELNHYLKTYVGRETPLYFAENMTEYC---
TRPB_BACAH       RYVPETLMQSVLELEEAYKEAMEDEA--FQKELNHYLNTYVGRETPLYFAENMTEYC---
TRPB_BACCZ       RYVPETLMQSVLELEEAYKEAMEDEA--FQKELNHYLKTYVGRETPLYFAENMTEYC---
TRPB_BACCR       RYVPETLMQSVLELEEAYKEAMQDEA--FQKELNHYLKTYIGRETPLYYAENMTKYC---
TRPB_BACC1       RYVPETLMQSVLELEEAYKEAMEDEA--FQKELNHYLKTYVGRETPLYYAENMTKYC---
TRPB_OCEIH       RFVPELLMPAVLELEKAYEDALKDES--FNEELQTYLTEYIGRETPLYHAKKLTEHA---
TRPB_LACLS       QFVPETLMTAVKELEVAYEDSKKDPV--FQAELKELLKDYVGRENPLYFAKRLTEYA---
TRPB_LACLM       QFVPETLMTAVKELEVAYEDSKKDPV--FQAELKELLKDYVGRENPLYFAKRLTEYA---
TRPB_LACLA       QFVPETLMTAVKQLEEAYVDSKKDPL--FQAELKELLKDYVGRENPLYYAKRLTEYA---
TRPB_STRR6       RFVPETLMTAVLELEKAYRESQADPS--FQEELNQLLRQYVGRETPLYYAKNLTQHI---
TRPB_STRP2       RFVPETLMTAVLELEKAYRESQADPS--FQEELNQLLRQYVGRETPLYYAKNLTQHI---
TRPB_STRPN       RFVPETLMTAVLELEKAYRESQADPS--FQEELNQLLRQYVGRETPLYYAKNLTQHI---
TRPB_STRT2       QFVPETLMTAVIELDKAYREAKEDSS--FQAELDDLLKNYVGRETPLYHAKRLTDHI---
TRPB_STRT1       QFVPETLMTAVIELDKAYREAKEDSS--FQAELDDLLKNYVGRETPLYHAKRLTDYI---
TRPB_STRTD       QFVPETLMTAVIELDKAYREAKEDSS--FQAELDDLLKNYVGRETPLYHAKRLTDHI---
TRPB_STRMU       QFIPETLMTAVIELDEAYREAKADPS--FHEELDALLKDYVGRETPLYFAKRLTDYI---
TRPB_LISMF       RFVPETLMKAVKELDEAYRASKTDPA--FQKELNYYLKEYVGRETPLYFAEQLTAHA---
TRPB_LISMO       RFVPETLMKAVKELDEAYQASKTDPA--FQKELNYYLKEYVGRETPLYFAEQLTAHA---
TRPB_LISIN       RFVPETLMKAVKELDEAYRASKTDAA--FQKELNYYLKEYVGRETPLYFAEQLTAYA---
TRPB_LISW6       RFVPETLMKAVIELDEAYRASKTDSA--FQKELNYYLKEYVGRETPLYFAEQLTAHA---
TRPB_STAAN       QYVPETLMPAIIELKKAYKEAKADPE--FQRELEYYLSEYVGRATPLTYAASYTESL---
TRPB_STAA1       QYVPETLMPAIIELKKAYKEAKADPE--FQRELEYYLSEYVGRATPLTYAASYTESL---
TRPB_STAAM       QYVPETLMPAIIELKKAYKEAKADPE--FQRELEYYLSEYVGRATPLTYAASYTESL---
TRPB_STAA9       QYVPETLMPAIIELKKAYKEAKADPE--FQRELEYYLSEYVGRATPLTYAASYTESL---
TRPB_STAA2       QYVPETLMPAIIELKKAYKEAKADPE--FQRELEYYLSEYVGRATPLTYAASYTESL---
TRPB_STAAR       QYVPETLMPAIIELKKAYKEAKADPE--FQRELEYYLSEYVGRATPLTYAASYTESL---
TRPB_STAAB       QYVPETLMPAIIELKKAYKEAKADPE--FQRELEYYLSEYVGRTTPLTYAASYTESL---
TRPB_STAAE       QYVPETLMPAIIELKKAYKEAKADPE--FQRELEYYLSEYVGRATPLTYAASYTESL---
TRPB_STAA8       QYVPETLMPAIIELKKAYKEAKADPE--FQRELEYYLSEYVGRATPLTYAASYTESL---
TRPB_STAA3       QYVPETLMPAIIELKKAYKEAKADPE--FQRELEYYLSEYVGRATPLTYAASYTESL---
TRPB_STAAW       QYVPETLMPAIIELKKAYKEAKADPE--FQRELEYYLSEYVGRATPLTYAASYTESL---
TRPB_STAAT       QYVPETLMPAIIELKKAYKEAKADPE--FQRELEYYLSEYVGRATPLTYAASYTESL---
TRPB_STAAC       QYVPETLMPAIIELKKAYKEAKADPE--FQRELEYYLSEYVGRATPLTYAASYTESL---
TRPB_STAAS       QYVPETLMPAIIELKKAYKEAKADPE--FQRELEYYLSEYVGRATPLTYAASYTESL---
TRPB_STAS1       QYVPETLMPAIQELKQAYQDAKNDPQ--FQIELDDYLKDYVGRETPLTYAKSYSELL---
TRPB_STAEQ       QYVPETLMPAIIELKKAYEDAKSDTH--FKKEFNYYLSEYVGRETPLTFAESYTKLL---
TRPB_STAES       QYVPETLMPAIIELKKAYEDAKSDTH--FKKEFNYYLSEYVGRETPLTFAESYTKLL---
TRPB_LEPIC       RYSPEILHDALVELETTYKKLKKNKH--FKKELEYYRKNYIGRPSPLTYAERLSKVW---
TRPB_LEPIN       RYSPEILHDALVELETTYKKLKKNKH--FKKELEYYRKNYIGRPSPLTYAERLSKVW---
TRPB_LEPBJ       RYSPEILHDALAELETTYKKLKKNKH--FKKELEYYRKNYIGRPSPLTYAERLTKVW---
TRPB_LEPBL       RYSPEILHDALAELETTYKKLKKNKH--FKKELEYYRKNYIGRPSPLTYAERLTKVW---
TRPB2_NOSS1      KYVPETLMPALAELETAYQQYRNDPG--FQAELQQLLRDYVGRATPLYFAERLTAHYARP
TRPB_TRIV2       KYVPETLMPALAELETAYQKYRHDPG--FQAELQQLLRDYVGRATPLYFAERLTAHYARP
TRPB1_NOSS1      KYVPETLMPALGELETAYQKYRDDAS--YQTELQNLLRDYVGRPSPLYFAERLTEYYARP
TRPB_TRIEI       KYVPETLMPALLQLETACKKYSQDPT--FKQELQQLLRDYVGRPSPLYFAERLTAHYTKP
TRPB_THEEB       KYVPETLMPALSELEAAFAHYRQDPD--FQAELQQLLRDYVGRPSPLYFAERLSAHYAH-
TRPB_SYNY3       KYVPETLMPALTELEEAYYRYRAESS--FQEELAGLLKDYVGRSSPLYFAERLSAHYARP
TRPB_SYNJB       RFVPETLMSALTELEEAFEHHWRDPD--FRAEFHNLLRDFVGRPSPLYFAQRLTEYYGG-
TRPB_GLOVI       QYVPETLMSALAQLEAAFNQYRHDPQ--FLAEFAGHLRDFVGRPTPLYFAERLTAHWGG-
TRPB_PROM1       QYVPETLIPALIELEQAAKEAWKDSS--FNSELNHLLKTYVGRSTPLYEATRLTEHYRKN
TRPB_PROMT       QYVPETLIPALIELEQAAKEAWKDSS--FNSELNHLLKTYVGRSTPLYEATRLTEHYRKN
TRPB_PROMA       QYVPETLIPALTELEQAAATAWKDES--FTKELTQLLKTYVGRETPLYEATRLTKHYERG
TRPB_SYNPW       QYVPETLMPALAELEQAAAQAWKDPA--FTAELNRLLKSYVGRATPLYEAERLTEHYRRA
TRPB_PROMM       QYVPETLMPALAELEQAAALAWKDPA--FTAELDRLLRSYVGRATPLYEAERLTAHYCRS
TRPB_SYNSC       QYVPETLMPALAELEQAAAQAWNDPA--FTDELNRLLKNYVGRATPLYEAERLTAHYRRA
TRPB_SYNPX       QYVPETLMPALAELEQAAAQAWNDPA--FTAELNQLLKNYVGRATPLYEAERLTAHYRRA
TRPB_SYNS9       QYVPETLMPALAELEQSAAQAWADPA--FTGRLNHLLKTYVGRATPLYEAERLTAHYRRD
TRPB_SYNS3       QYVPETLMPALAELEQAAAEAWKDSA--FTTELNRLLKSYVGRATPLYEAERLSAHYRRS
TRPB_PROMP       QYVPETLMPALFELEEAASDAWKDKQ--FVNELNHLLKTYVGRETPLYEAKRLTEHYQTK
TRPB_PROM5       QYVPETLMPALFELEKAASDAWKDKQ--FVDELNHLLKTYVGRETPLYEAKRLTEHYQTK
TRPB_PROMS       QYVPETLMPALFELEDAASNAWKDKL--FVEELNHLLKTYVGRETPLYEAKRLTEHYKNK
TRPB_PROM0       QYVPETLMPALFELETAASNAWKDKL--FVEELNHLLKTYVGRETPLYEAKRLTEHYKTK
TRPB_PROM9       QYVPETLMPALFELETAASNAWKDKL--FVKELNHLLKTYVGRETPLYEAKRLTEHYKTK
TRPB_PROM2       QYVPETLMPALFELETAASNAWKDKL--FVKELNHLLKTYVGRETPLYEAKRLTEYYKTK
TRPB_MYCTU       RYVPEALMAVIEEVTAAYQKERVSQD--FLDDLDRLQANYAGRPSPLYEATRLSQHAGS-
TRPB_MYCBO       RYVPEALMAVIEEVTAAYQKERVSQD--FLDDLDRLQANYAGRPSPLYEATRLSQHAGS-
TRPB_MYCLE       RYVPEALMAVIEEVTAAYEKERVNQD--FLDLLDKLQANYAGRPSPLYEATRLSEYAGS-
TRPB_MYCIT       RYVAEALMAVIEEVTTAYEKERVNQD--FLDTLDYLQANYAGRPSPLYEAPRLSEQAG--
TRPB_STRAW       KFIPEALVAAVDEVAVEYDKAKADPE--FARELDDLLVHYTGRPSALTEVSRFAEHAGG-
TRPB_STRCO       KFIPEALVAAVDEVAVEYDKAKSDPE--FARELDDLLVHYTGRPSALTEVPRFAAEAGG-
TRPB_LEIXX       RFVPESLVAALDELSAAWEAAKADPA--FHVQLDELHRSYTGRPSIVTEVPRFAEHGGG-
TRPB_SHIFL       MYVPQILMPALRQLEEAFVSAQKDPE--FQAQFNDLLKNYAGRPTALTKCQNITAGTN--
TRPB_ECOLC       MYVPQILMPALRQLEEAFVSAQKDPE--FQAQFNDLLKNYAGRPTALTKCQNITAGTN--
TRPB_SHIF8       MYVPQILMPALRQLEEAFVSAQKDPE--FQAQFNDLLKNYAGRPTALTKCQNITAGTN--
TRPB_ECOLI       MYVPQILMPALRQLEEAFVSAQKDPE--FQAQFNDLLKNYAGRPTALTKCQNITAGTN--
TRPB_ECO24       MYVPQILMPALRQLEEAFVSAQKDPE--FQAQFNDLLKNYAGRPTALTKCQNITAGTN--
TRPB_ECOHS       MYVPQILMPALRQLEEAFVSAQKDPE--FQAQFNDLLKNYAGRPTALTKCQNITAGTN--
TRPB_SHISS       MYVPQILMPALRQLEEAFVSAQKDPE--FQAQFNDLLKNYAGRPTALTKCQNITAGTN--
TRPB_ECO57       MYVPQILMPALRQLEEAFVSAQKDPE--FQAQFNDLLKNYAGRPTALTKCQNITAGTN--
TRPB_SHIBS       MYVPQILMPALRQLEEAFVSAQKDPE--FQAQFNDLLKNYAGRPTALTKCQNITAGTN--
TRPB_ECOK1       MYVPQILMPALRQLEEAFVSAQKDPE--FQAQFNDLLKNYAGRPTALTKCQNITAGTN--
TRPB_ECOUT       MYVPQILMPALRQLEEAFVSAQKDPE--FQAQFNDLLKNYAGRPTALTKCQNITAGTN--
TRPB_SHIDS       MYVPQILMPALRQLEEAFVSAQKDPE--FQAQFNDLLKNYAGRPTALTKCQNITAGTN--
TRPB_ECOL5       MYVPQILMPALRQLEEAFVSAQKDPE--FQAQFNDLLKNYAGRPTALTKCQNITAGTN--
TRPB_ECOL6       MYVPQILMPALRQLEEAFVSAQKDPE--FQAQFNDLLKNYAGRPTALTKCQNITAGTN--
TRPB_CITK8       MYVPQILMPALRQLEEAFVSAQKDPQ--FQAQFADLLKNYAGRPTALTKCQNITAGTK--
TRPB_SALTY       MYVPQILMPALNQLEEAFVSAQKDPE--FQAQFADLLKNYAGRPTALTKCQNITAGTR--
TRPB_SALPB       MYVPQILMPALNQLEEAFVSAQKDPE--FQAQFADLLKNYAGRPTALTKCQNITAGTR--
TRPB_SALTI       MYVPQILMPALNQLEEAFVSAQKDPE--FQAQFADLLKNYAGRPTALTKCQNITAGTR--
TRPB_SALPA       MYVPQILMPALNQLEEAFVSAQKDPE--FQAQFADLLKNYAGRPTALTKCQNITAGTR--
TRPB_SALCH       MYVPQILMPALNQLEEAFVSAQKDPE--FQAQFADLLKNYAGRPTALTKCQNITAGTR--
TRPB_SALAR       MYVPQILMPALRQLEEAFVSAQKDPE--FQAQFADLLKNYAGRPTALTKCQNITAGTR--
TRPB_CROS8       MYVPQILMPALRQLEEAFVSAQSDAE--FQAQFTDLLKNYAGRPTALTKCQNLTEGTR--
TRPB_KLEP7       MYVPQILMPALRQLEEAFVSAQKDPA--FQAEFTDLLKNYAGRPTALTKCRNLTEGTR--
TRPB_ENT38       MYVPQILMPALRQLEEAFVSAQKDPA--FQAEFTDLLKNYAGRPTALTKCRNLTEGTK--
TRPB_PECAS       QFVPQILIPALRQLEEAFVSAQKDPE--FQAEFTDLLKNYAGRPTALTLCKNLTAGTK--
TRPB_YERPA       MYVPQILVPALKQLEDAFVSAQLDPE--FQAAFQDLLKNYAGRPTALTLCQNLTKGTK--
TRPB_YERPS       MYVPQILVPALKQLEDAFVSAQLDPE--FQAAFQDLLKNYAGRPTALTLCQNLTKGTK--
TRPB_YERPN       MYVPQILVPALKQLEDAFVSAQLDPE--FQAAFQDLLKNYAGRPTALTLCQNLTKGTK--
TRPB_YERPP       MYVPQILVPALKQLEDAFVSAQLDPE--FQAAFQDLLKNYAGRPTALTLCQNLTKGTK--
TRPB_YERP3       MYVPQILVPALKQLEDAFVSAQLDPE--FQAAFQDLLKNYAGRPTALTLCQNLTKGTK--
TRPB_YERPE       MYVPQILVPALKQLEDAFVSAQLDPE--FQAAFQDLLKNYAGRPTALTLCQNLTKGTK--
TRPB_YERE8       MYVPQILMPALKQLEEAFVSAQLDPE--FQAEFQDLLKNYAGRPTALTLCQNLTKGTK--
TRPB_SERP5       QYVPQILMPALKQLEEAFVSAQRDPE--FQAEFIDLLKNYAGRPTALTLCRNLTAGTK--
TRPB_SODGM       MYVPQILMPALIQLEDAFVSAQSDPA--FQAEFSDLLTNYAGRPTPLTLCRNLTAGTR--
TRPB_PHOLL       QFVPQILIPALEQLEAAFIAAQQDPE--FQQEFQDLLKNYAGRPTALTLCRNLTKGTK--
TRPB_HAEIN       MYVPEILVPVLKQLEQAFVEAQNDPT--FQAEFADLLKNYAGRPTALTLCRNLTKGTK--
TRPB_HAEIE       MYVPEILVPVLKQLEQAFVEAQNDPT--FQAEFADLLKNYAGRPTALTLCRNLTKGTK--
TRPB_HAEIG       MYVPEILVPVLKQLEQAFVEAQNDPT--FQAEFADLLKNYAGRPTALTLCRNLTKGTK--
TRPB_HAEI8       MYVPEILVPVLKQLEQAFVEAQNDPT--FQAEFADLLKNYAGRPTALTLCRNLTKCTK--
TRPB_ACTSZ       MYVPEILVPVLQQLEKAFVEARNDPD--FQQEFQDLLKNYAGRPTALTLCRNLTKGTK--
TRPB_HISS2       MYVPEILVPVLKQLEKAFVEAQHDPV--FQQEFQDLLKNYAGRPTALTLCRNLTKGTK--
TRPB_ACTP2       MYVPEILVPVLKQLEEAFVAAQNDPL--FQAEFTDLLKNYAGRPTALTLCRNLTKGSK--
TRPB_PASMU       MYVPEILMPVLKNLEKAFVEAQQDPT--FKETFLDLLKNYAGRPTALTRCRNLTQGSK--
TRPB_MANSM       MYVPEILIPVLKQLEKAFVEAQQDPA--FQTEFLDLLKNYAGRPTALTLCRNLTKGTK--
TRPB_BUCAP       MYVPQILMPALYQLEKNFVDAKKDSN--FQKSFFNYLKNYAGRPTPLTLCNNLTNGTK--
TRPB_BUCAI       MYVPQILMPALFELEKNFVSAQKDAE--FQKKFFYLLQNYAGRPTPLTLCKNLTKGTK--
TRPB_BUCDN       MYVPQILMPALLELEKNFVEAQKDIN--FHKTFFNLLKNYAGRPTPLTLCNNLTKGTK--
TRPB_BUCMH       MYVPQILMPALYQLEEEFIFSLKSSK--FKIELSNLLENYAGRPTPLTLCRNLTKGTK--
TRPB_BUCSC       MYVPQILMPALYQLESEFVLSLKNLQ--FKKKLANLLKNYAGRPTPLTLCRNLTKGTN--
TRPB_BUCBP       MYVPQILMPALYKLEIEFLKALNDLQ--FTNELSNLLKNYAGRPTPLTLCKNITKNTN--
TRPB_BLOPB       MYVPQILIPALTQLEEAFISAQDDAI--FQKELKYLLNNYAGRPTPLTLCRNLTKGTR--
TRPB_BLOFL       MYVPQILIPALIQLEKEFIEAMKDIS--FQTTFKNLLHHYAGRPTPLTLCQNLTSGTC--
TRPB1_VIBPA      QYVPQILVPALKQLEQAFIDAQEDPE--FRSEFMTLLQEYAGRPTALTLTRNLTKGTK--
TRPB_VIBCB       QYVPQILVPALEQLEQAFIDAQEDPE--FRSEFMTLLQEYAGRPTALTLTRNLTKGTK--
TRPB_VIBVU       QYVPQILVPALEQLEQAFIDAQEDPD--FRSEFMGLLQEYAGRPTALTLTRNLTKGTK--
TRPB_VIBVY       QYVPQILVPALEQLEQAFIDAQEDPD--FRSEFMGLLQEYAGRPTALTLTRNLTKGTK--
TRPB_ALIF1       QYVPQILVPALEQLEQAFIDAQEDPD--FRSEFMTLLQEYAGRPTALTLCRNLTKGTK--
TRPB_VIBC3       QFVPQILVPALDQLEQAFIDAQQDDA--FRAEFMSLLQEYAGRPTALTLTQNITKGTK--
TRPB_VIBCH       QFVPQILVPALDQLEQAFIDAQQDDA--FRAEFMSLLQEYAGRPTALTLTQNITKGTK--
TRPB_VIBME       QYVPQILVPALDQLEQAFIDAQEDPD--FRAEFMSLLQEYAGRPTALTLTRNLTKGTK--
TRPB_PHOPR       QYVPQILVPALDQLEDAFIEAQQDPA--FQKEFIDLLKDYAGRPTALTLCQNLTKGTK--
TRPB_FRAT1       QFVPQILVPALDQLEQEFIKAQADES--FKQEFKELLQEYAGRPTALTKTRNIVKNTR--
TRPB_FRATT       QFVPQILVPALDQLEQEFIKAQADES--FKQEFKELLQEYAGRPTALTKTRNIVKNTR--
TRPB_FRATH       QFVPQILVPALDQLEQEFIKAQADES--FKQEFKELLQEYAGRPTALTKTRNIVKNTR--
TRPB_FRATF       QFVPQILVPALDQLEQEFIKAQADES--FKQEFKELLQEYAGRPTALTKTRNIVKNTR--
TRPB_FRATO       QFVPQILVPALDQLEQEFIKAQADES--FKQEFKELLQEYAGRPTALTKTRNIVKNTR--
TRPB_FRATW       QFVPQILVPALDQLEQEFIKAQADES--FKQEFKELLQEYAGRPTALTKTRNIVKNTR--
TRPB_FRATN       QFVPQILVPALDQLEQEFIKAQADES--FKQEFKELLQEYAGRPTALTKTRNIVKNTK--
TRPB_FRAP2       QFVPQILVPALDQLEHEFIKAQADES--FKQEFKELLQEYAGRPTALTKTRNIVKNTK--
TRPB_AERHH       MYVPQILIPALLQLEKAFVDAKDDPA--FIAEFQTLLTEYAGRPTPLTLTRNLTKGTK--
TRPB_AERS4       MYVPQILIPALLQLEKAFVDAQEDPA--FIAEFQELLTEYAGRPTPLTLTRNLTKGTK--
TRPB_PSYIN       MFVPQILVPALKQLEAEFVRAQTDPE--FLAELSELLTEYAGRPTPLTLCRNLTKGKK--
TRPB_SHEPA       MYVPQILMPALKQLETAFIEAQEDES--FQQEFTELLKNYAGRPTALTLTRNLSPNPL--
TRPB_SHEHH       MYVPQILMPALKQLETAFIEAQEDEA--FQEEFTDLLKNYAGRPTALTLTRNLSPNPL--
TRPB_SHELP       MFVPQILMPALKQLEAAFVDAQNDPS--FQAEFTDLLKNYAGRPTALTLTRNLSPNPL--
TRPB_SHESM       MYVPQILVPALKQLENAFVEAQADES--FQAEFTDLLKNYAGRPTALTLTRNLSPNPM--
TRPB_SHESA       MYVPQILVPALKQLENAFVEAQADES--FQAEFTDLLKNYAGRPTALTLTRNLSPNPM--
TRPB_SHESR       MYVPQILVPALKQLENAFVEAQADES--FQAEFTDLLKNYAGRPTALTLTRNLSPNPM--
TRPB_SHEON       MYVPQILVPALKQLESAFVEAQTDES--FQAEFTDLLKNYAGRPTALTLTRNLSPNPM--
TRPB_SHEB8       MYVPQILVPALKQLETAFVEAQEDDD--FKAEFTDLLKNYAGRPTALTLTRNLSPNPM--
TRPB_SHEB5       MYVPQILVPALKQLETAFVEAQEDDD--FKAEFTDLLKNYAGRPTALTLTRNLSPNPM--
TRPB_SHESW       MYVPQILVPALKQLETAFVEAQEDDD--FKAEFTDLLKNYAGRPTALTLTRNLSPNPM--
TRPB_SHEPC       MYVPQILVPALKQLETAFVEAQEDED--FKAEFTDLLKNYAGRPTALTLTRNLSPNPM--
TRPB_SHEB9       MYVPQILVPALKQLETAFVEAQEDDD--FKAEFTDLLKNYAGRPTALTLTRNLSPNPM--
TRPB_SHEFN       MYVPQILVPALKQLETAFVEAQQDES--FIAEFTDLLKNYAGRPTALTLTRNLSPNPL--
TRPB_SHEDO       MYVPQILVPALKQLESAFVDAQQDPA--FQAEFTDLLKNYAGRPTALTLTRNLSPNPL--
TRPB_SHEAM       MYVPQILMPALKQLETAFVEAQQDPE--FLTEFHDLLKNYAGRPTALTLTRNLSPNPK--
TRPB_PSEA6       MYVPELLIPALDQLEQAFIDAQNDPE--FQKEFMELLTDYAGRPTAMTLSRNLVSNPN--
TRPB_HELPY       SFVSELLVPALRELEQAFDACLKDEK--FQKEYFRLLKDFVGRPSPLTLCQNIVSNPK--
TRPB_HELPJ       SFVSELLVPALRELEQAFDTCLKDEE--FQKEYFRLLKDFVGRPSPLTLCQNIVSNPK--
TRPB_CORGL       QFVAESLLPALDQLEKAFVDATNSPE--FREELGGYLRDYLGRPTPLTECSNLPLAGEGK
TRPB_CORGB       QFVAESLLPALDQLEKAFVDATNSPE--FREELGGYLRDYLGRPTPLTECSNLPLSGEGK
TRPB1_COREF      QFVAESLLPALDQLEKAFVDATNHPE--FRQELAAYLRDYLGRPTPLTECSNLPLPGQGR
TRPB2_COREF      QFVPEVLLPALDELERAYVEALEDPT--FQQELDDLYTNYLGRPTPITECANLPLEGQGR
TRPB_METJA       KFVPETLMPAIAELEEAFKRFWINNEGNFREEFYALLRDYVGRPTPLYYAERLSEELG--
TRPB_METKA       RFVPETLMPALEELEDAFKEAREDPE--FWEELEELWRKYAGRPTPLYYARNLSRKLG--
TRPB1_METTH      IFVPELLIPALEELERAFLHYRDDRK--FMAELEYHLREYAGKPTGLYYARNLSEKLG--
TRPB2_METTM      IFVPELLIPALEELEAAFLHYSKDRR--FNEDLEHYLREYAGRPTGLYHARNLSEKLG--
TRPB1_METMA      QYVPEVLMPALEELEEGYERYKNDPE--FLAELDHYLRDFAGRETPLYLARNLSKKYG--
TRPB1_METAC      QYVPEVLMPALEELDVGYEKYKNDPE--SLAELDHYLRDFAGRETPLYFARNLSKKYG--
TRPB_HALVD       QYVPEALMPAIEELTDAYERYVLDNEDGFMDDFRARLRDFGGRPTPLQRADRLSERYD--
TRPB_HALSA       QYVPEVLMPAVEELTDAYERYVLDNEDGFVDDFRQRIRSFGGRPTPLTHAPTLSQRHG--
TRPB1_THEMA      QYVPEILMPALEELEAAYEEIMKDES--FWKEFNDLLRDYAGRPTPLYFARRLSEKYG--
TRPB_METVO       QYIPEVLKPAVEELKEAYKELKDDED--FQNELAYYLKHYAGRETPLYYAKNLTEKLGG-
TRPB_META3       QYVPEVLMPSLKELEKAYKKYKDDPE--FKEELEYYLKQYAGRETPLYFAENLTKKMGG-
TRPB1_PYRFU      QYVPETLIEPLKELEKAYKRFKDDEE--FNRQLNYYLKTWAGRPTPLYYAKRLTEKIGG-
TRPB1_PYRAB      QYVPETLMEPLRELEKAYKRLKNDEE--FNRQLDYYLRTWAGRPTPLYYAERLTKKVGG-
TRPB1_THEKO      QFVPETLIEPLKKLERAYKKFKDDPE--FNETLEYYLRNWAGRPTPLYYAERLSKKLGG-
TRPB1_ARCFU      RFVPEVLIPPLEELEKAYDRFKDDEE--FKARLEYYLKSYAGRPTPLYFAENLSRELG--
TRPB2_CHLCV      QFMPEILMAPVQDLSNSWKSLQNHSD--FKNELDSVLKNYAGRPTPLTEIKNFAKAIHG-
TRPB1_CHLCV      QYVPLELVKPLEDLDRSYEQLKKDPQ--FRETFHHILKNYAGRPTPLTEVKNFSRAING-
TRPB2_WOLSU      RFVPETLMPALLELESAYNELRFDRE--FWSEVDYYLKEYVGRPSPLYYAERLSDELG--
TRPB_BACTN       AYVPEILHKCVEELKNTYLGVLESED--FKKEFDQLLRDYVGRPSPLYLARRLSEKYG--
TRPB_HELHP       QYIPEILLPALKELEKAYHGVFVSKA--YKKELKSLFKHFVGRPTPLIYAHNASKILK--
TRPB2_AQUAE      PVK-PEKLLAIFPEPLVEQEVSDKEWIDIPEEVLDIYSLW-R-PTPLHRAKNLEEFLGT-
TRPB2_ARCFU      PVK-PEDLEPIFPKGLIQQEMSGERWIRIPEDVREIYRIW-R-PTPLVRAERLEKALKT-
TRPB2_METMA      PIN-PEALEPIFAKELIRQEMSSDRYIDIPAEILDVYRLW-R-PSPLFRAHQLEKDLKT-
TRPB2_METAC      PIS-PDALEPIFPKALIMQEMSSDRYIDIPEEVLDVYRLW-R-PSPLFRAHQLEKVLKS-
TRPB2_THEMA      PIS-PEKLSVIFPMSLIEQEVSEERFIEIPEPVLKEYAVY-R-PTPLIRATFLEEYLQT-
TRPB2_METTH      NI---ENLPRVFSRGVLEQEMSMERWIKIPREVMDVYKMIGR-PTPLFRAKGLEEMLDT-
TRPB2_PYRAB      PID-IEKLKRIFAEELVKQEISRERYIEIPGELRKLYSKIGR-PTPLFRATNLEKLLGT-
TRPB2_PYRFU      PVD-PKKLERIFAKELVKQEMSTKRYIKIPEEVRKMYSKIGR-PTPLFRATNLEKYLNT-
TRPB_PYRHO       TIN-PEKLTRIFAKELIKQEFSEKRYIKIPKEVRELYAKIGR-PTPLFRATNLEKILKT-
TRPB2_THEKO      PME-PEKLLRIFAEELVKQEMSTDRYIEIPKEVREIYSKIGR-PTPLFRATNLERALGT-
TRPB2_AERPE      PVD-PSALAKLFPKALIEQEVSRERYIEIPGEVHEAYISFARRPTPLLRAVNLERALNT-
TRPB1_SACS2      FSR-IDLLRSILPKEVLRQQFTIERYIKIPEEVRDRYLSIGR-PTPLFRAKRLEEYLKT-
TRPB1_SULTO      FSR-IELLKKILPKEVLRQQFTIERFIKIPEEVRDRYAIIGR-PTPLMRAKRLEEYLDT-
TRPB_PICTO       FSS-INLLNKILPKEVLKQEFTFKRYEKIPDEIIDKYIQIGR-PTPLIRAKNLEKYLDY-
TRPB2_SACS2      L----ELLKEVLPSKVLELEFAKERYVKIPDEVLERYLQVGR-PTPIIRAKRLEEYLGN-
TRPB2_SULTO      F----EILKQVLPSKVLELEFSKERYIKIPEEVLQRYLQVGR-PTPIIRARKLEEYLGG-
TRPB_THEAC       F----DTLKKAVPAKVLEYEFSGERYPKIPDEILERYMQVGR-PTPIIRAKKLEELLGG-
TRPB_THEVO       F----ETLKKAVPTKVLEYEFSGERYPKIPGEIYEKYMQVGR-PTPIIRAKNLEEFLGG-
TRPB1_AERPE      EESRIALLSRILPSRLIEDEYILARWVDIPGEVRKALARIGR-PTPLIRAEGLEKVLGVK
TRPB_PYRAE       GESRIGLLSKILPSALIDQEFTAERWVSIPEEVREAYRRVGR-PTPLFRAEGLEKALGT-
                                                             . :             

TRPB1_WOLSU      ---------AAIYLKREDLNHTGAHKLNHCMAEALLAKHLGKKKLIAETGAGQHGVALAT
TRPB2_VIBPA      ---------ADIYLKREDLNHTGAHKINHCLGEAILAKKMGKKKLIAETGAGQHGVALAT
TRPB_CALS4       ---------AKIYLKREDLNHTGAHKINNVLGQVLLAKRMGKKRIIAETGAGQHGVATAT
TRPB_CLOAB       ---------AKIYLKREDLNHTGSHKLNNALGQVLLAKRMGKKRVIAETGAGQHGVATAT
TRPB_CLOB8       ---------AKIYLKREDLNHTGAHKINNALGQVLLAKRMGKKKVIAETGAGQHGVATAT
TRPB_FUSNN       ---------AKIYLKREDLNHLGAHKLNNVIGQILLAKRMGKKKVIAETGAGQHGVATAA
TRPB_CLONN       ---------AKIYLKREDLNHTGAHKINNAIGQILLAKRMGKKKVIAETGAGQHGVATAT
TRPB_LACP3       ---------AKIYLKREDLNHTGAHKINNVIGQALLAKHLGKKRLIAETGAGQHGVATAT
TRPB_LACCA       ---------AKIYLKREDLNHTGAHKINNVIGQALLAKHLGKKRLIAETGAGQHGVATAT
TRPB_LACPL       ---------AQIYFKREDLNHTGAHKINNVLGQALLAKKMGKKRLIAETGAGQHGVATAT
TRPB_CAMJR       ---------HEIYLKREDLNHTGAHKINNAIAQALLAKKMGKKKIIAETGAGQHGLATAT
TRPB_CAMJE       ---------HEIYLKREDLNHTGAHKINNAIAQALLAKKMGKKKIIAETGAGQHGLATAT
TRPB_CAMJ8       ---------HEIYLKREDLNHTGAHKINNAIAQALLAKKMGKKKIIAETGAGQHGLATAT
TRPB_CAMJJ       ---------HEIYLKREDLNHTGAHKINNAIAQALLAKKMGKKKIIAETGAGQHGLATAT
TRPB_CAMJD       ---------HEIYLKREDLNHTGAHKINNAIAQALLAKKMGKKKIIAETGAGQHGLATAT
TRPB_THET2       -------GGAQVFLKREDLLHTGAHKINNTLGQALLARRMGKRRVIAETGAGQHGVSVAT
TRPB_THET8       -------GGAQVFLKREDLLHTGAHKINNTLGQALLARRMGKRRVIAETGAGQHGVSVAT
TRPB_DEIRA       -------GGAKIYLKREDQNFTGAHKINNCLAQALLAKRMGKQKIIAETGAGQHGVASAT
TRPB_CHLTE       -------GGAQIWLKREDLCHTGAHKINNALGQVLLAKRMGKKRIIAETGAGQHGVATAT
TRPB1_AQUAE      -------GGAKIYLKREDLLHTGAHKINNTIGQCLLTKRMGKKRVIAETGAGQHGVATAT
TRPB_BRASB       -------GGAKIYFKRDELNHTGSHKVNNVLGQIMLARRMGKRRIIAETGAGQHGVATAT
TRPB_BRASO       -------GGAKIYFKRDELNHTGSHKVNNVLGQIMLARRMGKKRIIAETGAGQHGVATAT
TRPB_BRADU       -------GGAKIYLKREELNHTGSHKVNNVLGQIMLARRMGKKRIIAETGAGQHGVATAT
TRPB_PARL1       -------GGAKIYFKRDELNHTGSHKINNCLGQILLARRMGKTRIIAETGAGQHGVATAT
TRPB_CAUVC       -------GGAKIYFKRDELNHTGSHKINNALGQILLAMRMGKTRIIAETGAGQHGVATAT
TRPB_ACICJ       -------GGAKVYFKRDELNHTGAHKINNCIGQILLAKRMGKTRIIAETGAGQHGVATAT
TRPB_NOVAD       -------GGAQVWFKRDELNHTGAHKINNCIGQILLAMRMGKTRIIAETGAGQHGVATAT
TRPB_RHOS4       -------GGAKIYLKRDELNHTGAHKINNVLGQIILARRMGKTRIIAETGAGQHGVATAT
TRPB_RUEST       -------GGAKVYMKRDELNHTGAHKVNNVLGQILLARRMGKTRIIAETGAGQHGVATAT
TRPB_RUEPO       -------GGAKVYMKRDELNHTGAHKINNVLGQIILARRMGKTRIIAETGAGQHGVATAT
TRPB_DINSH       -------GGAKVYLKRDELNHTGAHKINNVLGQIILARRMGKTRIIAETGAGQHGVATAT
TRPB_ROSDO       -------GGAKVYMKRDELNHTGAHKINNVLGQIILARRMGKTRIIAETGAGQHGVATAT
TRPB_JANSC       -------GGAKIYLKRDELNHTGAHKINNVLGQIILARRMGKTRIIAETGAGQHGVATAT
TRPB_PARDP       -------GGAKIYLKREELNHTGSHKINNVLGQILLARRMGKTRIIAETGAGQHGVATAT
TRPB_BRUSU       -------GGAKIYFKREDLNHTGSHKINNCLGQILLAKRMGKTRIIAETGAGQHGVASAT
TRPB_BRUC2       -------GGAKIYFKREDLNHTGSHKINNCLGQILLAKRMGKTRIIAETGAGQHGVASAT
TRPB_BRUSI       -------GGAKIYFKREDLNHTGSHKINNCLGQILLAKRMGKTRIIAETGAGQHGVASAT
TRPB_BRUAB       -------GGAKIYFKREDLNHTGSHKINNCLGQILLAKRMGKTRIIAETGAGQHGVASAT
TRPB_BRUA2       -------GGAKIYFKREDLNHTGSHKINNCLGQILLAKRMGKTRIIAETGAGQHGVASAT
TRPB_BRUME       -------GGAKIYFKREDLNHTGSHKINNCLGQILLAKRMGKTRIIAETGAGQHGVASAT
TRPB_OCHA4       -------GGAKIYFKREDLNHTGSHKINNCLGQILLAKRMGKTRIIAETGAGQHGVASAT
TRPB_RHILO       SSAKGLGGGAKVYFKREDLNHTGSHKINNCLGQILLAKRMGKKRIIAETGAGQHGVASAT
TRPB_RHIEC       --------GAKIYFKREELNHTGSHKINNCIGQILLAKRMGKTRIIAETGAGQHGVASAT
TRPB_RHIL3       -------GGAKIYFKREELNHTGSHKINNCIGQILLAKRMGKTRIIAETGAGQHGVASAT
TRPB_SINMW       -------GGAKIYFKREELNHTGSHKINNCIGQILLAKRMGKTRIIAETGAGQHGVASAT
TRPB_RHIME       -------GGAKIYFKREELNHTGSHKINNCIGQILLAKRMGKTRIIAETGAGQHGVASAT
TRPB_AGRFC       -------GGAKIYFKREELNHTGSHKINNCLGQILLAKRMGKTRIIAETGAGQHGVASAT
TRPB_CHESB       -------GGAKVYFKREELNHTGSHKVNNCLGQILLAKRMGKTRIIAETGAGQHGVASAT
TRPB_PSEPF       -------GGAKIYLKREELNHTGAHKINNCIGQILLARRMGKKRIIAETGAGMHGVATAT
TRPB_PSESY       -------GGAKIYLKREELNHTGAHKINNCIGQILLARRMGKKRIIAETGAGMHGVATAT
TRPB_PSEF5       -------GGAKIYLKREELNHTGAHKINNCIGQILLARRMGKKRIIAETGAGMHGVATAT
TRPB_PSEAE       -------GGAKIYLKREELNHTGAHKINNCIGQILLARRMGKKRIIAETGAGMHGVATAT
TRPB_PSESH       -------DGAKIYFKREELNHTGAHKINNCIGQVLLAKRMGKKRLIAETGAGMHGVATAT
TRPB_PSE14       -------DGAKIYFKREELNHTGAHKINNCIGQVLLAKRMGKKRLIAETGAGMHGVATAT
TRPB_PSEU2       -------GGAKIYFKREELNHTGAHKINNCIGQVLLAKRMGKKRLIAETGAGMHGVATAT
TRPB_PSESM       -------GGAKIYFKREELNHTGAHKINNCIGQVLLAKRMGKKRLIAETGAGMHGVATAT
TRPB_PSEPU       -------GGAKIFFKREELNHTGAHKVNNCIGQVLLAKRMGKKRLIAETGAGMHGVATAT
TRPB_PSEPG       -------GGAKIFFKREELNHTGAHKVNNCIGQVLLAKRMGKKRLIAETGAGMHGVATAT
TRPB_PSEPK       -------GGAKIFFKREELNHTGAHKVNNCIGQVLLAKRMGKKRLIAETGAGMHGVATAT
TRPB_PSEP1       -------GGAKIFFKREELNHTGAHKVNNCIGQVLLAKRMGKKRLIAETGAGMHGVATAT
TRPB_PSEE4       -------GGAKIFFKREELNHTGAHKVNNCIGQVLLAKRMGKKRLIAETGAGMHGVATAT
TRPB_ACICA       -------GGAQIYLKREDLNHTGSHKVNNTIGQALLAKLSGKKRIIAETGAGQHGVATAT
TRPB_ACIAD       -------GGAQIYLKREDLNHTGSHKVNNTIGQALLAKLSGKKRIIAETGAGQHGVATAT
TRPB_LEGPA       -------GGAQIYLKREDLNHTGAHKINNTIGQALLAKRMGKTRVIAETGAGQHGVATAT
TRPB_LEGPL       -------GGAQIYLKREDLNHTGAHKINNTIGQALLAKRMGKTRVIAETGAGQHGVATAT
TRPB_LEGPH       -------GGAQIYLKREDLNHTGAHKINNTIGQALLAKRMGKTRVIAETGAGQHGVATAT
TRPB_LEGPC       -------GGAQIYLKREDLNHTGAHKINNTIGQALLAKRMGKTRVIAETGAGQHGVATAT
TRPB_BORBR       -------GGAQIWFKREDLNHTGAHKVNNCIGQALLARRMGKPRVIAETGAGQHGVATAT
TRPB_BORPA       -------GGAQIWFKREDLNHTGAHKVNNCIGQALLARRMGKPRVIAETGAGQHGVATAT
TRPB_BORPE       -------GGAQIWFKREDLNHTGAHKVNNCIGQALLARRMGKPRVIAETGAGQHGVATAT
TRPB_RALSO       -------GGAQIYLKREDLNHTGAHKVNNVIGQALLARRMGKPRVIAETGAGQHGVATAT
TRPB_POLNA       -------GGAQIYLKREDLNHTGAHKINNTIGQAMLARRMGKQRIIAETGAGQHGVATAT
TRPB_POLSJ       -------GGAQIYLKREDLNHTGAHKINNTIGQAMLARRMGKTRIIAETGAGQHGVATAT
TRPB_ACIAC       -------GGAQIFLKREDLNHTGAHKINNVIGQAMLARRMGKPRVIAETGAGQHGVATAT
TRPB_METPP       -------GGAQIYLKREDLNHTGAHKINNTIGQALLARRMGKPRVIAETGAGQHGVATAT
TRPB_METFK       -------GGARIYLKREDLNHTGAHKVNNTIGQALLAKRMGKPRVIAETGAGQHGVATAT
TRPB_NITEU       -------GGAQILLKREDLNHTGAHKVNNTVGQALLARRMGKGRIIAETGAGQHGVASAT
TRPB_NITEC       -------GGAQILLKREDLNHTGAHKINNTVGQALLARRMGKSRIIAETGAGQHGVASAT
TRPB_NITMU       -------GGAQILLKREDLNHTGAHKINNAMGQALLARRMGKSRVIAETGAGQHGVATAT
TRPB_METCA       -------GGAQIFFKREDLNHTGAHKVNNTVGQALLAKRMGKRRVIAETGAGQHGVATAT
TRPB_XANAC       -------GGAQILLKREDLNHTGAHKINNTIGQALLASRMGKTRIIAETGAGQHGVASAT
TRPB_XANC5       -------GGAQILLKREDLNHTGAHKINNTIGQALLASRMGKTRIIAETGAGQHGVASAT
TRPB_XANOM       -------GGAQILLKREDLNHTGAHKINNTIGQALLASRMGKTRIIAETGAGQHGVASAT
TRPB_XANCP       -------GGAQILLKREDLNHTGAHKINNTIGQALLASRMGKTRIIAETGAGQHGVASAT
TRPB_XANC8       -------GGAQILLKREDLNHTGAHKINNTIGQALLASRMGKTRIIAETGAGQHGVASAT
TRPB_XYLFA       -------GGAQILLKREDLNHTGAHKINNTIGQALLAARMGKTRIIAETGAGQHGVASAT
TRPB_XYLFT       -------GGAQILLKREDLNHTGAHKINNTIGQALLAARMGKTRIIAETGAGQHGVASAT
TRPB_VESOH       -------RGAQIYLKREDLNHTGSHKINNTIGQALLAKRMGKTRIIAETGAGQHGVATAT
TRPB_RUTMC       -------DGAQIYLKREDLNHTGAHKINNTIGQALLAKRMGKTRIIAETGAGQHGVATAT
TRPB_NEIG1       -------GGAQIWLKREDLNHTGAHKVNNTIGQALLARRMGKKRVIAETGAGQHGVASAT
TRPB_NEIGO       -------GGAQIWLKREDLNHTGAHKVNNTIGQALLARRMGKKRVIAETGAGQHGVASAT
TRPB_NEIMF       -------GGAQIWLKREDLNHTGAHKVNNTIGQALLAKRMGKKRVIAETGAGQHGVASAT
TRPB_NEIMA       -------GGAQIWLKREDLNHTGAHKVNNTIGQALLAKRMGKKRVIAETGAGQHGVASAT
TRPB_NEIMB       -------GGAQIWLKREDLNHTGAHKVNNTIGQALLAKRMGKKRVIAETGAGQHGVASAT
TRPB_NEIM0       -------GGAQIWLKREDLNHTGAHKVNNTIGQALLAKRMGKKRVIAETGAGQHGVASAT
TRPB_CHRVO       -------GGAQIWFKREDLNHTGAHKINNAIGQALLARRMGKKRVIAETGAGQHGVATAT
TRPB_RHOBA       -------GGAQIWLKREDLNHTGAHKINNTIGQALLTLRMGKTRVIAETGAGQHGVASAT
TRPB_GEOSE       -------GGAKMYLKREDLNHTGAHKINNAIGQALLAKRMGKKKLIAETGAGQHGVAAAT
TRPB_GEOTN       -------GGAKIYLKREDLNHTGAHKINNAIGQALLAKRMGKKKLIAETGAGQHGVAAAT
TRPB_BACVZ       -------GGAKIYLKREDLNHTGSHKINNALGQILLAKKMGKTKIIAETGAGQHGVAAAT
TRPB_BACSU       -------GGAKIYLKREDLNHTGSHKINNALGQALLAKKMGKTKIIAETGAGQHGVAAAT
TRPB_BACLD       -------GGAKIYLKREDLNHTGAHKINNALGQALLAKKMGKTKLIAETGAGQHGVAAAT
TRPB_BACP2       -------GGAKIYLKREDLNHTGAHKINNALGQALLAKKMGKSNIIAETGAGQHGVAAAT
TRPB_BACHD       -------GGAKIYLKREDLLHTGAHKLNNAMGQALLAKRMGKKKIVAETGAGQHGVATAT
TRPB_BACSK       -------GGANIYLKREDLVHTGAHKLNNAIGQGLLAKRMGKNKLVAETGAGQHGVATAT
TRPB_BACAN       -------GGAKIYLKREDLNHTGAHKINNTIGQALLAVRMGKKKVVAETGAGQHGVATAT
TRPB_BACHK       -------GGAKIYLKREDLNHTGAHKINNTIGQALLAVRMGKKKVVAETGAGQHGVATAT
TRPB_BACAH       -------GGAKIYLKREDLNHTGAHKINNTIGQALLAVRMGKKKVVAETGAGQHGVATAT
TRPB_BACCZ       -------GGAKIYLKREDLNHTGAHKINNTIGQALLAVRMGKKKVVAETGAGQHGVATAT
TRPB_BACCR       -------GGAKIYLKREDLNHTGAHKINNTIGQALLAVRMGKKKVVAETGAGQHGVATAT
TRPB_BACC1       -------GGAKIYLKREDLNHTGAHKINNTIGQALLAVRMGKKKVVAETGAGQHGVATAT
TRPB_OCEIH       -------GGAQIYLKREDLNHTGAHKINNTIGQALLTLRMGKKKVVAETGAGQHGVATAT
TRPB_LACLS       -------GGAKIYLKREDLNHTGAHKINNALGQVLLAKKMGKNKVIAETGAGQHGVATAT
TRPB_LACLM       -------GGAKIYLKREDLNHTGAHKINNALGQVLLAKKMGKNKVIAETGAGQHGVATAT
TRPB_LACLA       -------GGAKIYLKREDLNHTGAHKINNALGQVLLAKKMGKNKVIAETGAGQHGVASAT
TRPB_STRR6       -------GGAKIYLKREDLNHTGAHKINNALGQVWLAKRMGKKKIIAETGAGQHGVATAT
TRPB_STRP2       -------GGAKIYLKREDLNHTGAHKINNALGQVWLAKRMGKKKIIAETGAGQHGVATAT
TRPB_STRPN       -------GGAKIYLKREDLNHTGAHKINNALGQVWLAKRMGKKKIIAETGAGQHGVATAT
TRPB_STRT2       -------GGAQIYLKREDLNHTGAHKINNALGQVLLAKRMGKKKIIAETGAGQHGVATAT
TRPB_STRT1       -------GGAQIYLKREDLNHTGAHKINNALGQVLLAKRMGKKKIIAETGAGQHGVATAT
TRPB_STRTD       -------GGAQIYLKREDLNHTGAHKINNALGQVLLAKRMGKKKIIAETGAGQHGVATAT
TRPB_STRMU       -------GGAKIYLKREDLNHTGAHKINNALGQVLLAKRMGKNKIIAETGAGQHGVATAT
TRPB_LISMF       -------GGAKIYLKREDLNHTGAHKINNTIGQALLARQMGKQKVVAETGAGQHGVATAT
TRPB_LISMO       -------GGAKIYLKREDLNHTGAHKINNTIGQALLARQMGKQKVVAETGAGQHGVATAT
TRPB_LISIN       -------GGAKIYLKREDLNHTGAHKINNTIGQALLARQMGKQKVVAETGAGQHGVATAT
TRPB_LISW6       -------GGAKIYLKREDLNHTGAHKINNTIGQALLARQMGKHKVVAETGAGQHGVATAT
TRPB_STAAN       -------GGAKIYLKREDLNHTGAHKINNALGQALLAKRMGKKKLVAETGAGQHGVASAT
TRPB_STAA1       -------GGAKIYLKREDLNHTGAHKINNALGQALLAKRMGKKKLVAETGAGQHGVASAT
TRPB_STAAM       -------GGAKIYLKREDLNHTGAHKINNALGQALLAKRMGKKKLVAETGAGQHGVASAT
TRPB_STAA9       -------GGAKIYLKREDLNHTGAHKINNALGQALLAKRMGKKKLVAETGAGQHGVASAT
TRPB_STAA2       -------GGAKIYLKREDLNHTGAHKINNALGQALLAKRMGKKKLVAETGAGQHGVASAT
TRPB_STAAR       -------GGAKIYLKREDLNHTGAHKINNALGQALLAKRMGKKKLVAETGAGQHGVASAT
TRPB_STAAB       -------GGAKIYLKREDLNHTGAHKINNALGQALLAKRMGKKKLVAETGAGQHGVASAT
TRPB_STAAE       -------GGAKIYLKREDLNHTGAHKINNALGQALLAKRMGKKKLVAETGAGQHGVASAT
TRPB_STAA8       -------GGAKIYLKREDLNHTGAHKINNALGQALLAKRMGKKKLVAETGAGQHGVASAT
TRPB_STAA3       -------GGAKIYLKREDLNHTGAHKINNALGQALLAKRMGKKKLVAETGAGQHGVASAT
TRPB_STAAW       -------GGAKIYLKREDLNHTGAHKINNALGQALLAKRMGKKKLVAETGAGQHGVASAT
TRPB_STAAT       -------GGAKIYLKREDLNHTGAHKINNALGQALLAKRMGKKKLVAETGAGQHGVASAT
TRPB_STAAC       -------GGAKIYLKREDLNHTGAHKINNALGQALLAKRMGKKKLVAETGAGQHGVASAT
TRPB_STAAS       -------GSAKIYLKREDLNHTGAHKINNALGQALLAKRMGKKKLVAETGAGQHGVASAT
TRPB_STAS1       -------GGAKIYLKREDLNHTGAHKINNALGQALLAKRMGKNKLVAETGAGQHGVASAT
TRPB_STAEQ       -------GGAKIYLKREDLNHTGAHKINNAIGQALLAKRMGKTKLVAETGAGQHGVASAT
TRPB_STAES       -------GGAKIYLKREDLNHTGAHKINNAIGQALLAKRMGKTKLVAETGAGQHGVASAT
TRPB_LEPIC       -------GGAKIWLKREDLNHTGAHKINNTIGQVLIAKAMGKTRIIAETGAGQHGVATAT
TRPB_LEPIN       -------GGAKIWLKREDLNHTGAHKINNTIGQVLIAKAMGKTRIIAETGAGQHGVATAT
TRPB_LEPBJ       -------DGARIWLKREDLNHTGAHKINNTIGQVLIAKAMGKTRIIAETGAGQHGVATAT
TRPB_LEPBL       -------DGARIWLKREDLNHTGAHKINNTIGQVLIAKAMGKTRIIAETGAGQHGVATAT
TRPB2_NOSS1      DGT-----GAQIYLKREDLNHTGAHKINNALGQVLLAKRMGKQRIIAETGAGQHGVATAT
TRPB_TRIV2       DGT-----GAQIYLKREDLNHTGAHKINNALGQVLLAKRMGKQRIIAETGAGQHGVATAT
TRPB1_NOSS1      DGT-----GAQIYLKREDLNHTGAHKINNALAQVLLAKRIGKQRVIAETGAGQHGVATAT
TRPB_TRIEI       DGT-----GPQIYLKREDLNHTGAHKINNALGQALLAQRMGKQRIIAETGAGQHGVATAT
TRPB_THEEB       DQV-----QPQIYLKREDLNHTGAHKINNALGQVLLAKRMGKQRIIAETGAGQHGVATAT
TRPB_SYNY3       DGT-----YPLIYLKREDLNHTGAHKINNALGQVLLAKRMGKKRIIAETGAGQHGVATAT
TRPB_SYNJB       ---------PQIYLKREDLNHTGAHKINNALGQVLLAVRMGKRRIIAETGAGQHGVATAT
TRPB_GLOVI       ---------GRIFLKREDLNHTGAHKINNALGQALLALRMGKRRIIAETGAGQHGVATAT
TRPB_PROM1       TLK-----GPRIWLKREDLNHTGAHKINNALGQALLAIRMGKKRIIAETGAGQHGVATAT
TRPB_PROMT       TLK-----GPRIWLKREDLNHTGAHKINNALGQALLAIRMGKKRIIAETGAGQHGVATAT
TRPB_PROMA       TV------GPRIWLKREDLNHTGAHKINNALGQALLAIRMGKKRIIAETGAGQHGVATAT
TRPB_SYNPW       DG------GPRIWLKREDLNHTGAHKINNALGQALLALRMGKKRVIAETGAGQHGVATAT
TRPB_PROMM       DG------GPRIWLKREDLNHTGAHKINNALGQALLALRMGKKRIIAETGAGQHGVATAT
TRPB_SYNSC       DG------GPRIWLKREDLNHTGAHKINNALGQALLALRMGKKRIIAETGAGQHGVATAT
TRPB_SYNPX       DG------GPRIWLKREDLNHTGAHKINNALGQALLALRMGKKRIIAETGAGQHGVATAT
TRPB_SYNS9       DG------GPRIWLKREDLNHTGAHKINNALGQALLALRMGKKRIIAETGAGQHGVATAT
TRPB_SYNS3       DG------GPRIWLKREDLNHTGAHKINNALGQALLALRMGKKRIIAETGAGQHGVATAT
TRPB_PROMP       TS------TSRIWLKREDLNHTGAHKINNALGQALLAIRMGKQRIIAETGAGQHGVATAT
TRPB_PROM5       TC------TSRIWLKREDLNHTGAHKINNALGQALLAIRMGKERIIAETGAGQHGVATAT
TRPB_PROMS       QA------TPRIWLKREDLNHTGAHKINNALGQALLAIRMGKKRIIAETGAGQHGVATAT
TRPB_PROM0       QA------TPRIWLKREDLNHTGAHKINNALGQALLAIRMGKKRIIAETGAGQHGVATAT
TRPB_PROM9       HA------TTRIWLKREDLNHTGAHKINNALGQALLAIRMGKKRIIAETGAGQHGVATAT
TRPB_PROM2       KA------IPKIWLKREDLNHTGAHKINNALGQALLAIRMGKKRIIAETGAGQHGVATAT
TRPB_MYCTU       ---------ARIFLKREDLNHTGSHKINNVLGQALLARRMGKTRVIAETGAGQHGVATAT
TRPB_MYCBO       ---------ARIFLKREDLNHTGSHKINNVLGQALLARRMGKTRVIAETGAGQHGVATAT
TRPB_MYCLE       ---------VRIFLKREDLNHTGSHKINNVLGQTLLAQRMGKTRVIAETGAGQHGVATAT
TRPB_MYCIT       ---------ARIFLKREDLNHTGSHKINNVLGQALLAQRMGKKRVIAETGAGQHGVATAT
TRPB_STRAW       ---------ARVFLKREDLNHTGSHKINNVLGQALLTRRMGKTRVIAETGAGQHGVATAT
TRPB_STRCO       ---------ARIFLKREDLNHTGSHKINNVLGQALLTKRMGKTRVIAETGAGQHGVATAT
TRPB_LEIXX       ---------ARLLLKREDLNHTGSHKINNVLGQAILTKRIGKTRVIAETGAGQHGVAIAT
TRPB_SHIFL       ---------TTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGAGQHGVASAL
TRPB_ECOLC       ---------TTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGAGQHGVASAL
TRPB_SHIF8       ---------TTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGAGQHGVASAL
TRPB_ECOLI       ---------TTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGAGQHGVASAL
TRPB_ECO24       ---------TTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGAGQHGVASAL
TRPB_ECOHS       ---------TTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGAGQHGVASAL
TRPB_SHISS       ---------TTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGAGQHGVASAL
TRPB_ECO57       ---------TTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGAGQHGVASAL
TRPB_SHIBS       ---------TTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGAGQHGVASAL
TRPB_ECOK1       ---------TTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTKIIAETGAGQHGVASAL
TRPB_ECOUT       ---------TTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTKIIAETGAGQHGVASAL
TRPB_SHIDS       ---------TTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGAGQHGVASAL
TRPB_ECOL5       ---------TTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGAGQHGVASAL
TRPB_ECOL6       ---------TTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGAGQHGVASAL
TRPB_CITK8       ---------TTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGAGQHGVASAL
TRPB_SALTY       ---------TTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKSEIIAETGAGQHGVASAL
TRPB_SALPB       ---------TTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKSEIIAETGAGQHGVASAL
TRPB_SALTI       ---------TTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKSEIIAETGAGQHGVASAL
TRPB_SALPA       ---------TTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKSEIIAETGAGQHGVASAL
TRPB_SALCH       ---------TTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKSEIIAETGAGQHGVASAL
TRPB_SALAR       ---------TTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKSEIIAETGAGQHGVASAL
TRPB_CROS8       ---------TTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGAGQHGVASAL
TRPB_KLEP7       ---------TTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGAGQHGVASAL
TRPB_ENT38       ---------TTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGAGQHGVASAL
TRPB_PECAS       ---------TKLYLKREDLLHGGAHKTNQVLGQALLAKRMGKSEIIAETGAGQHGVATAL
TRPB_YERPA       ---------TKLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGAGQHGVASAL
TRPB_YERPS       ---------TKLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGAGQHGVASAL
TRPB_YERPN       ---------TKLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGAGQHGVASAL
TRPB_YERPP       ---------TKLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGAGQHGVASAL
TRPB_YERP3       ---------TKLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGAGQHGVASAL
TRPB_YERPE       ---------TKLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGAGQHGVASAL
TRPB_YERE8       ---------TKLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGAGQHGVASAL
TRPB_SERP5       ---------TKLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGAGQHGVASAL
TRPB_SODGM       ---------TKLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGAGQHGVASAL
TRPB_PHOLL       ---------TRLYLKREDLLHGGAHKTNQVLGQALLAKRMGKNEIIAETGAGQHGVATAL
TRPB_HAEIN       ---------TKLYLKREDLLHGGAHKTNQVLGQILLAKRMGKTRIIAETGAGQHGVATAL
TRPB_HAEIE       ---------TKLYLKREDLLHGGAHKTNQVLGQILLAKRMGKTRIIAETGAGQHGVATAL
TRPB_HAEIG       ---------TKLYLKREDLLHGGAHKTNQVLGQILLAKRMGKTRIIAETGAGQHGVATAL
TRPB_HAEI8       ---------TKLYLKREDLLHGGAHKTNQVLGQILLAKRMGKTRIIAETGAGQHGVATAL
TRPB_ACTSZ       ---------TKLYLKREDLLHGGAHKTNQVLGQILLAKRMGKTRIIAETGAGQHGVATAL
TRPB_HISS2       ---------TKLYLKREDLLHGGAHKTNQVLGQILLAKRMGKTRIIAETGAGQHGVATAL
TRPB_ACTP2       ---------TKLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTRIIAETGAGQHGVATAL
TRPB_PASMU       ---------TKLYLKREDLLHGGAHKTNQVLGQILLAKRMGKTRIIAETGAGQHGVATAL
TRPB_MANSM       ---------TKLYLKREDLLHGGAHKTNQVLGQILLAKRMGKTRIIAETGAGQHGVATAL
TRPB_BUCAP       ---------TRIYLKREDLLHGGAHKTNQVLGQAMLAVKMKKKEIIAETGAGQHGVAAAI
TRPB_BUCAI       ---------TKIYLKREDLLHGGAHKTNQVLGQAMLAIRMKKKEIIAETGAGQHGVASAI
TRPB_BUCDN       ---------TRIYLKREDLLHGGAHKTNQVLGQAILAIRMKKNEIIAETGAGQHGVATAI
TRPB_BUCMH       ---------TKIYLKREDLLHGGAHKTNQVLGQALLAKKMKKKEIIAETGAGQHGVAAAF
TRPB_BUCSC       ---------TRIYLKREDLLHGGAHKTNQVLGQALLAKQMKKKEIIAETGAGQHGVAAAL
TRPB_BUCBP       ---------TKLYLKREDLLHGGAHKTNQVLGQALLAKKMSKKEIIAETGAGQHGVATAL
TRPB_BLOPB       ---------AKLYLKREDLLHGGSHKTNQVLGQALLAKRMSKTEIIAETGAGQHGVAVSI
TRPB_BLOFL       ---------SKLYLKREDLLHGGSHKTNQVLGQALLAKRMHKKEIIAETGAGQHGVAVSI
TRPB1_VIBPA      ---------TKLYLKREDLLHGGAHKTNQVLGQALLAKRMGKHEIIAETGAGQHGVATAL
TRPB_VIBCB       ---------TKLYLKREDLLHGGAHKTNQVLGQALLAKRMGKNEIIAETGAGQHGVATAL
TRPB_VIBVU       ---------TKLYLKREDLLHGGAHKTNQVLGQALLAKRMGKNEIIAETGAGQHGVATAL
TRPB_VIBVY       ---------TKLYLKREDLLHGGAHKTNQVLGQALLAKRMGKNEIIAETGAGQHGVATAL
TRPB_ALIF1       ---------TKLYLKREDLLHGGAHKTNQVLGQALLAKRMGKDEIIAETGAGQHGVATAL
TRPB_VIBC3       ---------TKLYLKREDLLHGGAHKTNQVLGQALLAKRMGKHEIIAETGAGQHGVATAL
TRPB_VIBCH       ---------TKLYLKREDLLHGGAHKTNQVLGQALLAKRMGKHEIIAETGAGQHGVATAL
TRPB_VIBME       ---------TKLYLKREDLLHGGAHKTNEVLGQGLVGKRMGKSAIIAETGAGQHGVGSAL
TRPB_PHOPR       ---------TKLYLKREDLLHGGAHKTNQVLGQALLAKRMGKKEIIAETGAGQHGVATAL
TRPB_FRAT1       ---------TKLYLKREDLLHGGAHKTNQVLGQALLAKRMGKKEIIAETGAGQHGVATAL
TRPB_FRATT       ---------TKLYLKREDLLHGGAHKTNQVLGQALLAKRMGKKEIIAETGAGQHGVATAL
TRPB_FRATH       ---------TKLYLKREDLLHGGAHKTNQVLGQALLVKRMGKKEIIAETGAGQHGVATAL
TRPB_FRATF       ---------TKLYLKREDLLHGGAHKTNQVLGQALLVKRMGKKEIIAETGAGQHGVATAL
TRPB_FRATO       ---------TKLYLKREDLLHGGAHKTNQVLGQALLVKRMGKKEIIAETGAGQHGVATAL
TRPB_FRATW       ---------TKLYLKREDLLHGGAHKTNQVLGQALLAKRMGKKEIIAETGAGQHGVATAL
TRPB_FRATN       ---------TTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKKEIIAETGAGQHGVATAL
TRPB_FRAP2       ---------TKLYLKREDLLHGGAHKTNQVLGQALLAKRMGKKEIIAETGAGQHGVATAL
TRPB_AERHH       ---------TRLYLKREDLLHGGAHKTNQVLGQALLAKRMGKSEIIAETGAGQHGVATAL
TRPB_AERS4       ---------TRLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGAGQHGVATAL
TRPB_PSYIN       ---------TKLYLKREDLLHGGAHKTNQVLGQALLAKRMGKKEIIAETGAGQHGVAAAL
TRPB_SHEPA       ---------TKIYLKREDLLHGGAHKTNQVLGQALLAKRMGKKEIIAETGAGQHGVATAL
TRPB_SHEHH       ---------AKIYLKREDLLHGGAHKTNQVLGQALLAKRMGKKEIIAETGAGQHGVATAL
TRPB_SHELP       ---------VKIYLKREDLLHGGAHKTNQVLGQALLAKRMGKKEIIAETGAGQHGVATAL
TRPB_SHESM       ---------VKIYLKREDLLHGGAHKTNQVLGQALLAKRMGKKEIIAETGAGQHGVATAL
TRPB_SHESA       ---------VKIYLKREDLLHGGAHKTNQVLGQALLAKRMGKKEIIAETGAGQHGVATAL
TRPB_SHESR       ---------VKIYLKREDLLHGGAHKTNQVLGQALLAKRMGKKEIIAETGAGQHGVATAL
TRPB_SHEON       ---------VKIYLKREDLLHGGAHKTNQVLGQALLAKRMGKKEIIAETGAGQHGVATAL
TRPB_SHEB8       ---------VKIYLKREDLLHGGAHKTNQVLGQALLAKRMGKKEIIAETGAGQHGVATAL
TRPB_SHEB5       ---------VKIYLKREDLLHGGAHKTNQVLGQALLAKRMGKKEIIAETGAGQHGVATAL
TRPB_SHESW       ---------VKIYLKREDLLHGGAHKTNQVLGQALLAKRMGKKEIIAETGAGQHGVATAL
TRPB_SHEPC       ---------VKIYLKREDLLHGGAHKTNQVLGQALLAKRMGKKEIIAETGAGQHGVATAL
TRPB_SHEB9       ---------VKIYLKREDLLHGGAHKTNQVLGQALLAKRMGKKEIIAETGAGQHGVATAL
TRPB_SHEFN       ---------VKIYLKREDLLHGGAHKTNQVLGQALLAKRMGKKEIIAETGAGQHGVATAL
TRPB_SHEDO       ---------VKIYLKREDLLHGGAHKTNQVLGQALLAKRMGKKEIIAETGAGQHGVATAL
TRPB_SHEAM       ---------VKIYLKREDLLHGGAHKTNQVLGQALLAKRMGKKEIIAETGAGQHGVATAL
TRPB_PSEA6       ---------VKLYLKREDLLHGGAHKTNQVLGQALLTKRMGKTEVIAETGAGQHGVATAL
TRPB_HELPY       ---------VKLYLKREDLIHGGAHKTNQALGQALLAKKMGKTRIIAETGAGQHGVATAI
TRPB_HELPJ       ---------VKLYLKREDLIHGGAHKTNQALGQALLAKKMGKTRIIAETGAGQHGVATAI
TRPB_CORGL       GF-------ARIFLKREDLVHGGAHKTNQVIGQVLLAKRMGKTRIIAETGAGQHGTATAL
TRPB_CORGB       GF-------ARIFLKREDLVHGGAHKTNQVIGQVLLAKRMGKTRIIAETGAGQHGTATAL
TRPB1_COREF      GY-------ARIFLKREDLVHGGAHKTNQVIGQALLAKRMGKTRIIAETGAGQHGTATAL
TRPB2_COREF      GT-------ARIFLKREDLVHGGAHKGNQTIGQALLAKRLGKTRLIAETGAGQHGTATAM
TRPB_METJA       ---------CKVYLKREDLAHLGAHKINNALGQALLAKKMGKKRVIAETGAGQHGVATAA
TRPB_METKA       ---------VKVYLKREDLVHGGAHKLNNTLGQALLADRMGKDRIIAETGAGQHGLATAM
TRPB1_METTH      ---------CRVYLKREDMLHTGAHKINNTIGQALLARYMGKTRIIAETGAGQHGIATAA
TRPB2_METTM      ---------CRVYLKREDMLHTGAHKINNTIGQALLAGYMGKRRLIAETGAGQHGIATAA
TRPB1_METMA      ---------TKIYLKREDLVHGGAHKLNNAIGQALLAKYMGKTRLIAETGAGQHGTATAM
TRPB1_METAC      ---------TKVYLKREDLVHGGAHKLNNALGQALLAKFMGKTRLIAETGAGQHGTATAM
TRPB_HALVD       ---------REVYLKREDLLHGGAHKLNNALGQVLLAKYMGKERIIAETGAGQHGTATAM
TRPB_HALSA       ---------VDVYLKREDLLHGGAHKLNNALGQVLLAKYMGKDRIVAETGAGQHGTATAM
TRPB1_THEMA      ---------ARIYLKREDLLHTGAHKINNAIGQVLLAKKMGKTRIIAETGAGQHGVATAT
TRPB_METVO       ---------AKIYLKREDLLHGGAHKTNNTIGQALLAKKMGKTRIIAETGAGQHGVGTSM
TRPB_META3       ---------AKIYLKREDLLLGGAHKINNSLGQALLAKRIGKTRIIAETGAGEHGLSTAM
TRPB1_PYRFU      ---------AKIYLKREDLVHGGAHKTNNAIGQALLAKFMGKTRLIAETGAGQHGVATAM
TRPB1_PYRAB      ---------AKIYLKREDLLHGGAHKTNNAIGQALLAKFMGKTRLIAETGAGQHGVATAM
TRPB1_THEKO      ---------AKIYLKREDLLHGGAHKTNNGIGQALLAKFMGKERLIAETGAGQHGVATAM
TRPB1_ARCFU      ---------VKIYLKREDLLHGGAHKINNTIGQALLAKFMGKKRVIAETGAGQHGVATAM
TRPB2_CHLCV      ---------PRIFLKREDLLHTGAHKINNALGQCLLAKHLGKTRIIAETGAGQHGVATAT
TRPB1_CHLCV      ---------PRIFLKREDLLHTGAHKINNVLGQCLIAKFQGKTRVVAETGAGQHGVALAA
TRPB2_WOLSU      ---------AKIYLKREDLNHTGAHKINNTVIQGLLAKRLGKKKIIAETGAGQHGVATAT
TRPB_BACTN       ---------CKMYLKREDLNHTGAHKINNTIGQILLARRMGKKRIIAETGAGQHGVATAT
TRPB_HELHP       ---------NDIYLKFEGLANTGAHKINNALGQVLLAKHMKKKRVIAETGAGQHGLATAA
TRPB2_AQUAE      --------PAKIFYKNESVSPPGSHKPNTAVAQAYYNKISGVKRLTTETGAGQWGSALSF
TRPB2_ARCFU      --------PARIYFKYEGASPPGSHKPNTAVAQAYYNAKEGVERLTTETGAGQWGSALCF
TRPB2_METMA      --------PAKIYYKYEGVSPAGSHKTNTSIAQAYYNMKEGTERLTTETGAGQWGSALSL
TRPB2_METAC      --------PAKIYYKYEGVSPAGSHKTNTSIAQAYYNMKEGTERLTTETGAGQWGSALSL
TRPB2_THEMA      --------PARIYYKYEGVSPTGSHKPNTAIAQAYYNKIEGVKRLVTETGAGQWGSALSY
TRPB2_METTH      --------PARIYYKREDYSPTGSHKLNTAIAQAYYARKDGAERLTTETGAGQWGTALSL
TRPB2_PYRAB      --------PARIYFKYEGATVTGSHKINTALAQAYYAKKQGIERLVTETGAGQWGTALSL
TRPB2_PYRFU      --------PARIYFKFEGATVTGSHKINTALAQAYYAKKEGIERLVTETGAGQWGTALSL
TRPB_PYRHO       --------PARIYFKYEGATVTGSHKINTALAQAYYAKKEGIKRLVTETGAGQWGTALSL
TRPB2_THEKO      --------PARIYFKYEGATVTGSHKINTALAQAYYAKRQGIERLVTETGAGQWGTALSL
TRPB2_AERPE      --------PAEIYYKYEGVTPTGSHKINTALAQAYYNKLEGVERLVTETGAGQWGSALSA
TRPB1_SACS2      --------PARIYFKYEGATPTGSHKINTAIPQAYFAKEEGIEHVVTETGAGQWGTAVAL
TRPB1_SULTO      --------PAKIYFKFEGATPTGSHKINTAVPQAYFAAEEGISHVVTETGAGQWGTAVAL
TRPB_PICTO       --------GGKIFFKFEGATATGSHKINTAIAQAYYAMNENANGVTTETGAGQWGSATAL
TRPB2_SACS2      --------NIKIYLKMESYTYTGSHKINSALAHVYYAKLDNAKFVTTETGAGQWGSSVAL
TRPB2_SULTO      --------YIKIYMKMESHTYTGSHKINSALAHVYFAKLDNAKFVSTETGAGQWGSAVAL
TRPB_THEAC       --------NLKIFLKMESYTYSGSHKINSALAHVFFAREEGAKFVSTETGAGQWGSAVAL
TRPB_THEVO       --------NIKIYLKMESYTYSGSHKINSALAHVFFAKQDNAKFVSTETGAGQWGSAVAL
TRPB1_AERPE      G-------RVRIYYKSEAVLPTGSHKINTAIAQAYYAKLDGAKEIVTETGAGQWGLAAST
TRPB_PYRAE       --------GVRIYYKYEGVLPVGSHKLNTALAQAYYAKADGAVEVATETGAGQWGMAVSL
                            :  * :     *:** *  : .           : :*****  * . . 

TRPB1_WOLSU      AAAYFGMECEIHMGEVDIAKEHPNVIRMKMLGAKVVPVSFGER----------------T
TRPB2_VIBPA      AAALVGLECDIYMGEVDIAKEHPNVVRMRILGANVIPATHGRK----------------T
TRPB_CALS4       AAAMFGMECEIFMGEEDIKRQALNVFRMKLLGAKVTAVTSGTR----------------T
TRPB_CLOAB       AAALFGLECEVFMGAEDVERQALNVFRMKILGAKVNSVKSGTN----------------T
TRPB_CLOB8       VAAKFGLECKIFMGEEDIKRQAMNVKKMELLGAEVVPVLNGVR----------------T
TRPB_FUSNN       AAAKFGMQCDIYMGALDVERQRLNVFRMEILGATVHAVEKGER----------------T
TRPB_CLONN       AAALFGMECTIFMGEEDIKRQKLNTFKMELLGAKIKPVKSGNG----------------T
TRPB_LACP3       IAALMGMDCEIFMGKEDTDRQKLNVYRMELLGAKVHPVTSGSM----------------V
TRPB_LACCA       IAALMGMDCEIFMGKEDTDRQKLNVYRMELLGAKVHPVTSGSM----------------V
TRPB_LACPL       IAALFGMECDVFMGKKDTNRQALNVYRMQLLGAKVHPVTTGSM----------------V
TRPB_CAMJR       AAALLGLECEIYMGATDVQRQALNVYKMELLGAKIHAVQSGLK----------------T
TRPB_CAMJE       AAALLGLECEIYMGATDVQRQALNVYKMELLGAKIHAVQSGLK----------------T
TRPB_CAMJ8       AAALLGLECEIYMGATDVQRQALNVYKMELLGAKIHAVQSGLK----------------T
TRPB_CAMJJ       AAALLGLECEIYMGATDVQRQALNVYKMELLGAKIHAVQSGLK----------------T
TRPB_CAMJD       AAALLGLECEIYMGATDVQRQALNVYKMELLGAKIHAVQSGLK----------------T
TRPB_THET2       VAALFGLECVVYMGEEDVRRQALNVFRMKLLGAEVRPVAAGSR----------------T
TRPB_THET8       VAALFGLECVVYMGEEDVRRQALNVFRMKLLGAEVRPVAAGSR----------------T
TRPB_DEIRA       AAALLGLSCVVYMGEEDMRRQSLNVFRMQLLGAEVRPVTSGTA----------------T
TRPB_CHLTE       VCALFGLDCIVYMGEEDIRRQAPNVARMKLLGTEVRPVTAGSR----------------T
TRPB1_AQUAE      ASALFGLECVVYMGEEDAERQALNVFRMKLLGAKVEIVKSGSR----------------T
TRPB_BRASB       LCARFGLDCVVYMGAVDVERQQPNVLRMEMLGAKVVPVQSGAR----------------T
TRPB_BRASO       LCARFGLDCVVYMGAVDVERQQPNVLRMEMLGAKVIPVQSGAR----------------T
TRPB_BRADU       LCARFGLECVVYMGAVDVERQQPNVIRMEMLGAKVVPVQSGTR----------------T
TRPB_PARL1       VCARFGLPCVIYMGTTDIERQKPNVFRMKLLGAEVVPVTSGTG----------------T
TRPB_CAUVC       VCARFGLPCVVYMGATDVERQKPNVFRMNLLGAEVRPVSSGTG----------------T
TRPB_ACICJ       VAALFGLPCIVYMGATDVERQQPNVFRMKLLGAEVRPVTSGAS----------------T
TRPB_NOVAD       VCARFGLPCVIFMGATDVARQAPNVFRMKLLGAEVVPVTAGAG----------------T
TRPB_RHOS4       VCAKFGLKCVVYMGAHDVERQAPNVFRMRLLGAEVVPVTSGRG----------------T
TRPB_RUEST       VCAKFGLKCVVYMGAHDVRRQAPNVFRMRLLGAEVIPVTSGRG----------------T
TRPB_RUEPO       VCAKFGLKCVVYMGAHDVRRQAPNVFRMRLLGAEVIPVTSGRG----------------T
TRPB_DINSH       VCAKFGLKCVVYMGAHDVERQAPNVFRMKLLGAEVVPVTSGRG----------------T
TRPB_ROSDO       VCAKFGLKCVVYMGAHDVERQAPNVFRMRLLGAEVVPVTSGRG----------------T
TRPB_JANSC       VCAKFGLKCIVYMGATDVERQAPNVFRMKLLGAEVVPVTSGRG----------------T
TRPB_PARDP       VCARFGLKCIVYMGAHDVERQAPNVFRMRLLGAEVVPVTSGRG----------------T
TRPB_BRUSU       VAARFGLPCIVYMGATDVERQKPNVFRMKLLGAEVKPVSAGNG----------------T
TRPB_BRUC2       VAARFGLPCIVYMGATDVERQKPNVFRMKLLGAEVKPVSAGNG----------------T
TRPB_BRUSI       IAARFGLPCIVYMGATDVERQKPNVFRMKLLGAEVKPVSAGNG----------------T
TRPB_BRUAB       VAARFGLPCIVYVGATDVERQKPNVFRMKLLGAEVKPVSAGNG----------------T
TRPB_BRUA2       VAARFGLPCIVYVGATDVERQKPNVFRMKLLGAEVKPVSAGNG----------------T
TRPB_BRUME       VAARFGLPCIVYVGASDVERQKPNVFRMKLLGAEVKPVSAGNG----------------T
TRPB_OCHA4       VAARFGLPCVVYMGATDVERQKPNVFRMKLLGAEVIPVSAGNG----------------T
TRPB_RHILO       VAARFGYPCVVYMGATDVARQSPNVFRMKLLGAEVRPVTAGHG----------------T
TRPB_RHIEC       VAARFGLPCVVYMGATDVERQAPNVFRMKLLGAEVKPVTAGSG----------------T
TRPB_RHIL3       VAARFGLPCVVYMGATDVERQAPNVFRMKLLGAEVKPVTAGSG----------------T
TRPB_SINMW       VAARFGLPCVVYMGATDVERQAPNVFRMKLLGAEVKPVTAGHG----------------T
TRPB_RHIME       VAARFGLPCVVYMGATDVERQAPNVFRMKLLGAEVKPVTAGNG----------------T
TRPB_AGRFC       VAARFGLPCVVYMGATDVARQAPNVFRMKLLGAEVKPVTAGHG----------------T
TRPB_CHESB       VAARFGLPCVVYMGATDVERQAPNVFRMRLLGAEVKPVTSGHG----------------T
TRPB_PSEPF       VAARFGLDCVIYMGTTDIERQQANVFRMKLLGAEVIPVVAGTG----------------T
TRPB_PSESY       VAARFGLQCVIYMGTTDIERQQANVFRMKLLGAEVIPVVAGTG----------------T
TRPB_PSEF5       VAARFGLDCVIYMGTTDIERQQANVFRMKLLGAEVIPVVAGTG----------------T
TRPB_PSEAE       VAARFGLQCVIYMGTTDIDRQQANVFRMKLLGAEVIPVTAGTG----------------T
TRPB_PSESH       VAARFGLPCVIYMGATDIERQQANVFRMKLLGAEIVPVTSGTG----------------T
TRPB_PSE14       VAARFGLPCVIYMGATDIERQQANVFRMKLLGAEIVPVTSGTG----------------T
TRPB_PSEU2       VAARFGLPCVIYMGATDIERQQANVFRMRLLGAEIVPVTSGTG----------------T
TRPB_PSESM       VAARFGLPCVIYMGATDIERQQANVFRMKLLGAEIVPVTSGTG----------------T
TRPB_PSEPU       VAARFGLPCVIYMGATDIERQQANVFRMKLLGAEIVPVTAGTG----------------T
TRPB_PSEPG       VAARFGLPCVIYMGATDIERQQANVFRMKLLGAEIVPVTAGTG----------------T
TRPB_PSEPK       VAARFGLPCVIYMGATDIERQQANVFRMKLLGAEIVPVTAGTG----------------T
TRPB_PSEP1       VAARFGLPCVIYMGATDIERQQANVFRMKLLGAEIVPVTAGTG----------------T
TRPB_PSEE4       VAARFGLPCVIYMGATDIERQQANVFRMKLLGAEIVPVTAGTG----------------T
TRPB_ACICA       IAARLGLECVVFMGAEDVKRQAMNVYRMRLLGATVIPVQSGSK----------------T
TRPB_ACIAD       IAARLGLECVVFMGAEDVKRQAMNVYRMRLLGATVIPVQSGSK----------------T
TRPB_LEGPA       VAAKFGFQCVVYMGSEDIKRQSSNVYRMKLLGAEVVPVTSGSK----------------T
TRPB_LEGPL       VAAKFGFQCVVYMGSEDIKRQSSNVYRMKLLGAEVVPVTSGSK----------------T
TRPB_LEGPH       VAAKFGFQCVVYMGSEDIKRQSSNVYRMKLLGAEVVPVTSGSK----------------T
TRPB_LEGPC       VAAKFGFQCVVYMGSEDIKRQSSNVYRMKLLGAEVVPVTSGSK----------------T
TRPB_BORBR       VAARYGMECVVFMGSEDVRRQASNVYRMKLLGATVVPVDSGSR----------------T
TRPB_BORPA       VAARYGMECVVFMGSEDVRRQASNVYRMKLLGATVVPVDSGSR----------------T
TRPB_BORPE       VAARYGMECVVFMGSEDVRRQASNVYRMKLLGATVVPVDSGSC----------------T
TRPB_RALSO       IAARYGMECVVYMGSEDVRRQAANVYRMKLLGATVVPVESGSR----------------T
TRPB_POLNA       ICARYGLECVVYMGSEDVKRQSPNVYRMNLLGATVVPVESGSK----------------T
TRPB_POLSJ       ICARYGLECVVYMGSEDVKRQSPNVYRMKLLGATVVPVESGSK----------------T
TRPB_ACIAC       ICARYGLECVVYMGAEDVKRQSPNVYRMKLLGATVVPVESGSR----------------T
TRPB_METPP       ICARYGMECVVYMGSEDVKRQSPNVYRMHLLGARVVPVDSGSK----------------T
TRPB_METFK       IAARLGLECVVYMGAEDVKRQAPNVFRMKLLGATVVPVESGSK----------------T
TRPB_NITEU       VAARYGMECVVYMGSEDVKRQATNVYRMKLLGATVIPVDSGSC----------------T
TRPB_NITEC       VAARYGMECVVYMGSEDVKRQATNVYRMKLLGATVIPVDSGSR----------------T
TRPB_NITMU       VAARYGMECVIYMGSVDVERQAANVYRMKLLGAEVIPVESGSR----------------T
TRPB_METCA       VAARLGMECVVYMGAVDVQRQALNVFRMKLLGATVIAVDSGSR----------------T
TRPB_XANAC       VAARLGLECVVYMGATDIERQKINVYRMKLLGATVIPVTSGSA----------------T
TRPB_XANC5       VAARLGLECVVYMGATDIERQKINVYRMKLLGATVIPVTSGSA----------------T
TRPB_XANOM       VAARLGLECLVYMGATDIERQKINVYRMKLLGATVIPVTSGSA----------------T
TRPB_XANCP       VAARLGLECVVYMGATDIERQKINVYRMQLLGAKVIPVTSGSA----------------T
TRPB_XANC8       VAARLGLECVVYMGATDIERQKINVYRMQLLGAKVIPVTSGSA----------------T
TRPB_XYLFA       VAARLGLECVVYMGATDIERQQINVYRMKLLGATVVPVTSGSA----------------T
TRPB_XYLFT       VAARLGLECVVYMGATDIQRQQINVYRMKLLGATVVPVTSGSA----------------T
TRPB_VESOH       VAARLGLECVVYMGEVDVARQSLNVFRMKLLGAKVIPVTSGSK----------------T
TRPB_RUTMC       VAARLGLECVVYMGEVDVARQALNVFRMKLLGATVIPVTLGSK----------------T
TRPB_NEIG1       VAARFGMTCDVYMGADDIQRQMPNVFRMKLLGANVIGVDSGSR----------------T
TRPB_NEIGO       VAARFGMTSDVYMGADDIQRQMPNVFRMKLLGANVIGVDSGSR----------------T
TRPB_NEIMF       VAARFGMTCDVYMGADDIQRQMPNVFRMKLLGANVVGVESGSR----------------T
TRPB_NEIMA       VAARFGMTCDVYMGADDIQRQMPNVFRMKLLGANVVGVESGSR----------------T
TRPB_NEIMB       VAARFGMTCDVYMGADDIQRQMPNVFRMKLLGANVVGVESGSR----------------T
TRPB_NEIM0       VAARFGMTCDVYMGADDIQRQMPNVFRMKLLGANVVGVESGSR----------------T
TRPB_CHRVO       VAARYGMECVVYMGAEDVKRQSPNVFRMKLLGATVVPVESGSK----------------T
TRPB_RHOBA       ACAHFGLPCTVYMGAEDIRRQKPNVFSMKLLGANISAVESGSR----------------T
TRPB_GEOSE       VAAHFGMDCIVFMGEEDIKRQELNVFRMKLLGAEVVPVSSGNR----------------T
TRPB_GEOTN       VAAHFGMECIVFMGEEDMKRQELNVFRMKLLGAEVVPVLSGNR----------------T
TRPB_BACVZ       AAAKFGFKCTVFMGEEDVARQSLNVFRMKLLGAEVVPVTSGNG----------------T
TRPB_BACSU       VAAKFGFSCTVFMGEEDVARQSLNVFRMKLLGAEVVPVTSGNG----------------T
TRPB_BACLD       VAAKFGLSCIVFMGEEDVARQSLNVFRMKLLGAEVVPVSSGNG----------------T
TRPB_BACP2       VAAKFGLSCTVFMGKEDVERQSLNVFRMKLLGAEVIPVTSGNG----------------T
TRPB_BACHD       IAARFGLECKVFMGEEDMERQALNVFRMELLGAEVVPATSGSK----------------T
TRPB_BACSK       VASRLGMECKVFMGVEDMKRQELNVFRMELLGAEVVPAETGSR----------------T
TRPB_BACAN       VCALLGLECVIFMGEEDVRRQKLNVFRMELLGAKVESVAAGSG----------------T
TRPB_BACHK       VCALLGLECVIFMGEEDVRRQKLNVFRMELLGAKVESVAAGSG----------------T
TRPB_BACAH       VCALLGLECVIFMGEEDVRRQKLNVFRMELLGAKVESVAAGSG----------------T
TRPB_BACCZ       VCALLGLECVIFMGEEDVRRQKLNVFRMELLGAKVESVAAGSG----------------T
TRPB_BACCR       VCALLGLECVIFMGEEDVRRQKLNVFRMELLGAKVESVAAGSG----------------T
TRPB_BACC1       VCALLGLECVIFMGEEDVRRQKLNVFRMELLGAKVESVAAGSG----------------T
TRPB_OCEIH       VCSLLGLECIVFMGEEDIKRQKLNVFRMELLGAEVVSVSQGSG----------------T
TRPB_LACLS       AAALFGMECTIYMGEEDVKRQSLNVFRMELLGAKVHSVTDGSR----------------V
TRPB_LACLM       AAALFGMECTIYMGEEDVKRQSLNVFRMELLGAKVHSVTDGSR----------------V
TRPB_LACLA       AAALFGMECTIYMGEEDVKRQSLNVFRMELLGAKVHSVTDGSR----------------V
TRPB_STRR6       AAALFNMECIIYMGEEDVKRQALNVFRMELLGAKVEAVTDGSR----------------V
TRPB_STRP2       AAALFNMECIIYMGEEDVKRQALNVFRMELLGAKVEAVTDGSR----------------V
TRPB_STRPN       AAALFNMECTIYMGEEDVKRQALNVFRMELLGAKVEAVTDGSR----------------V
TRPB_STRT2       AAALFDMDCTIYVGEEDVKRQALNVFRMELLGAKVFSVTDGSR----------------V
TRPB_STRT1       AAALFDMDCTIYMGEEDVKRQALNVFRMELLGAKVFSVTDGSR----------------V
TRPB_STRTD       AAALFDMDCTIYMGEEDVKRQALNVFRMELLGAKVFSVTDGSR----------------V
TRPB_STRMU       AAALFDMECTIYMGEEDVKRQALNVFRMELLGAKVHSVTDGSR----------------V
TRPB_LISMF       VAALFNMECTIFMGEEDVKRQSLNVFRMELLGAKVVSVKAGSR----------------T
TRPB_LISMO       VAALFNMKCTIFMGEEDVKRQSLNVFRMELLGAKVVSVKAGSR----------------T
TRPB_LISIN       VAALFNMECTIFMGEEDVKRQSLNVFRMELLGAKVVSVKAGSR----------------T
TRPB_LISW6       VAALFNMECTIFMGEEDVKRQSLNVFRMELLGAKVVSVKAGSR----------------T
TRPB_STAAN       VAALFDMELVVFMGSEDIKRQQLNVFRMELLGAKVVAVEEGQG----------------T
TRPB_STAA1       VAALFDMELVVFMGSEDIKRQQLNVFRMELLGAKVVAVEEGQG----------------T
TRPB_STAAM       VAALFDMELVVFMGSEDIKRQQLNVFRMELLGAKVVAVEEGQG----------------T
TRPB_STAA9       VAALFDMELVVFMGSEDIKRQQLNVFRMELLGAKVVAVEEGQG----------------T
TRPB_STAA2       VAALFDMELVVFMGSEDIKRQQLNVFRMELLGAKVVAVEEGQG----------------T
TRPB_STAAR       VAALFDMELVVFMGSEDIKRQQLNVFRMELLGAKVVAVEDGQG----------------T
TRPB_STAAB       VAALFDMELVVFMGSEDIKRQQLNVFRMELLGAKVVAVEDGQG----------------T
TRPB_STAAE       VAALFDMELVVFMGSEDIKRQQLNVFRMELLGAKVVAVEDGQG----------------T
TRPB_STAA8       VAALFDMELVVFMGSEDIKRQQLNVFRMELLGAKVVAVEDGQG----------------T
TRPB_STAA3       VAALFDMELVVFMGSEDIKRQQLNVFRMELLGAKVVAVEDGQG----------------T
TRPB_STAAW       VAALFDMELVVFMGSEDIKRQQLNVFRMELLGAKVVAVEDGQG----------------T
TRPB_STAAT       VAALFDMELVVFMGSEDIKRQQLNVFRMELLGAKVVAVEDGQG----------------T
TRPB_STAAC       VAALFDMELVVFMGSEDIKRQQLNVFRMELLGAKVVAVEDGQG----------------T
TRPB_STAAS       VAALFDMELVVFMGSEDIKRQQLNVFRMELLGAKVVAVEDGQG----------------T
TRPB_STAS1       VAALFDMELVVFMGEEDIKRQSLNVFRMELLGAKVESVTEGQG----------------T
TRPB_STAEQ       IAALFDMDLIVFMGSEDIKRQQLNVFRMELLGAKVVSVSDGQG----------------T
TRPB_STAES       IAALFDMDLIVFMGSEDIKRQQLNVFRMELLGAKVVSVSDGQG----------------T
TRPB_LEPIC       VGAMFQMETVVYMGEEDLRRQELNAIRMRMLGAKVVGVSSGTA----------------T
TRPB_LEPIN       VGAMFQMETVVYMGEEDLRRQELNAIRMRMLGAKVVGVSSGTA----------------T
TRPB_LEPBJ       VGAMFQMETVVYMGEEDLRRQELNAIRMRMMGAKVVGVSSGTA----------------T
TRPB_LEPBL       VGAMFQMETVVYMGEEDLRRQELNAIRMRMMGAKVVGVSSGTA----------------T
TRPB2_NOSS1      VCARFGLECVIYMGVHDMERQALNVFRMRLMGAEVRPVAAGTG----------------T
TRPB_TRIV2       VCARFGLECVIYMGVHDMERQALNVFRMRLMGAEVRPVEAGTG----------------T
TRPB1_NOSS1      VCARFGLDCVIYMGIHDMERQALNVFRMKLMGAEVRPVEAGTG----------------T
TRPB_TRIEI       VCARFGLKCVIYMGIHDMERQALNVFRMRLMGAEVRPVEAGTG----------------T
TRPB_THEEB       VCARFGLQCVIYMGVQDMERQRLNVLRMRLLGAEVAPVSAGTG----------------T
TRPB_SYNY3       VCARFGLECIIYMGVQDMERQKLNVFRMNLLGARVQPVTAGTG----------------T
TRPB_SYNJB       VCARFGLECVIYMGALDMERQAPNVQRMRLLGAEVRGVESGTR----------------T
TRPB_GLOVI       VCARFGLECIIYMGVHDIERQKLNVYRMKLLGAEVRPVAAGTG----------------T
TRPB_PROM1       VCARFGLECIIYMGKEDMRRQALNVFRMQLLGASVRPVTSGTA----------------T
TRPB_PROMT       VCARFGLECIIYMGKEDMRRQALNVFRMQLLGASVRPVTSGTA----------------T
TRPB_PROMA       VCARFGLECIIYMGQEDMRRQSLNVFRMKLLGAKVRPVTAGTA----------------T
TRPB_SYNPW       VCARFGLECVVYMGAEDMRRQALNVFRMRLLGATVHPVTAGTA----------------T
TRPB_PROMM       VCARFGLECVVYMGAEDMRRQALNVFRMRLLGATVQPVTAGTA----------------T
TRPB_SYNSC       VCARFGLECVIYMGAEDMRRQALNVFRMRLLGATVQPVTAGTA----------------T
TRPB_SYNPX       VCARFGLECVIYMGAEDMRRQALNVFRMRLLGATVQPVTAGTA----------------T
TRPB_SYNS9       VCARFGLDCVIYMGAEDMRRQALNVFRMRLLGATVAPVTAGSA----------------T
TRPB_SYNS3       VCARFGLECVVYMGAEDMRRQALNVFRMRLLGATVQAVTAGTA----------------T
TRPB_PROMP       VCARFGLQCIIYMGAEDIKRQSLNVFRMKLLGAEVKVVTSGTA----------------T
TRPB_PROM5       VCARFGLKCIIYMGAEDIKRQSLNVFRMKLLGAEVKVVTSGTA----------------T
TRPB_PROMS       VCARFGLKCIIYMGAEDIKRQSLNVFRMKLLGAEVKVVNSGTA----------------T
TRPB_PROM0       VCARFGLKCIIYMGAEDIKRQSLNVFRMKLLGAEVKVVNSGTA----------------T
TRPB_PROM9       VCARFGMKCIIYMGAEDIKRQSLNVFRMKLLGAEVKVVNSGTA----------------T
TRPB_PROM2       VCARFGLKCIIYMGAEDIKRQSLNVFRMKLLGAEVKVVNSGTA----------------T
TRPB_MYCTU       ACALLGLDCVIYMGGIDTARQALNVARMRLLGAEVVAVQTGSK----------------T
TRPB_MYCBO       ACALLGLDCVIYMGGIDTARQALNVARMRLLGAEVVAVQTGSK----------------T
TRPB_MYCLE       ACALFGLDCVIYMGALDTARQALNVARMRLLGAEVVSVETGSR----------------T
TRPB_MYCIT       ACALLGLECVIYMGAVDTERQALNVARMRLLGATVVSVQSGSK----------------T
TRPB_STRAW       ACALFGLDCTIYMGEIDTQRQALNVARMRMLGAEVIAVKSGSR----------------T
TRPB_STRCO       ACALFGLDCTIYMGEIDTRRQALNVARMRMLGAEVIAVKSGSR----------------T
TRPB_LEIXX       AAALFGLSCTIYMGEVDTERQALNVARMRLLGAEVVAVKTGSR----------------T
TRPB_SHIFL       ASALLGLKCRIYMGAKDVERQSPNVFRMRLMGAEVIPVHSGSA----------------T
TRPB_ECOLC       ASALLGLKCRIYMGAKDVERQSPNVFRMRLMGAEVIPVHSGSA----------------T
TRPB_SHIF8       ASALLGLKCRIYMGAKDVERQSPNVFRMRLMGAEVIPVHSGSA----------------T
TRPB_ECOLI       ASALLGLKCRIYMGAKDVERQSPNVFRMRLMGAEVIPVHSGSA----------------T
TRPB_ECO24       ASALLGLKCRIYMGAKDVERQSPNVFRMRLMGAEVIPVHSGSA----------------T
TRPB_ECOHS       ASALLGLKCRIYMGAKDVERQSPNVFRMRLMGAEVIPVHSGSA----------------T
TRPB_SHISS       ASALLGLKCRIYMGAKDVERQSPNVFRMRLMGAEVIPVHSGSA----------------T
TRPB_ECO57       ASALLGLKCRIYMGAKDVERQSPNVFRMRLMGAEVIPVHSGSA----------------T
TRPB_SHIBS       ASALLGLKCRIYMGAKDVERQSPNVFRMRLMGAEVIPVHSGSA----------------T
TRPB_ECOK1       ASALLGLKCRIYMGAKDVERQSPNVFRMRLMGAEVIPVHSGSA----------------T
TRPB_ECOUT       ASALLGLKCRIYMGAKDVERQSPNVFRMRLMGAEVIPVHSGSA----------------T
TRPB_SHIDS       ASALLGLKCRIYMGAKDVERQSPNVFRMRLMGAEVIPVHSGSA----------------T
TRPB_ECOL5       ASALLGLKCRIYMGAKDVERQSPNVFRMRLMGAEVIPVHSGSA----------------T
TRPB_ECOL6       ASALLGLKCRIYMGAKDVERQSPNVFRMRLMGAEVIPVHSGSA----------------T
TRPB_CITK8       ASALLGLKCRIYMGAKDVERQSPNVFRMRLMGAEVIPVHSGSA----------------T
TRPB_SALTY       ASALLGLKCRIYMGAKDVERQSPNVFRMRLMGAEVIPVHSGSA----------------T
TRPB_SALPB       ASALLGLKCRIYMGAKDVERQSPNVFRMRLMGAEVIPVHSGSA----------------T
TRPB_SALTI       ASALLGLKCRIYMGAKDVERQSPNVFRMRLMGAEVIPVHSGSA----------------T
TRPB_SALPA       ASALLGLKCRIYMGAKDVERQSPNVFRMRLMGAEVIPVHSGSA----------------T
TRPB_SALCH       ASALLGLKCRIYMGAKDVERQSPNVFRMRLMGAEVIPVHSGSA----------------T
TRPB_SALAR       ASALLGLKCRIYMGAKDVERQSPNVFRMRLMGAQVIPVHSGSA----------------T
TRPB_CROS8       ASALLGLKCRIYMGAKDVERQSPNVFRMKLMGAEVIPVYSGSA----------------T
TRPB_KLEP7       ASALLGLKCRIYMGAKDVERQSPNVFRMRLMGAEVIPVHSGSA----------------T
TRPB_ENT38       ACALLGLKCRIYMGAKDIERQSPNVFRMRLMGADVIPVHSGSA----------------T
TRPB_PECAS       ACALLGLKCRVYMGAKDVERQSPNVFRMRLMGAEVIPVHSGSS----------------T
TRPB_YERPA       ACALLGLKCRIYMGAKDIERQSPNVFRMRLMGAEVIPVHSGSS----------------T
TRPB_YERPS       ACALLGLKCRIYMGAKDIERQSPNVFRMRLMGAEVIPVHSGSS----------------T
TRPB_YERPN       ACALLGLKCRIYMGAKDIERQSPNVFRMRLMGAEVIPVHSGSS----------------T
TRPB_YERPP       ACALLGLKCRIYMGAKDIERQSPNVFRMRLMGAEVIPVHSGSS----------------T
TRPB_YERP3       ACALLGLKCRIYMGAKDIERQSPNVFRMRLMGAEVIPVHSGSS----------------T
TRPB_YERPE       ACALLGLKCRIYMGAKDIERQSPNVFRMRLMGAEVIPVHSGSS----------------T
TRPB_YERE8       ACALLGLKCRIYMGAKDIERQSPNVFRMRLMGAEVIPVHSGSS----------------T
TRPB_SERP5       ACALLGLKCRIYMGAKDIERQSPNVFRMRLMGAEVIPVHSGSS----------------T
TRPB_SODGM       SSALLGLKCRIYMGAKDIERQSPNVFRMRLMGAEVIPVHSGSS----------------T
TRPB_PHOLL       TCALLNMKCRIYMGAKDVERQSPNVFRMRLMGAEVIPVHSGSA----------------T
TRPB_HAEIN       ACAMLDMPCRVYMGAKDVERQSPNVFRMRLMGAEVIPVQKGSC----------------S
TRPB_HAEIE       ACAMLDMPCRVYMGAKDVERQSPNVFRMRLMGAEVIPVQKGSC----------------S
TRPB_HAEIG       ACAMLDMPCRVYMGAKDVERQSPNVFRMRLMGAEVIPVQKGSC----------------S
TRPB_HAEI8       ACAMLDMPCRVYMGAKDVERQSPNVFRMRLMGAEVIPVEKGSC----------------S
TRPB_ACTSZ       ACAMLDMPCRVYMGSKDVERQSPNVFRMRLMGTEVVPVEKGSC----------------S
TRPB_HISS2       ACAMLDMPCRVYMGAKDVERQSPNVFRMRLMGAEVIPVEKGSC----------------S
TRPB_ACTP2       ACAMLDLPCVIYMGAKDVERQSPNVFRMRLMGAEVIPVQKGSC----------------S
TRPB_PASMU       ACAMLGMPCQIYMGAKDVERQSPNVFRMRLMGANVTAVTKGSA----------------S
TRPB_MANSM       ACAMLGMPCRIYMGAKDVERQSPNVFRMRLMGAEVFPVTKGSS----------------T
TRPB_BUCAP       ASALFNLKCKIYMGYKDIKRQSPNVFRMKLMGAEVVSVESGSG----------------T
TRPB_BUCAI       ACALFNLKCRIYMGIKDIKRQNTNVFRMKLMGAEVISVKNGSG----------------T
TRPB_BUCDN       ACALLNLKCRIYMGIKDIKRQHPNVFRMKLMGAEVIPVKNGSG----------------T
TRPB_BUCMH       SCALLNLKCRIYMGLKDINRQQQNVFRMKLMGAEVIPVKTGSG----------------T
TRPB_BUCSC       SCALLNLKCRIYMGIKDIERQKQNVFRMKLMGAQVIPVKSGNG----------------T
TRPB_BUCBP       SCALLGLKCRIYMGFKDVIRQQQNVFRMQLMGAKVISVKNGSG----------------T
TRPB_BLOPB       AASLLGLKCRIYMGSKDIKRQKLNVLRMQLMGTQVIPVHRGSE----------------T
TRPB_BLOFL       ASSLLKLKCRIYMGYKDMKRQELNVLRMKLMGTQVIPVHHGSA----------------T
TRPB1_VIBPA      ACALLGLKCRVYMGAKDVERQSPNVFRMKLMGAEVIPVHSGSA----------------T
TRPB_VIBCB       ACALLGLKCRVYMGAKDVERQSPNVFRMKLMGAEVIPVHSGSA----------------T
TRPB_VIBVU       ACALLGLKCRVYMGAKDVERQSPNVFRMKLMGATVIPVHSGSA----------------T
TRPB_VIBVY       ACALLGLKCRVYMGAKDVERQSPNVFRMKLMGATVIPVHSGSA----------------T
TRPB_ALIF1       ACALLGLKCRVYMGAKDVERQSPNVFRMKLMGAEVIPVHSGSA----------------T
TRPB_VIBC3       ACALLGLKCRVYMGAKDVERQSPNVFRMRLMGATVIPVHSGSA----------------T
TRPB_VIBCH       ACALLGLKCRVYMGAKDVERQSPNVFRMRLMGATVIPVHSGSA----------------T
TRPB_VIBME       ASALVGLKCRIIMGAKNLERQSPNVFRMKLMAESI----PSSV----------------T
TRPB_PHOPR       ACALLGLKCRVYMGAKDIERQSPNVFRMKLMGATVIPVHSGSS----------------T
TRPB_FRAT1       ACALLDLKCRVYMGAKDVERQSPNVFRMKLMGAEVIPVHSGSA----------------T
TRPB_FRATT       ACALLDLKCRVYMGAKDVERQSPNVFRMKLMGAEVIPVHSGSA----------------T
TRPB_FRATH       ACALLDLKCRVYMGAKDVERQSPNVFRMKLMGAEVIPVHSGSA----------------T
TRPB_FRATF       ACALLDLKCRVYMGAKDVERQSPNVFRMKLMGAEVIPVHSGSA----------------T
TRPB_FRATO       ACALLDLKCRVYMGAKDVERQSPNVFRMKLMGAEVIPVHSGSA----------------T
TRPB_FRATW       ACALLDLKCRVYMGAKDVERQSPNVFRMKLMGAEVIPVHSGSA----------------T
TRPB_FRATN       ACALLDLKCRVYMGAKDVERQSPNVFRMKLMGAEVIPVHSGSA----------------T
TRPB_FRAP2       ACALLDLKCRVYMGAKDVERQSPNVFRMKLMGAEVIPVHSGSA----------------T
TRPB_AERHH       ACALLGLKCRVYMGAKDCERQKPNVFRMKLMGATVIPVHSGSS----------------T
TRPB_AERS4       ACALLGLKCRVYMGAKDCERQKPNVFRMKLMGATVIPVHSGSS----------------T
TRPB_PSYIN       ACALLGLKCRVYMGAVDCERQKPNVFRMRLMGAEVIPVHSGSS----------------T
TRPB_SHEPA       ACALLGLKCKVYMGAKDVERQSPNVFRMKLMGAEVIPVTSGSA----------------T
TRPB_SHEHH       ACALLGLKCRVYMGAKDVERQSPNVFRMKLMGAEVIPVTSGSA----------------T
TRPB_SHELP       ACALLGLKCKVYMGAKDVERQSPNVFRMRLMGAEVIPVTSGSA----------------T
TRPB_SHESM       ACALLGLKCKVYMGAKDVARQSPNVFRMRLMGAEVIPVTSGSA----------------T
TRPB_SHESA       ACALLGLKCKVYMGAKDVARQSPNVFRMRLMGAEVIPVTSGSA----------------T
TRPB_SHESR       ACALLGLKCKVYMGAKDVARQSPNVFRMRLMGAEVIPVTSGSA----------------T
TRPB_SHEON       ACALLGLKCKVYMGAKDVARQSPNVFRMRLMGAEVIPVTSGSA----------------T
TRPB_SHEB8       ACALLGLKCKVYMGAKDVARQSPNVFRMRLMGAEVIPVTSGSA----------------T
TRPB_SHEB5       ACALLGLKCKVYMGAKDVARQSPNVFRMRLMGAEVIPVTSGSA----------------T
TRPB_SHESW       ACALLGLKCKVYMGAKDVARQSPNVFRMRLMGAEVIPVTSGSA----------------T
TRPB_SHEPC       ACALLGLKCKVYMGAKDVARQSPNVFRMRLMGAEVIPVTSGSA----------------T
TRPB_SHEB9       ACALLGLKCKVYMGAKDVARQSPNVFRMRLMGAEVIPVTSGSA----------------T
TRPB_SHEFN       ACALLGLKCKVYMGAKDIERQSPNVFRMKLMGAEVIPVTSGSS----------------T
TRPB_SHEDO       ACALLGLKCKVYMGAKDVERQSPNVFRMKLMGAEVIPVTSGSA----------------T
TRPB_SHEAM       ACALLGLKCKVYMGAKDVARQSPNVFRMRLMGAEVIPVTSGSA----------------T
TRPB_PSEA6       ACALLGLKARIYMGAKDVERQAPNVFRMRLMGAEVIPVNAGSG----------------T
TRPB_HELPY       ACALLNLKCVVFMGSKDIKRQEMNVFRMHLLGAEVREVNSGSA----------------T
TRPB_HELPJ       ACALLNLKCVIFMGGKDIKRQEMNVFRMRLLGAEVREVNSGSA----------------T
TRPB_CORGL       ACALMGLECVVYMGAKDVARQQPNVYRMQLHGAKVIPVESGSG----------------T
TRPB_CORGB       ACALMGLECVVYMGAKDVARQQPNVYRMQLHGAKVIPVESGSG----------------T
TRPB1_COREF      ACSLLGLECVVYMGAKDVARQQPNVYRMQLHGAKVIPVESGSG----------------T
TRPB2_COREF      VAALFGMKCTVYMGAKDVARQQPNVYRMRLMGAEVVAVDEQSGN---------------G
TRPB_METJA       ACAKLGLECIIYMGAKDVERQKLNVFRMELMGAKVIPVFGGSQ----------------T
TRPB_METKA       AGAALGKKVEIYMGAIDVERQKHNVFRMELMGAKVHPVKAGTQ----------------T
TRPB1_METTH      AGALFGMDVDIYMGTEDVERQKLNVFRMEVSGAEVIPVDSGSR----------------T
TRPB2_METTM      AGALFGMDVDVYMGTEDVERQKLNVFRMEISGARVIPVDSGSR----------------T
TRPB1_METMA      AGANLGFETVVYMGAKDVKRQQMNAYRMELMGTEVKPVKTGSK----------------T
TRPB1_METAC      VGATLGFETIVYMGAKDIKRQQMNAYRMELMGTEVRAVETGSK----------------T
TRPB_HALVD       ACAHLDMPCEIYMGERDINRQRPNVFRMKLNGSEVNPVTVGRG----------------T
TRPB_HALSA       ACAALEMPCEIYMGRTDVNRQRPNVFRMRLHDADVNPVTVGSG----------------T
TRPB1_THEMA      AAALFGMECVIYMGEEDTIRQKPNVERMKLLGAKVVPVKSGSR----------------T
TRPB_METVO       AGALFGLETEIFMGRVDTERQQPNVARMKLLGAKVTPVDTGSK----------------V
TRPB_META3       VGALFGLKAKIYMGAVDVERQKLNVYKMRLHGAEVHAVQSGSK----------------T
TRPB1_PYRFU      AGALLGMKVDIYMGAEDVERQKMNVFRMKLLGANVIPVNSGSR----------------T
TRPB1_PYRAB      AGALLGMKVDIYMGAEDVERQKMNVFRMKLLGANVIPVHTGSK----------------T
TRPB1_THEKO      AGALLGMKVDVYMGAEDVERQKMNVFRMGLLGARVIPVESGSR----------------T
TRPB1_ARCFU      AAALLGLEAEIYMGAEDYERQKMNVFRMELLGAKVTAVESGSR----------------T
TRPB2_CHLCV      ACGCLGLECVIYMGAKDIERQKPNVDKMNLLGAEVISVNQGAQ----------------T
TRPB1_CHLCV      AAAYLGMECVIFMGETDINRQKPNVDRIRVLGAEVVSVKRGNS----------------G
TRPB2_WOLSU      IAALLGLECEVFMGSKDTARQELNVFRMKLLSSKVQSVESGSK----------------T
TRPB_BACTN       VCALMDMECIVYMGKTDVERQHINVEKMKMLGATVIPVTSGNM----------------T
TRPB_HELHP       ACARLGLECEIFMGEIDIARQRPNVFNMELFGAKVHSVSSGSK----------------T
TRPB2_AQUAE      ATQFFDLQCRVYMVRVSYNQKPYRRILMETWKGEVIPSPSPYTNAGRKYY-EENPEHPGS
TRPB2_ARCFU      ATKLFEMACTVYMVKVSFMQKPYRRVMMETWGGEVIPSPSDRTEVGRKIL-AENPDTPGS
TRPB2_METMA      ACNYFDLECKVYMVRSSYYQKPYRKSLMTLWGGNVVPSPSPDTEFGRKIL-KEQPDTPGS
TRPB2_METAC      ACNYFDLECKVYMVRSSFYQKPYRKSLITLWGGNVVPSPSPDTEFGRKIL-QEQPDTPGS
TRPB2_THEMA      AGAKFGLEVKVFMVKVSYQQKPMRKYMMNLFGGKVTPSPSEETNFGRKIL-SEDPDNPGS
TRPB2_METTH      ACSLMDLQCKVYMVRVSFNQKPFRKTIMQLYGGEVVPSPSNHTEFGRRML-KEDPEHPGS
TRPB2_PYRAB      AGALLGLKVRVYMARASYQQKPYRKTLMRIYGAEVFPSPSENTEVGKRFL-KEDPNHPGS
TRPB2_PYRFU      AGALMGIKVRVYMARASYEQKPYRKVLMRIYGAEVFPSPSENTEIGKRFL-SENPNHPGS
TRPB_PYRHO       AGALIGLKVRVYMTRASYYQKPYRKILMEIYGAEVFPSPSENTEVGKRFL-REDPNHPGS
TRPB2_THEKO      AGALLGLNVRVYMARASYQQKPYRKTIMRLYGAEIYPSPSDRTEIGRKFL-AEDPNHPGG
TRPB2_AERPE      AGAYFGVKVRVYMVRVSYLQKPYRRTLMELYGAEVYPSPSDKTEFGRKLL-AENPNHPGS
TRPB1_SACS2      AASMYNMKSTIFMVKVSYEQKPMRRSIMQLYGANVYASPTNLTEYGRKIL-ETNPQHPGS
TRPB1_SULTO      AASMYDLSSTIFMVRVSYEQKPMRKTIMELYGGKVYASPTDLTEFGRKIL-KENPNHPGS
TRPB_PICTO       AASLYNLKSQIFMVRVSYEQKPLRKVVMSLYNSSVVPSPSNLTEFGRKIL-SENPDHPGT
TRPB2_SACS2      ASALFRMKAHIFMVRTSYYAKPYRKYMMQMYGAEVHPSPSDLTEFGRQLL-AKDSNHPGS
TRPB2_SULTO      ASALFNIQAHIFMVRTSYYAKPYRRYLMQMYNAQVHPSPSEFTRYGREVL-AKDPNTPGS
TRPB_THEAC       ASALFHMESHIFMVRTSFYAKPYRKYMMYMYGAHPHPSPSEFTEYGREVL-KRMPDTPGS
TRPB_THEVO       ASALFGVDSHIFMVRTSFYAKPYRKYMMYMYGAHPHPSPSEFTEYGKEVL-KKNPDTPGS
TRPB1_AERPE      AAALMGLKATVFMTASSFKSKIQRRLLMEAQGARVISSPSKLTDTGREALEEYGSTHPGS
TRPB_PYRAE       AAALFGLRAVVFMTRSSYNSKRQRLTFMRAYGAVVYPSPSDVTEAGRR---HYRPDHPGS
                           : :   .   :  .   :                                

TRPB1_WOLSU      LKEAVDSAFEAYLKDPANAIYAIGSVVGPHPFPKMVRDFQSVVGAEAKEQFLEMTG----
TRPB2_VIBPA      LKEAVDAAFEAYLKDPETQLYAIGSVVGPHPFPKMVRDFQSIIGNEARVQFKEMTG----
TRPB_CALS4       LKDAVNEAIRDWVTNIETTFYVIGSVVGPHPYPTMVRDFQRVIGDETKEQILEKE-----
TRPB_CLOAB       LKDAINAAMRDWVTNIDNTYYVIGSVMGPHPYPTIVKDFQKIIGEEARKQILKAE-----
TRPB_CLOB8       LNDAVTEAIRYWASNVEDTYYVLGTAAGPHPYPTMVRNFQRVIGDEARKQILELE-----
TRPB_FUSNN       LKEAVDAAFKAWINNINDTFYVLGSAVGPHPYPSMVKDFQRVISQEARRQILEKE-----
TRPB_CLONN       LKDAVDEAIKQWVKSSDDTFYVLGSAVGPHPYPTMVREFQKIIGEETKDQILRME-----
TRPB_LACP3       LKDAVNATLQEWASRSDDTFYVLGSAVGPAPFPEMVKHFQSVISTESKQQLQAKE-----
TRPB_LACCA       LKDAVNATLQEWASPSDDTFYVLGSAVGPAPFPEMVKHFQSVISTESKQQLQAKE-----
TRPB_LACPL       LKDAINAALQEWTRRCDDTAYIMGSATGPHPFPMMVHEFQSVISVEARQQILDQT-----
TRPB_CAMJR       LKEATTAAIQAWVGDIKNIFYVVGSAVGPYPYPKMVMHFQSIIGKECKMQLQKL------
TRPB_CAMJE       LKEATTAAIQAWVGDIKNIFYVVGSAVGPYPYPKMVMHFQSIIGKECKMQLQKL------
TRPB_CAMJ8       LKEATTAAIQAWVGDIKNIFYVVGSAVGPYPYPKMVMHFQSIIGKECKMQLQKL------
TRPB_CAMJJ       LKEATTAAIQAWVGDIKNIFYVVGSAVGPYPYPKMVMHFQSIIGKECKMQLQKL------
TRPB_CAMJD       LKEATTAAIQAWVGDIKNIFYVVGSAVGPYPYPKMVTHFQSIIGKECKMQLQKL------
TRPB_THET2       LKDATNEAIRDWITNVRTTFYILGSVVGPHPYPMMVRDFQSVIGEEVKRQSLELF--GR-
TRPB_THET8       LKDATNEAIRDWITNVRTTFYILGSVVGPHPYPMMVRDFQSVIGEEVKRQSLELF--GR-
TRPB_DEIRA       LKDATNEAIREWVTNVRDTFYILGSVVGPHPYPAMVRDFQSVIGEEVKVQLQEKE--GRS
TRPB_CHLTE       LKDATSEAIRDWMNNPEETFYIVGSVIGMHPYPMMVRDFQSVIGRETRQQVLDQA--GR-
TRPB1_AQUAE      LKDAINEALRDWVTNVESTHYVIGSVVGPHPFPMIVRDFQSVIGRETKEQILQKE--GR-
TRPB_BRASB       LKDAMNEALRDWVTNVHDTFYCIGTVAGPHPYPMMVRDFQSVIGDETRVQMQEAE--GRL
TRPB_BRASO       LKDAMNEALRDWVTNVHNTFYCIGTVAGPHPYPMMVRDFQSVIGQETRTQMQEAE--GRL
TRPB_BRADU       LKDAMNEALRDWVTNVHNTFYCIGTVAGPHPYPTLVRDFQSIIGNETKAQMQEVE--GRL
TRPB_PARL1       LKDAMNEALRDWVTNVENTYYLIGTVAGPHPYPAMVRDFQSVIGEETKKQMLERE--GRL
TRPB_CAUVC       LKDAMNEAMRDWVTNVHDTYYLIGTAAGPHPYPVMVRDFQSVIGAEAREQILEME--GRL
TRPB_ACICJ       LKDAMNEALRDWVANVRDTFYIIGTAAGPHPYPAMVRDFQSVIGVEARAQMMEAE--GRL
TRPB_NOVAD       LKDAMNEALRDWVANVHNTFYIIGTAAGPHPYPELVRDFQSVIGKEARAQMLSRT--GRL
TRPB_RHOS4       LKDAMNDALRDWVTNVRDTFYCIGTVAGPHPYPAMVRDFQSIIGREVRWQLAEQE-EGRL
TRPB_RUEST       LKDAMNDALRDWVTNVRDTFYCIGTVAGPHPYPAMVRDFQSVIGKEVRWQLAEQEGEGRL
TRPB_RUEPO       LKDAMNDALRDWVTNVRDTFYCIGTVAGPHPYPAMVRDFQSIIGKEAKEQMMKAE--GRL
TRPB_DINSH       LKDAMNDALRDWVTNVRETFYCIGTVAGPHPYPAMVRDFQAIIGQEAREQMMEAE--GRL
TRPB_ROSDO       LKDAMNDALRDWVTNVRDTFYCIGTVAGPHPYPAMVRDFQAIIGKEVRTQMTAAE--GRF
TRPB_JANSC       LKDAMNDALRDWVTNVRDTFYCIGTVAGPHPYPAMVRDFQAIIGKETRDQMMAAE--GRL
TRPB_PARDP       LKDAMNDALRDWVTNVRDTFYCIGTVAGPHPYPAMVRDFQCIIGRETRRQLAEQEGEGRL
TRPB_BRUSU       LKDAMNEALRDWVTNVEDTYYLIGTAAGPHPYPELVRDFQSVIGTEARQQILEQE--GRL
TRPB_BRUC2       LKDAMNEALRDWVTNVEDTYYLIGTAAGPHPYPELVRDFQSVIGTEARQQILEQE--GRL
TRPB_BRUSI       LKDAMNEALRDWVTNVEDTYYLIGTAAGPHPYPELVRDFQSVIGTEARQQILEQE--GRL
TRPB_BRUAB       LKDAMNEALRDWVTNVEDTYYLIGTAAGPHPYPELVRDFQSVIGTEARQQILEQE--GRL
TRPB_BRUA2       LKDAMNEALRDWVTNVEDTYYLIGTAAGPHPYPELVRDFQSVIGTEARQQILEQE--GRL
TRPB_BRUME       LKDAMNEALRDWVTNVEDTYYLIGTAAGPHPYPELVRDFQSVIGTEARQQILEQE--GRL
TRPB_OCHA4       LKDAMNEALRDWVTNVEDTYYLIGTAAGPHPYPELVRDFQSVIGNEARQQILEQE--GRL
TRPB_RHILO       LKDAMNEALRDWVTNVEDTYYLIGTAAGPHPYPELVRDFQSVIGTEARAQILEQE--GRL
TRPB_RHIEC       LKDAMNEALRDWVTNVEDTYYLIGTAAGPHPYPEMVRDFQSVIGAEAKEQMLAAEG----
TRPB_RHIL3       LKDAMNEALRDWVTNVEDTYYLIGTAAGPHPYPEMVRDFQSVIGIEAKEQMLAAE--GRL
TRPB_SINMW       LKDAMNEALRDWVTNVDSTYYLIGTAAGPHPYPEMVRDFQAVIGEEAKQQMLEAE--GRL
TRPB_RHIME       LKDAMNEALRDWVTNVDSTYYLIGTAAGPHPYPEMVRDFQAVIGEEAKQQILEAE--GRL
TRPB_AGRFC       LKDAMNEALRDWVTNVDDTYYLIGTAAGPHPYPEMVRDFQAVIGEEAKAQMLEAE--GRL
TRPB_CHESB       LKDAMNEALRDWVTNVEDTYYLIGTAAGPHPYPELVRDFQSVIGQETKEQILAAE--GRL
TRPB_PSEPF       LKDAMNEALRDWVTNVDSTFYLIGTVAGPHPYPAMVRDFQAVIGKETRDQLQAQE--GRL
TRPB_PSESY       LKDAMNEALRDWVTNVEDTFYLIGTVAGPHPYPAMVRDFQAVIGKETRDQLQAQE--GRL
TRPB_PSEF5       LKDAMNEALRDWVTNVDSTFYLIGTVAGPHPYPAMVRDFQAVIGKETREQMQAQE--GRL
TRPB_PSEAE       LKDAMNEALRDWVTNVDSTFYLIGTVAGPHPYPAMVRDFQAVIGKETREQLAEKE--GRL
TRPB_PSESH       LKDAMNEALRDWVTNVDDTFYLIGTVAGPHPYPAMVRDFQAIIGKETKEQMQEKE--GRL
TRPB_PSE14       LKDAMNEALRDWVTNVDDTFYLIGTVAGPHPYPAMVRDFQAIIGKETKEQMQEKE--GRL
TRPB_PSEU2       LKDAMNEALRDWVTNVDDTFYLIGTVAGPHPYPAMVRDFQAIIGKETKEQMLEKE--GRL
TRPB_PSESM       LKDAMNEALRDWVTNVDDTFYLIGTVAGPHPYPAMVRDFQSVIGKETKEQMQEKE--GRL
TRPB_PSEPU       LKDAMNEALRDWVTNVEDTFYLIGTVAGPHPYPAMVRDFQSIIGKETRAQLQEKE--GRL
TRPB_PSEPG       LKDAMNEALRDWVTNVEDTFYLIGTVAGPHPYPAMVRDFQSIIGKETRAQLQEKE--GRL
TRPB_PSEPK       LKDAMNEALRDWVTNVEDTFYLIGTVAGPHPYPAMVRDFQSIIGKETRAQLQEKE--GRL
TRPB_PSEP1       LKDAMNEALRDWVTNVEDTFYLIGTVAGPHPYPAMVRDFQSIIGKETRAQLQEKE--GRL
TRPB_PSEE4       LKDAMNEALRDWVTNVEDTFYLIGTVAGPHPYPAMVRDFQSIIGKETRAQLQEKE--GRL
TRPB_ACICA       LKDAMNEAMRDWVTNVDSTYYVIGTVAGPHPYPQLVRDFQSIIGREARRQIQEQA--GRL
TRPB_ACIAD       LKDAMNEAMRDWVTNVDSTYYVIGTVAGPHPYPQLVRDFQSIIGREARRQIQEQA--GRL
TRPB_LEGPA       LKDALNEALRDWVSHVDDTFYIIGTVAGPHPYPQMVRDFQAIIGVEARAQHMEKT--GRL
TRPB_LEGPL       LKDALNEALRDWVSHVDDTFYIIGTVAGPHPYPQMVRDFQAIIGVEARAQHMEKT--GRL
TRPB_LEGPH       LKDALNEALRDWVSHVDDTFYIIGTVAGPHPYPQMVRDFQAIIGVEARAQHMEKT--GHL
TRPB_LEGPC       LKDALNEALRDWVSHVDDTFYIIGTVAGPHPYPQMVRDFQAIIGVEARAQHMEKT--GRL
TRPB_BORBR       LKDALNEAMRDWVTNIENTFYIIGTVAGPDPYPRMVRDFQTVIGQECLTQMPEVI--GRQ
TRPB_BORPA       LKDALNEAMRDWVTNIENTFYIIGTVAGPDPYPRMVRDFQTVIGQECLTQMPEVI--GRQ
TRPB_BORPE       LKDALNEAMRDWVTNIENTFYIIGTVAGPDPYPRMVRDFQTVIGQECLTQMPEVI--GRQ
TRPB_RALSO       LKDALNEAMRDWVTNVADTFYIIGTVAGPHPYPMMVRDFQAVIGEECKVQMPELA--GRQ
TRPB_POLNA       LKDALNEAMRDWVANVDNTFYIIGTVAGPHPYPMMVRDFQSVIGTECLSQMPEMN--AGR
TRPB_POLSJ       LKDALNEAMRDWVANVDNTFYIIGTVAGPHPYPMMVRDFQSVIGTECLAQMPEFI--GNR
TRPB_ACIAC       LKDALNEAMRDWVANVDNTFYIIGTVAGPHPYPMMVRDFQSVIGTECLAQMPGML--AGQ
TRPB_METPP       LKDALNEALRDWVTNVENTFYIIGTVAGPAPYPEMVRDFQSVIGEECLRQMPEMA--GRQ
TRPB_METFK       LKDALNEAMRDWVTNISNTFYIIGTVAGPHPYPMMVRDFQAVIGTEAKQQMQELI--GRQ
TRPB_NITEU       LKDALNEAMRDWVTNVSNTYYIIGTVAGPHPYPMMVRDFQAIIGNEARQQMREEY--GRQ
TRPB_NITEC       LKDALNEAMRDWVTNVGNTYYIIGTVAGPHPYPMMVRDFQAVIGNEARQQMQEEY--GRQ
TRPB_NITMU       LKDALNEAMRDWVTNVADTFYIIGTVAGPHPYPMMVRDFQAIIGREAITQMQEDY--GRQ
TRPB_METCA       LKDALNEAMRDWVTNVDDTFYIIGTVAGPHPYPAMVRDFQAVIGREARRQMLEMT--GRL
TRPB_XANAC       LKDALNEAMRDWVTNVRDTFYIIGTVAGPDPYPRMVRDFNAIVGREAREQMLQDY--GRL
TRPB_XANC5       LKDALNEAMRDWVTNVRDTFYIIGTVAGPDPYPRMVRDFNAIVGREAREQMLQDY--GRL
TRPB_XANOM       LKDALNEAMRDWVTNVRDTFYIIGTVAGPDPYPRMVRDFNAIVGRESRAQMLEDY--GRL
TRPB_XANCP       LKDALNEAMRDWVSNVQDTFYIIGTVAGPDPYPRMVRDFNAIVGREARAQMLEDY--GRL
TRPB_XANC8       LKDALNEAMRDWVSNVQDTFYIIGTVAGPDPYPRMVRDFNAIVGREARAQMLEDY--GRL
TRPB_XYLFA       LKDALNEAMRDWVTHVGHTFYIIGTVAGPDPYPRMVRDFNAIVGREARAQMIEDY--GRL
TRPB_XYLFT       LKDALNEAMRDWVTHVGHTFYIIGTVAGPDPYPRMVRDFNAIVGREARAQMIEDY--GRL
TRPB_VESOH       LKDSLNEAMRDWVKNIDDTFYIIGTIAGPHPYPMMVRDFQSIIGKEAKAQFHDQV--GGL
TRPB_RUTMC       LKDSINEAMRDWVTNIDDTFYIIGTVVGPHPYPMMVRDFQSIIGKETKVQFAAQV--GGL
TRPB_NEIG1       LKDAMNEAMREWVARVDDTFYIIGTAAGPAPYPEMVRDFQCVIGNEAKAQMQEAT--GRQ
TRPB_NEIGO       LKDAMNEAMREWVARVDDTFYIIGTAAGPAPYPEMVRDFQCVIGNEAKAQMQEAT--GRQ
TRPB_NEIMF       LKDAMNEAMREWVARVDDTFYIIGTAAGPAPYPEMVRDFQCVIGNEAKAQMQEAI--GRQ
TRPB_NEIMA       LKDAMNEAMREWVARVDDTFYIIGTAAGPAPYPEMVRDFQCVIGNEAKAQMQEAI--GRQ
TRPB_NEIMB       LKDAMNEAMREWVARVDDTFYIIGTAAGPAPYPEMVRDFQCVIGNEAKAQMQEAI--GRQ
TRPB_NEIM0       LKDAMNEAMREWVARVDDTFYIIGTAAGPAPYPEMVRDFQCVIGNEAKAQMQEAI--GRQ
TRPB_CHRVO       LKDALNEAMRDWVTNVDSTFYILGTAAGPHPYPMLVRDFVSVIGAESKIQMPEAI--GRQ
TRPB_RHOBA       LRDAVNEAMRDWMSSVEDTHYIIGSVIGPHPFPMMVRDFQSVIGRETREQCRDTF--GRL
TRPB_GEOSE       LKDATNEAIRYWVAHCDDHFYMIGSVVGPHPYPKMVREFQRIIGDEAKEQFLACEG----
TRPB_GEOTN       LKDATNEAIRYWVAHCDDHFYMIGSVVGPHPYPKMVREFQRVIGDEAKEQFLAGEG----
TRPB_BACVZ       LKDATNEAIRYWVQHCEDHFYLIGSVVGPHPYPYIVREFQKIIGEEAKEQLRRVEG----
TRPB_BACSU       LKDATNEAIRYWVQHCEDHFYMIGSVVGPHPYPQVVREFQKMIGEEAKDQLKRIEG----
TRPB_BACLD       LKDATNEAIRYWVQHCQDHFYMIGSVVGPHPYPYIVREFQRMIGEEAKAQFYQLEQ----
TRPB_BACP2       LKDATNEAIRYWVQHCSDHFYMIGSVVGPHPYPQIVSEFQRMIGDEAKEQMLKKEG----
TRPB_BACHD       LKDATNEAIRYWVTHADDTFYLIGSVVGPHPYPQMVRDFQRIIGDEARAQFQEITG----
TRPB_BACSK       LKDATNEAIRYWVSHADDTFYLIGSVVGPHPYPKMVRNFQRVIGDEAKQQMAEKTG----
TRPB_BACAN       LKDAVNEALRYWVSHVHDTHYIMGSVLGPHPFPQIVRDFQSVIGNETKKQYEALEG----
TRPB_BACHK       LKDAVNEALRYWVSHVHDTHYIMGSVLGPHPFPQIVRDFQSVIGNETKKQYEALEG----
TRPB_BACAH       LKDAVNEALRYWVSHVHDTHYIMGSVLGPHPFPQIVRDFQSVIGNETKKQYEELEG----
TRPB_BACCZ       LKDAVNEALRYWVSHVHDTHYIMGSVLGPHPFPQIVRDFQSVIGKETKKQYEALEG----
TRPB_BACCR       LKDAVNEALRYWVSHVHDTHYIMGSVLGPHPFPQIVRDFQSVIGNETKKQYEALEG----
TRPB_BACC1       LKDAVNEALRYWVSHVHDTHYIMGSVLGPHPFPQIVRDFQSVIGKETKKQYEALEG----
TRPB_OCEIH       LKDAVNEALRYWVNNVNDTHYIIGSVVGPHPFPKIVRDFQSVIGKETKEQSMKKIG----
TRPB_LACLS       LKDAVNAALRAWVAQVEDTHYVMGSVLGPHPFPQIVRDYQAVIGQEARAQFLEKEN----
TRPB_LACLM       LKDAVNAALRAWVAQVEDTHYVMGSVLGPHPFPQIVRDYQAIIGQEARAQFLEKEN----
TRPB_LACLA       LKDAVNAALRAWVAQVEDTHYVMGSVLGPHPFPQIVRDYQAVIGQEARAQFLEKEN----
TRPB_STRR6       LKDAVNAALRSWVANIDDTHYILGSTLGPHPFPEIVRDFQSVIGREAKQQYRDLTGQ---
TRPB_STRP2       LKDAVNAALRSWVANIDDTHYILGSTLGPHPFPEIVRDFQSVIGREAKQQYRDLTGQ---
TRPB_STRPN       LKDAVNAALRSWVANIDDTHYILGSALGPHPFPEIVRDFQSVIGREAKQQYRDLTGR---
TRPB_STRT2       LKDAVNAALRAWVAGIEDTHYIMGSALGPAPFPEIVRDFQSVIGREAKRQYAEISGG---
TRPB_STRT1       LKDAVNAALRAWVAGIEDTHYIMGSALGPAPFPEIVRDFQSVIGREAKRQYAEISGG---
TRPB_STRTD       LKDAVNAALRAWVAGIDDTHYIMGSALGPAPFPEIVRDFQSVIGREVKRQYAEISGG---
TRPB_STRMU       LKDAVNAALRAWVTNIEDTHYVMGSALGPAPFPEIVRDFQSVIGREAKRQFATVSNG---
TRPB_LISMF       LKDAVNEALRFWVANVEDTHYIMGSVLGPHPFPEIVRDYQSVIGIEARKQHLEKEG----
TRPB_LISMO       LKDAVNEALRFWVANVEDTHYIMGSVLGPHPFPEIVRDYQSVIGIEARKQHLEKEG----
TRPB_LISIN       LKDAVNEALRFWVANVEDTHYIMGSVLGPHPFPEIVRDYQSVIGTEARKQHLEKEG----
TRPB_LISW6       LKDAVNEALRFWVANVEDTHYIMGSVLGPHPFPEIVRDYQSVIGIEARKQHMEKEG----
TRPB_STAAN       LSDAVNKALQYWVSHVDDTHYLLGSALGPDPFPTIVRDFQSVIGKEIKSQILKKEG----
TRPB_STAA1       LSDAVNKALQYWVSHVDDTHYLLGSALGPDPFPTIVRDFQSVIGKEIKSQILKKEG----
TRPB_STAAM       LSDAVNKALQYWVSHVDDTHYLLGSALGPDPFPTIVRDFQSVIGKEIKSQILKKEG----
TRPB_STAA9       LSDAVNKALQYWVSHVDDTHYLLGSALGPDPFPTIVRDFQSVIGKEIKSQILKKEG----
TRPB_STAA2       LSDAVNKALQYWVSHVDDTHYLLGSALGPDPFPTIVRDFQSVIGKEIKSQILKKEG----
TRPB_STAAR       LSDAVNKALQYWVSHVDDTHYLLGSALGPDPFPTIVRDFQSVIGKEIKSQILKKEG----
TRPB_STAAB       LSDAVNKALQYWVSHVDDTHYLLGSALGPDPFPTIVRDFQSVIGKEIKSQILKKEG----
TRPB_STAAE       LSDAVNKALQYWVSHVDDTHYLLGSALGPDPFPTIVRDFQSVIGKEIKSQILKKEG----
TRPB_STAA8       LSDAVNKALQYWVSHVDDTHYLLGSALGPDPFPTIVRDFQSVIGKEIKSQILKKEG----
TRPB_STAA3       LSDAVNKALQYWVSHVDDTHYLLGSALGPDPFPTIVRDFQSVIGKEIKSQILKKEG----
TRPB_STAAW       LSDAVNKALQYWVSHVDDTHYLLGSALGPDPFPTIVRDFQSVIGKEIKSQILKKEG----
TRPB_STAAT       LSDAVNKALQYWVSHVDDTHYLLGSALGPDPFPTIVRDFQSVIGKEIKSQILKKEG----
TRPB_STAAC       LSDAVNKALQYWVSHVDDTHYLLGSALGPDPFPTIVRDFQSVIGKEIKSQILKKEG----
TRPB_STAAS       LSDAVNKALQYWVSHVDDTHYLLGSALGPDPFPTIVRDFQSVIGKEIKSQILKKEG----
TRPB_STAS1       LSDAVNKALQYWVSHVDDTHYLLGSALGPDPFPTIVRDFQKIIGQEIKAQVHEKEG----
TRPB_STAEQ       LSDAVNKALQYWVNHVEDTHYLLGSALGPDPFPTMVRDFQSVIGNEIKSQILSKEG----
TRPB_STAES       LSDAVNKALQYWVNHVEDTHYLLGSALGPDPFPTMVRDFQSVIGNEIKSQILSKEG----
TRPB_LEPIC       LKDATSEAMRDWALNVSNTHYIVGSSIGPHPFPTIVRDFQSVIGIESRKQFKKVND----
TRPB_LEPIN       LKDATSEAMRDWALNVSNTHYIVGSSIGPHPFPTIVRDFQSVIGIESRKQFKKVND----
TRPB_LEPBJ       LKDATSEAMRDWALNVSNTHYIVGSSIGPHPFPTIVRDFQSVIGIESRKQFKKVNG----
TRPB_LEPBL       LKDATSEAMRDWALNVSNTHYIVGSSIGPHPFPTIVRDFQSVIGIESRKQFKKVNG----
TRPB2_NOSS1      LKDATSEAIRDWVTNVETTHYILGSVAGPHPYPMMVRDFHAVIGQETRAQALEKWG----
TRPB_TRIV2       LKDATSEAIRDWVTNVETTHYILGSVAGPHPYPMMVRDFHAVIGQETRAQALEKWG----
TRPB1_NOSS1      LKDATSEAIRDWVTNVETTHYILGSVAGPHPYPMIVRDFHAIIGKETRVQCQEKWG----
TRPB_TRIEI       LKDATSEAIRDWVTNVETTHYILGSVAGPHPYPMMVRDFHAVIGVETRAQCLEKWN----
TRPB_THEEB       LKDATSEAIRDWVTNVETTHYILGSVAGPHPYPMLVREFHAVIGAETRQQCLEKWG----
TRPB_SYNY3       LKDATSEAIRDWVTNVETTHYILGSVAGPHPYPMMVRDFHRVIGQETRQQALKKWG----
TRPB_SYNJB       LKDALSEAIRDWVTNVETTHYVIGTVAGPHPYPKLVRAFHDVIGQETRQQCQEKWG----
TRPB_GLOVI       LKDATSEAIRDWVTHVETTHYILGSAAGPHPYPLMVREFQAVIGRETRVQCLERLG----
TRPB_PROM1       LKDATSEAIRDWVTNVETTHYILGSVAGPHPYPMLVRDFHAVIGEETKQQCKQAFG----
TRPB_PROMT       LKDATSEAIRDWVTNVETTHYILGSVAGPHPYPMLVRDFHAVIGEETKQQCKQAFG----
TRPB_PROMA       LKDATSEAIRDWVTNVETTHYILGSVAGPHPYPMLVRDFHAVIGEEAKKQCLEAFG----
TRPB_SYNPW       LKDATSEAIRDWVTNVETTHYILGSVAGPHPYPMLVRDFHAVIGQETRQQCREAFG----
TRPB_PROMM       LKDATSEAIRDWVTNVETTHYILGSVAGPHPYPMLVRDFHAVIGQEARQQCAEAFG----
TRPB_SYNSC       LKDATSEAIRDWVTNVETTHYILGSVAGPHPYPMLVRDFHAVIGEESKQQCQEAFG----
TRPB_SYNPX       LKDATSEAIRDWVTNVESTHYILGSVAGPHPYPMLVRDFHAVIGQEARQQCREAFG----
TRPB_SYNS9       LKDATSEAIRDWVTNVETTHYILGSVAGPHPYPMLVRDFHAVIGQEAKQQCEEAFG----
TRPB_SYNS3       LKDATSEAIRDWVTNVETTHYILGSVAGPHPYPMLVRDFHAVIGNEAREQCKESFG----
TRPB_PROMP       LKDATSEAIRDWVSNVETTHYILGSVAGPHPFPMIVRDFHAVIGEEAKKQCLESFG----
TRPB_PROM5       LKDATSEAIRDWVSNVETTHYILGSVAGPHPFPMIVRDFHAVIGEEAKKQCVESFG----
TRPB_PROMS       LKDATSEAIRDWVSNVETTHYILGSVAGPHPFPKIVRDFHAVIGEETKKQCLESFG----
TRPB_PROM0       LKDATSEAIRDWVSNVETTHYILGSVAGPHPFPKIVRDFHAVIGEETKKQCLESFG----
TRPB_PROM9       LKDATSEAIRDWVSNVETTHYILGSVAGPHPFPKIVRDFHAVIGEETKKQCQESFG----
TRPB_PROM2       LKDATSEAIRDWVSNVESTHYILGSVAGPHPFPKIVRDFHAVIGEETKKQCLESFG----
TRPB_MYCTU       LKDAINEAFRDWVANADNTYYCFGTAAGPHPFPTMVRDFQRIIGMEARVQIQGQAG----
TRPB_MYCBO       LKDAINEAFRDWVANADNTYYCFGTAAGPHPFPTMVRDFQRIIGMEARVQIQGQAG----
TRPB_MYCLE       LKDAINDAFRDWVTNADNTYYCFGTASGPHPFPTMVRDLQRVIGLETRRQIQYQAG----
TRPB_MYCIT       LKDAINEAFRDWVTNADNTFYCFGTAAGPHPFPAMVRDFQRIIGLEARAQIQAQAG----
TRPB_STRAW       LKDAINEAFRDWVANVDRTHYLFGTVAGPHPFPAMVRDFHRVIGVEARRQILERAG----
TRPB_STRCO       LKDAINEAFRDWVANVDRTHYLFGTVAGPHPFPAMVRDFHRVIGVEARRQLLEQAG----
TRPB_LEIXX       LKDAINDAMRDWVTNVETTNYIFGTVAGPHPFPTMVRDLQRIIGEEAREQVLALTG----
TRPB_SHIFL       LKDACNEALRDWSGSYETAHYMLGTAAGPHPYPTIVREFQRMIGEETKAQILEREG----
TRPB_ECOLC       LKDACNEALRDWSGSYETAHYMLGTAAGPHPYPTIVREFQRMIGEETKAQILEREG----
TRPB_SHIF8       LKDACNEALRDWSGSYETAHYMLGTAAGPHPYPTIVREFQRMIGEETKAQILEREG----
TRPB_ECOLI       LKDACNEALRDWSGSYETAHYMLGTAAGPHPYPTIVREFQRMIGEETKAQILEREG----
TRPB_ECO24       LKDACNEALRDWSGSYETAHYMLGTAAGPHPYPTIVREFQRMIGEETKAQILEREG----
TRPB_ECOHS       LKDACNEALRDWSGSYETAHYMLGTAAGPHPYPTIVREFQRMIGEETKAQILEREG----
TRPB_SHISS       LKDACNEALRDWSGSYETAHYMLGTAAGPHPYPTIVREFQRMIGEETKAQILEREG----
TRPB_ECO57       LKDACNEALRDWSGSYETAHYMLGTAAGPHPYPTIVREFQRMIGEETKAQILEREG----
TRPB_SHIBS       LKDACNEALRDWSGSYETAHYMLGTAAGPHPYPTIVCEFQRMIGEETKAQILEREG----
TRPB_ECOK1       LKDACNEALRDWSGSYETAHYMLGTAAGPHPYPTIVREFQRMIGEETKAQILEREG----
TRPB_ECOUT       LKDACNEALRDWSGSYETAHYMLGTAAGPHPYPTIVREFQRMIGEETKAQILEREG----
TRPB_SHIDS       LKDACNEALRDWSGSYETAHYMLGTAAGPHPYPTIVREFQRMIGEETKAQILEREG----
TRPB_ECOL5       LKDACNEALRDWSGSYETAHYMLGTAAGPHPYPTIVREFQRMIGEETKAQILEREG----
TRPB_ECOL6       LKDACNEALRDWSGSYETAHYMLGTAAGPHPYPTIVREFQRMIGEETKAQILEREG----
TRPB_CITK8       LKDACNEALRDWSGSYESAHYMLGTAAGPHPFPTIVREFQRMIGEETKAQILEKEG----
TRPB_SALTY       LKDACNEALRDWSGSYETAHYMLGTAAGPHPYPTIVREFQRMIGEETKAQILDKEG----
TRPB_SALPB       LKDACNEALRDWSGSYETAHYMLGTAAGPHPYPTIVREFQRMIGEETKAQILDKEG----
TRPB_SALTI       LKDACNEALRDWSGSYETAHYMLGTAAGPHPYPTIVREFQRMIGEETKAQILDKEG----
TRPB_SALPA       LKDACNEALRDWSGSYETAHYMLGTAAGPHPYPTIVREFQRMIGEETKAQILDKEG----
TRPB_SALCH       LKDACNEALRDWSGSYETAHYMLGTAAGPHPYPTIVREFQRMIGEETKAQILDKEG----
TRPB_SALAR       LKDACNEALRDWSGSYETAHYMLGTAAGPHPYPTIVREFQRMIGEETKSQILDKEG----
TRPB_CROS8       LKDACNEALRDWSGSYDRAHYMLGTAAGPHPFPTIVREFQRMIGEETRAQIMEKEG----
TRPB_KLEP7       LKDACNEALRDWSGSYEKAHYMLGTAAGPHPFPTIVREFQRMIGEETKAQILEKEG----
TRPB_ENT38       LKDACNEALRDWSGSYDTAHYMLGTAAGPHPFPTIVREFQRMIGEETKAQILEKEG----
TRPB_PECAS       LKDACNEALRDWSGSYETAHYLLGTAAGPHPYPTIVREFQRMIGEETKAQILEKEG----
TRPB_YERPA       LKDACNEALRDWSGTYETAHYMLGTAAGPHPYPTIVREFQRMIGEETKAQILEKEG----
TRPB_YERPS       LKDACNEALRDWSGTYETAHYMLGTAAGPHPYPTIVREFQRMIGEETKAQILEKEG----
TRPB_YERPN       LKDACNEALRDWSGTYETAHYMLGTAAGPHPYPTIVREFQRMIGEETKAQILEKEG----
TRPB_YERPP       LKDACNEALRDWSGTYETAHYMLGTAAGPHPYPTIVREFQRMIGEETKAQILEKEG----
TRPB_YERP3       LKDACNEALRDWSGTYETAHYMLGTAAGPHPYPTIVREFQRMIGEETKAQILEKEG----
TRPB_YERPE       LKDACNEALRDWSGTYETAHYMLGTAAGPHPYPTIVREFQRMIGEETKAQILEKEG----
TRPB_YERE8       LKDACNEALRDWSGSYETAHYMLGTAAGPHPYPTIVREFQRMIGEETKAQMLAREG----
TRPB_SERP5       LKDACNEALRDWSGSYETAHYMLGTAAGPHPYPTIVREFQRMIGEETKAQMLEREG----
TRPB_SODGM       LKDACNEALRDWSDSYERAHYMLGTAAGPHPFPTIVREFQRMIGEETRAQLQEHEQ----
TRPB_PHOLL       LKDACNEALRDWSGSYDKAHYLLGTAAGPHPYPTMVREFQRMIGEEAKSQILAREG----
TRPB_HAEIN       LKDACCEAMRDWSANYETTHYLLGTAAGPHPFPTIVREFQKMIGEETKRQILEREG----
TRPB_HAEIE       LKDACCEAMRDWSANYETTHYLLGTAAGPHPFPTIVKEFQKMIGEETKRQILEREG----
TRPB_HAEIG       LKDACCEAMRDWSANYETTHYLLGTAAGPHPFPTIVREFQKMIGEETKRQILEREG----
TRPB_HAEI8       LKDACCEAMRDWSANYETTHYLLGTAAGPHPFPTIVREFQKMIGEETKRQILEREG----
TRPB_ACTSZ       LKDACCEAMRDWSANYENTHYLLGTAAGPHPFPTIVREFQKMIGEETKRQILEKEG----
TRPB_HISS2       LKDACCEAMRDWSANYETTHYLLGTAAGPHPFPTIVREFQKMIGEETKCQILAKEN----
TRPB_ACTP2       LKDACCEAMRDWAANYETTHYLIGTAAGPHPFPTMVREFQKMIGEETKRQILEKEN----
TRPB_PASMU       LKDACCEAMRDWAENYEHTHYLLGTAAGPHPFPTIVREFQKIIGEETKQQILAREG----
TRPB_MANSM       LKDACCEAMRDWAANYENTHYLIGTAAGPHPFPTIVREFQKMIGEETKAQILQREG----
TRPB_BUCAP       LKDACNEALRDWSRNYQKSHYMIGTAAGPHPYPTIVKEFQKMIGEEAKKQILEQEN----
TRPB_BUCAI       LKDACNEALRDWSSSYKKSHYMIGTAAGPHPYPTIVREFQKMIGEETKKQILEKEN----
TRPB_BUCDN       LKDACNEALRDWSNSYKNSHYMIGTAAGPHPYPTIVREFQKIIGEETKQQILEQET----
TRPB_BUCMH       LKDACNEALRDWSENYINAHYMLGTAAGPHPYPTIVKEFQSIIGKETKRQIVREEN----
TRPB_BUCSC       LKDACNEALRDWSENYINAHYMLGTAAGPHPYPTIVKQFQSVIGKETKQQIFEKEH----
TRPB_BUCBP       LKDACNEALRDWSENYCTSHYMIGTAAGPHPYPTMVKKFQSIIGIETRCQILKQES----
TRPB_BLOPB       LKDACNEAMREWSKTYEYTHYMLGTAAGPHPFPTIVREFQRIIGKETYKQIQKYEQ----
TRPB_BLOFL       LKDACNEAIREWSSTYKHTHYMIGTVAGPHPFPTIVKEFQRIIGSETYNQIQTHEK----
TRPB1_VIBPA      LKDACNEALRDWSGSYEDAHYLLGTAAGPHPFPTIVREFQRMIGEETKNQILAREG----
TRPB_VIBCB       LKDACNEALRDWSATYEDAHYLLGTAAGPHPFPTIVRDFQRMIGEETKNQILAREG----
TRPB_VIBVU       LKDACNEALRDWSGSYETAHYLLGTAAGPHPFPTIVREFQRMIGEETKNQILAREG----
TRPB_VIBVY       LKDACNEALRDWSGSYETAHYLLGTAAGPHPFPTIVREFQRMIGEETKNQILAREG----
TRPB_ALIF1       LKDACNEALRDWSATYETAHYLLGTAAGPHPFPTIVREFQRMIGEETKMQILAREG----
TRPB_VIBC3       LKDACNEALRDWSASYETAHYLLGTAAGPHPFPTIVREFQRIIGEETKNQILAREG----
TRPB_VIBCH       LKDACNEALRDWSASYETAHYLLGTAAGPHPFPTIVREFQRIIGEETKNQILAREG----
TRPB_VIBME       LKVAVNEALRDWSAT-ETTHYYLGTAAGPHPYPTIVREFQRIIGEETKLQILAREG----
TRPB_PHOPR       LKDACNEAMRDWSATYEEAHYLLGTAAGPHPFPTIVREFQRIIGEETKVQILEKEG----
TRPB_FRAT1       LKDACNEALRDWSANYSKAHYLLGTAAGPHPFPTIVREFQRMIGEETKQQMLAKEG----
TRPB_FRATT       LKDACNEALRDWSANYSKAHYLLGTAAGPHPFPTIVREFQRMIGEETKQQMLAKEG----
TRPB_FRATH       LKDACNEALRDWSANYSKAHYLLGTAAGPHPFPTIVREFQRMIGEETKQQMLAKEG----
TRPB_FRATF       LKDACNEALRDWSANYSKAHYLLGTAAGPHPFPTIVREFQRMIGEETKQQMLAKEG----
TRPB_FRATO       LKDACNEALRDWSANYSKAHYLLGTAAGPHPFPTIVREFQRMIGEETKQQMLAKEG----
TRPB_FRATW       LKDACNEALRDWSANYSKAHYLLGTAAGPHPFPTIVREFQRMIGEETKQQMLAKEG----
TRPB_FRATN       LKDACNEALRDWSANYSKAHYLLGTAAGPHPFPTIVREFQRMIGEETKQQILAKEG----
TRPB_FRAP2       LKDACNEALRDWSANYNKAHYLLGTAAGPHPFPTIVREFQRMIGEETKQQILAKEG----
TRPB_AERHH       LKDACNEALRDWAANYESAHYLLGTAAGPHPFPTIVREFQKMIGEEAKAQCFEKEE----
TRPB_AERS4       LKDACNEALRDWAASYDNAHYLLGTAAGPHPFPTIVREFQKMIGEEAKAQCFKKEE----
TRPB_PSYIN       LKDACNEALRDWAGSYDTAHYLLGTVAGPHPFPTIVREFQKIIGEEAKQQVLKKEG----
TRPB_SHEPA       LKDACNEAMRDWSGSYDKAHYLLGTAAGPHPFPTIVREFQRMIGEETKSQILEREG----
TRPB_SHEHH       LKDACNEAMRDWSGCYDKAHYLLGTAAGPHPYPTIVREFQRMIGAETKRQILEREG----
TRPB_SHELP       LKDACNEAMRDWSASYDKAHYLLGTAAGPHPFPTIVREFQRMIGEETKAQILEREG----
TRPB_SHESM       LKDACNEAMRDWSGSYEKAHYLLGTAAGPHPFPTIVREFQRMIGEETKKQMLEREG----
TRPB_SHESA       LKDACNEAMRDWSGSYEKAHYLLGTAAGPHPFPTIVREFQRMIGEETKKQMLEREG----
TRPB_SHESR       LKDACNEAMRDWSGSYEKAHYLLGTAAGPHPFPTIVREFQRMIGEETKKQMLEREG----
TRPB_SHEON       LKDACNEAMRDWSGSYEKAHYLLGTAAGPHPFPTIVREFQRIIGEETKKQILEREG----
TRPB_SHEB8       LKDACNEAMRDWSGSYEKAHYLLGTAAGPHPFPTIVREFQRIIGEETKKQMLEREG----
TRPB_SHEB5       LKDACNEAMRDWSGSYEKAHYLLGTAAGPHPFPTIVREFQRIIGEETKKQMLEREG----
TRPB_SHESW       LKDACNEAMRDWSGSYEKAHYLLGTAAGPHPFPTIVREFQRIIGEETKKQMLEREG----
TRPB_SHEPC       LKDACNEAMRDWSGSYEKAHYLLGTAAGPHPFPTIVREFQRIIGEETKKQMLEREG----
TRPB_SHEB9       LKDACNEAMRDWSGSYEKAHYLLGTAAGPHPFPTIVREFQRIIGEETKKQMLEREG----
TRPB_SHEFN       LKDACNEAMRDWSASYDKAHYLLGTAAGPHPFPTIVREFQRMIGEETKKQILEKEG----
TRPB_SHEDO       LKDACNEAMRDWSASYDKAHYLLGTAAGPHPFPTIVREFQRMIGEETKQQILEKEG----
TRPB_SHEAM       LKDACNEAMRDWSGSYDRAHYLLGTAAGPHPFPTIVREFQRMIGAETKAQMLEKEG----
TRPB_PSEA6       LKDAVNEAMRDWSATYDKAHYLLGTAAGPHPFPTIVREFHRMIGEETRAQIMAKEG----
TRPB_HELPY       LKDAVNEALRDWASSYKDTHYLLGTAAGPHPYPTMVKTFQKMIGDEVKSQILEKEN----
TRPB_HELPJ       LKDAVNEALRDWASSYKDTHYLLGTSAGPHPYPTMVKTFQKMIGDEVKSQILEKEN----
TRPB_CORGL       LKDAVNEALRDWTATFHESHYLLGTAAGPHPFPTIVREFHKVISEEAKAQMLERTG----
TRPB_CORGB       LKDAVNEALRDWTATFHESHYLLGTAAGPHPFPTIVREFHKVISEEAKAQMLERTG----
TRPB1_COREF      LKDAVNEALRDWTATFHESHYLLGTAAGPHPFPTIVREFHKVISEEAKAQMLERTG----
TRPB2_COREF      LSSAIDVAINDWVNNLEDTHYLLGTAAGPHPFPTLVKKFHSVISRESREQMLERTG----
TRPB_METJA       LKDAVNEALRDWTTNVRTTYYLLGSALGPHPYPMMVREFQRVIGKELKEQILEKEG----
TRPB_METKA       LKDAINEALRDWITNLETTHYLLGSVVGPHPYPWIVREFQRVIGRETKEQITELEG----
TRPB1_METTH      LKDAINEAMRDWISNVDDTHYLIGSTMGPHPYPTMVKHFQSVIGREAREQILEVEG----
TRPB2_METTM      LKDAINQAMRDWISSVEDTHYLIGSTMGPHPYPTMVKHFQSVIGREAREQILEIEG----
TRPB1_METMA      LKDAINEAFRDWVTNIGNTHYLIGSVVGPHPYPMIVRDFQSVIGREVKEQAMEKEG----
TRPB1_METAC      LKDAINEAMRDWVTNIENTHYLIGSVVGPHPYPMIVRDFQSVIGKEVKEQAMEKEG----
TRPB_HALVD       LKEAISETMRDWATNVEDTHYVIGSVVGPHPFPSMVRDFQSVISEEARTQAREKLG----
TRPB_HALSA       LKEAINETMRDWATNVADTHYVIGSVVGPHPFPSMVRDFQAIISEELRAQSREQLG----
TRPB1_THEMA      LKDAINEALRDWITNLQTTYYVIGSVVGPHPYPIIVRNFQKVIGEETKKQILEKEG----
TRPB_METVO       LKDAVNEAMRNWTATFENTHYLLGTVMGPHPFPTMVRDFQSVIGKEVKKQIMEQEE----
TRPB_META3       LKDAINEALRDWVETFEDTHYIIGSAVGPYPFPSMVRDFQSVIGKEAKKQILEAEG----
TRPB1_PYRFU      LKDAINEALRDWVATFEYTHYLIGSVVGPHPYPTIVRDFQSVIGREAKAQILEAEG----
TRPB1_PYRAB      LKDAINEALRDWVATFEYSHYLIGSVVGPHPYPIIVRDFQSVIGREAREQILEAEG----
TRPB1_THEKO      LKDAINEALRDWVATFEYSHYLIGSVVGPYPYPVIVRDFQSVIGREAREQILEAEG----
TRPB1_ARCFU      LKDAINEALRDWVESFEHTHYLIGSVVGPHPFPTIVRDFQAVIGKEARRQIIEAEG----
TRPB2_CHLCV      LKDAVNEALRDWSKNYESTHYCLGSALGPSPYPEMVRNFQSVISLEVKSQLQEIG-----
TRPB1_CHLCV      LKEAVDAAIEDFIFKHDHTHFCIGSALGPYPYPKIVRDFQSVISLEVKSQIKEYTD----
TRPB2_WOLSU      LKDAMNEAIRHWVTHARDTFYIIGTVAGPHPYPMMVRDFQSVISFEAKKQILEKEER---
TRPB_BACTN       LKDATNEAIRDWCCHPADTYYIIGSTVGPHPYPDMVARLQSVISEEIKKQLMEKEGRD--
TRPB_HELHP       LKDAVNEALREWSKRSDDSFYVLGSALGPYPYPDIVRDLQSVISKELKKQTKAYFS----
TRPB2_AQUAE      LGIAISEAIEEAASRE-DTKYSLGSVLNH------VLLHQTVIGLEAKKQMEEAGYY---
TRPB2_ARCFU      LGIAISEAIEDAAKNE-NTKYSLGSVLNH------VLLHQTVIGLETKAQLEKVDEK---
TRPB2_METMA      LGIAISEAVEDAIAHD-NTKYTLGSVLNH------VVLHQTVIGAECKKQLEQVEEY---
TRPB2_METAC      LGIAISEAVEDAIAHE-NTKYSLGSVLNH------VVLHQTVIGAECKQQLAQVEEY---
TRPB2_THEMA      LGIAISEALEVAVSDP-NTKYSLGSVLNH------VLLHQTVIGLEIKKQLELIGEK---
TRPB2_METTH      LGIAISEAMEEALQEE-NVYYSLGSVLNH------VLLHQTVIGLETKKQLEIAGET---
TRPB2_PYRAB      LGIAISEAIEDVLKDE-KARYSLGSVLNH------VLMHQTVIGLEAKEQMEEFEE----
TRPB2_PYRFU      LGIAISEAIEDVLKDE-KARYSLGSVLNH------VLMHQTVIGLEAKQQMEEFEE----
TRPB_PYRHO       LGIAISEAIEDVLSDE-KARYSLGSVLNH------VLMHQTVIGLEAKKQVKEFEE----
TRPB2_THEKO      LGIAISEAIEDVLRDE-KARYALGSVLNH------VLMHQTVIGLEAQEQMKEFEE----
TRPB2_AERPE      LGIAISEAIEDVINSGGNAKYSLGSVLNH------VLLHQTVIGLEAEKQFREAGVY---
TRPB1_SACS2      LGIAMSEAIEYALKNE--FRYLVGSVLDV------VLLHQSVIGQETITQLDLLGED---
TRPB1_SULTO      LGIAMSEAIEFALNHN--FRYLVGSVLDV------VLLHQSVIGMEAIAQLDELGEE---
TRPB_PICTO       LGIGISEAVEYALDHN--YRYMVASVMNA------ALTHQSVIGQESIKQMELLGEF---
TRPB2_SACS2      LGIAISDAVEYAHKNG--GKYVVGSVVNS------DIMFKTIAGMEAKKQMELIGED---
TRPB2_SULTO      LGIAISEAVYYALENG--GKYVVGSVVNS------DILFKTIAGMEAKKQMEMIGED---
TRPB_THEAC       LGLAISEAIHYALDNG--GKYIAGSVINS------DILFKTIAGMEAKKQMEMAGED---
TRPB_THEVO       LGLAISEAIHYALDNG--GKYIAGSVINS------DILFKTIAGMEAKKQMEMAGED---
TRPB1_AERPE      LGLAIAEAVEYTLESG-DRRYLPGSVLEA------VLMHQTVIGLEALDQLP---EE---
TRPB_PYRAE       LGIAISEAVEYVLSGE-RRKYLPGSVMEF------VLLHQTVIGLEAVRQLP---EE---
                 *  .   :.           :  .:     . .        : . *   *          

TRPB1_WOLSU      ----ELPDHIVACVGGGSNAMGIF--SAFIDDP---------------VELWGVEPLGKG
TRPB2_VIBPA      ----KLPNNLVACVGGGSNAMGLF--SAFLEDEN--------------VAIHGVEPAGRS
TRPB_CALS4       ---GRLPDYVVACVGGGSNAMGIF--YPFIEDK--------------GVKLVGVEAAGEG
TRPB_CLOAB       ---GRLPDYVVACVGGGSNSMGIF--YPFIKDE--------------GVKLIGVEAAGLG
TRPB_CLOB8       ---GRLPDYILAPVGGGSNAIGIF--YPFIHDE--------------EVNLIGVEAAGKG
TRPB_FUSNN       ---NRLPDMIIACVGGGSNAIGAF--AEFIPDK--------------EVKLIGVEAAGKG
TRPB_CLONN       ---GRLPDTLIACVGGGSNAIGLF--YPFIKDE--------------NIEIIGVEAGGKG
TRPB_LACP3       ---ARLPDMVVACVGGGSNAIGSF--AAYIDDP--------------SVQLVGVEAAGKG
TRPB_LACCA       ---AQLPDMVVACVGGGSNAIGSF--AAYIDDP--------------SVQLVGVEAAGKG
TRPB_LACPL       ---GHLPDAVVACVGGGSNAIGSF--AAFLDDT--------------SVELIGCEAAGKG
TRPB_CAMJR       ---NKKVDYIIAAVGGGSNAAGIF--YDFIKDE--------------NVKLIGIEAGGLG
TRPB_CAMJE       ---NKKVDYIIAAVGGGSNAAGIF--YDFIKDE--------------NVKLIGIEAGGLG
TRPB_CAMJ8       ---NKKVDYIIAAVGGGSNAAGIF--YDFIKDE--------------NVKLIGIEAGGLG
TRPB_CAMJJ       ---NKKVDYIIAAVGGGSNAAGIF--YDFIKDE--------------NVKLIGIEAGGLG
TRPB_CAMJD       ---NKKVDYIIAAVGGGSNAAGIF--YDFIKDE--------------NVKLIGIEAGGLG
TRPB_THET2       -----LPDALIAAVGGGSNAIGLFAPFAYLPEG--------------RPKLIGVEAAGEG
TRPB_THET8       -----LPDALIAAVGGGSNAIGLFAPFAYLPEG--------------RPKLIGVEAAGEG
TRPB_DEIRA       -----VPDAIVACVGGGSNAIGIFAPFAYLPEGE-------------RPRLIGTEAAGHG
TRPB_CHLTE       -----LPDVIVACVGGGSNAIGMF--YEFLPDAK-------------EVELIGVEAAGEG
TRPB1_AQUAE      -----LPDAIVACVGGGSNAMGIF--YPFVEDK--------------GVQLIGVEAGGYG
TRPB_BRASB       ------PDSLVACIGGGSNAMGLF--HPFLDDP--------------SVEIFGVEAAGHG
TRPB_BRASO       ------PDSLVACIGGGSNAMGLF--HPFLDDP--------------SVEIFGVEAAGHG
TRPB_BRADU       ------PDSLVACIGGGSNAMGLF--HPFLDDP--------------SVEIFGVEAAGHG
TRPB_PARL1       ------PDSLVACIGGGSNAMGLF--HPFLDDP--------------SVKIYGVEAAGHG
TRPB_CAUVC       ------PDAVVACIGGGSNAIGLF--HPFLGDE--------------GVRLIGVEAAGHG
TRPB_ACICJ       ------PDVAIAAIGGGSNAIGLF--HAFLDE---------------QVKLIGVEAAGRG
TRPB_NOVAD       ------PDLLVAAIGGGSNAIGLF--HPFLDDP--------------SVRMLGVEAAGHG
TRPB_RHOS4       ------PDTLVAAIGGGSNAMGLF--HPFLDDP--------------SVRIVGVEAGGKG
TRPB_RUEST       ------PDTVIAAIGGGSNAMGLF--HPFLDDP--------------SVNIIGVEAGGKG
TRPB_RUEPO       ------PDTIIAAIGGGSNAMGLF--YPFLDDT--------------SVNIIGVEAGGKG
TRPB_DINSH       ------PDTLIAAIGGGSNAMGLF--YPFLDDK--------------EVAIIGVEAGGKG
TRPB_ROSDO       ------PDTVIAAIGGGSNAMGLF--YPFLDDK--------------EVGIIGVEAGGKG
TRPB_JANSC       ------PDTLIAAIGGGSNAMGLF--FPFLDDK--------------SVNIIGVEAGGHG
TRPB_PARDP       ------PDSVVAAIGGGSNAMGLF--HPFLDEP--------------SVRIIGVEAGGKG
TRPB_BRUSU       ------PDVIVAAVGGGSNAIGLF--HPFLDDA--------------SVKIVGVEAGGRG
TRPB_BRUC2       ------PDVIVAAVGGGSNAIGLF--HPFLDDA--------------SVKIVGVEAGGRG
TRPB_BRUSI       ------PDVIVAAVGGGSNAIGLF--HPFLDDA--------------SVKIVGVEAGGRG
TRPB_BRUAB       ------PDVIVAAVGGGSNAIGLF--HPFLDDA--------------SVKIVGVEAGGRG
TRPB_BRUA2       ------PDVIVAAVGGGSNAIGLF--HPFLDDA--------------SVKIVGVEAGGRG
TRPB_BRUME       ------PDVIVAAVGGGSNAIGLF--HPFLDDA--------------SVKIVGVEAGGRG
TRPB_OCHA4       ------PDVIVAAVGGGSNAIGLF--HPFLDDA--------------SVKIVGVEAGGRG
TRPB_RHILO       ------PDTIIAAVGGGSNAIGLF--HPFLDDK--------------DVRIIGIEAGGRG
TRPB_RHIEC       ----RLPDLVVAAVGGGSNAIGIF--HPFLDDS--------------SVKIVGVEAGGKG
TRPB_RHIL3       ------PDLVIAAVGGGSNAIGIF--HPFLDDP--------------SVKIVGVEAGGKG
TRPB_SINMW       ------PDLVVAAVGGGSNAIGIF--HPFLDDG--------------GVRIVGVEAGGKG
TRPB_RHIME       ------PDLVVAAVGGGSNAIGIF--HSFLDDE--------------GVRIVGVEAGGKG
TRPB_AGRFC       ------PDMIIAAVGGGSNAIGIF--HPFLDDK--------------NVRIVGVEAGGKG
TRPB_CHESB       ------PDMLVAAVGGGSNAIGLF--HPFLDDK--------------GVAMVGVEAGGKG
TRPB_PSEPF       ------PDSLVACIGGGSNAMGLF--HPFLDDK--------------SVEIIGVEAAGYG
TRPB_PSESY       ------PDSLVACIGGGSNAMGLF--HPFLDDK--------------SVEIIGVEAAGHG
TRPB_PSEF5       ------PDSLVACIGGGSNAMGLF--HPFLDDK--------------SVEIIGVEAAGYG
TRPB_PSEAE       ------PDSLVACIGGGSNAMGLF--HPFLDDA--------------GVQIVGVEAAGHG
TRPB_PSESH       ------PDSLIACVGGGSNAMGLF--HPFLDDA--------------SVEIIGVEAGGHG
TRPB_PSE14       ------PDSLIACVGGGSNAMGLF--HPFLDDA--------------SVEIIGVEAGGHG
TRPB_PSEU2       ------PDSLVACVGGGSNAMGLF--HPFLDDA--------------SVEIIGVEAGGHG
TRPB_PSESM       ------PDSLIACVGGGSNAMGLF--HPFLDDA--------------SVEIIGVEAGGHG
TRPB_PSEPU       ------PDSLVACVGGGSNAMGLF--HEFLEEP--------------SVQIIGVEAGGHG
TRPB_PSEPG       ------PDSLVACVGGGSNAMGLF--HEFLEEP--------------SVQIIGVEAGGHG
TRPB_PSEPK       ------PDSLVACVGGGSNAMGLF--HEFLEEP--------------SVQIIGVEAGGHG
TRPB_PSEP1       ------PDSLVACVGGGSNAMGLF--HEFLEEP--------------SVQIIGVEAGGHG
TRPB_PSEE4       ------PDSLIACVGGGSNAMGLF--HDFLDDA--------------SVQIIGVEAGGHG
TRPB_ACICA       ------PDALVACVGGGSNAIGLF--YPFLNDQ--------------DVKMYGVEAAGHG
TRPB_ACIAD       ------PDALVACVGGGSNAIGLF--YPFLNDQ--------------DVKMYGVEAAGHG
TRPB_LEGPA       ------PDALVACVGGGSNAIGLF--YPFLNDQ--------------SVMIYGVEAGGKG
TRPB_LEGPL       ------PDALVACVGGGSNAIGLF--YPFLNDQ--------------SVMIYGVEAGGKG
TRPB_LEGPH       ------PDALVACVGGGSNAIGLF--YPFLNDQ--------------SVMIYGVEAGGKG
TRPB_LEGPC       ------PDALVACVGGGSNAIGLF--YPFLNDQ--------------SVMIYGVEAGGKG
TRPB_BORBR       ------PDYVVAAVGGGSNAMGIF--HPYIPYE--------------NVRLIGVEAAGEG
TRPB_BORPA       ------PDYVVAAVGGGSNAMGIF--HPYIPYE--------------NVRLIGVEAAGEG
TRPB_BORPE       ------PDYVVAAVGGGSNAMGIF--HPYIPYE--------------NVRLIGVEAAGEG
TRPB_RALSO       ------PDAVIACVGGGSNAMGIF--YPYIDHA--------------SVQLIGVEAAGEG
TRPB_POLNA       -----QPDAVVACVGGGSNAMGIF--HPYIAHE--------------NTRLIGVEAAGEG
TRPB_POLSJ       -----QPDAVIACVGGGSNAMGIF--YPYIAHE--------------ETRLIGVEAAGEG
TRPB_ACIAC       RIAAEHPDAVIACVGGGSNAMGIF--HPYIPHE--------------KTRLIGVEAAGEG
TRPB_METPP       ------PDAVIACVGGGSNAMGIF--YPYIRHE--------------GVRLIGVEAAGHG
TRPB_METFK       ------PDAVIACVGGGSNAMGIF--YPYIDVE--------------GVRLIGVEAAGHG
TRPB_NITEU       ------PDALIACVGGGSNAIGLF--YPYIDEE--------------NVRMIGVEAAGKG
TRPB_NITEC       ------PDALIACVGGGSNAIGLF--YPYIGEE--------------NVRMIGVEAAGKG
TRPB_NITMU       ------PDALIACVGGGSNAIGLF--YPYL-DS--------------SIRMIGVEAAGHG
TRPB_METCA       ------PDALVACVGGGSNAIGLF--HPFVDDR--------------EVAMYGVEAAGDG
TRPB_XANAC       ------PDAISACVGGGSNAIGLF--HAFLNDP--------------GVKIYGAEAAGDG
TRPB_XANC5       ------PDAISACVGGGSNAIGLF--HAFLNDP--------------GVKIYGAEAAGDG
TRPB_XANOM       ------PDAISACVGGGSNAIGLF--HAFLNDP--------------GVKIYGAEAAGDG
TRPB_XANCP       ------PDAISACVGGGSNAIGLF--HAFLNDP--------------GVKIYGAEAAGDG
TRPB_XANC8       ------PDAISACVGGGSNAIGLF--HAFLNDP--------------GVKIYGAEAAGDG
TRPB_XYLFA       ------PDAMTACVGGGSNAIGLF--HAFLNDA--------------SVRIYGAEAAGDG
TRPB_XYLFT       ------PDAMTACVGGGSNAIGLF--HAFLNDA--------------SVRIYGAEAAGDG
TRPB_VESOH       ------PDALVACVGGGSNAIGLF--YAFIDNV--------------SVEIYGVEAAGHG
TRPB_RUTMC       ------PDVLVACVGGGSNAIGLF--HAFIDDA--------------SVEIYGVEAAGYG
TRPB_NEIG1       ------PDVAVACVGGGSNAIGLF--YPYIEEE--------------NVRLVGVEAGGLG
TRPB_NEIGO       ------PDVAVACVGGGSNAIGLF--YPYIEEE--------------NVRLVGVEAGGLD
TRPB_NEIMF       ------PDVAVACVGGGSNAIGLF--HPYIGEE--------------NVRLVGVEAGGLG
TRPB_NEIMA       ------PDVAVACVGGGSNAIGLF--HPYIGEE--------------NVRLVGVEAGGLG
TRPB_NEIMB       ------PDVAVACVGGGSNAIGLF--HPYIGEE--------------NVRLVGVEAGGLG
TRPB_NEIM0       ------PDVAVACVGGGSNAIGLF--HPYIGEE--------------NVRLVGVEAGGLG
TRPB_CHRVO       ------PDVVVACVGGGSNAIGMF--HPYIEVP--------------GVRMVGVEAGGHG
TRPB_RHOBA       ------PDCVVACVGGGSNAAGMF--YPFVEDE--------------GVRMVGVEAGGRS
TRPB_GEOSE       ----KLPDVIVACVGGGSNAIGMF--YPFLQDD---------------VRLVGVEAAGKG
TRPB_GEOTN       ----TLPDVIVACVGGGSNAIGMF--YPFLQDD---------------VRLVGVEAAGKG
TRPB_BACVZ       ----TLPDKVVACVGGGSNAMGIF--QAFLDED---------------TELIGAEAAGKG
TRPB_BACSU       ----TMPDKVVACVGGGSNAMGMF--QAFLNED---------------VELIGAEAAGKG
TRPB_BACLD       ----SLPDKVVACVGGGSNAIGMF--SAFIEET---------------VELIGVEAAGKG
TRPB_BACP2       ----RLPHKVIACVGGGSNAIGMY--RAFLDDE---------------VDLIGVEAAGKG
TRPB_BACHD       ----TLPTEVIACVGGGSNAIGTF--YPFLEDD---------------VKLIGVEAAGKG
TRPB_BACSK       ----RLPDTIVACVGGGSNAIGMF--YPFLDDE---------------VELVGVEAAGRG
TRPB_BACAN       ----KLPEAVVACIGGGSNAMGMF--YPFVHDE--------------EVALYGVEAAGKG
TRPB_BACHK       ----KLPEAVVACIGGGSNAMGMF--YPFVHDE--------------EVALYGVEAAGKG
TRPB_BACAH       ----KLPEAVVACIGGGSNAMGMF--YPFVHDE--------------EVALYGVEAAGKG
TRPB_BACCZ       ----KLPEAVVACIGGGSNAMGMF--YPFVHDE--------------EVALYGVEAAGKG
TRPB_BACCR       ----KLPEAVVACIGGGSNAMGMF--YPFVHDE--------------EVALYGVEAAGKG
TRPB_BACC1       ----KLPEAVVACIGGGSNAMGMF--YPFVHDE--------------EVALYGVEAAGKG
TRPB_OCEIH       ----SLPDAVVACVGGGSNAMGMF--YPFIDDK--------------EVTLFGVEAAGAG
TRPB_LACLS       ----KLPDALVACVGGGSNSMGLF--YPFVNDE--------------SVEMYGVEAAGLG
TRPB_LACLM       ----KLPDALVACVGGGSNSMGLF--YPFVNDE--------------SVEMYGVEAAGLG
TRPB_LACLA       ----KLPDALVACVGGGSNSMGLF--YPFVNDE--------------SVAMYGVEAAGLG
TRPB_STRR6       ----NLPDALVACVGGGSNAIGLF--HPFVEDE--------------SVAMYGAEAAGLG
TRPB_STRP2       ----NLPDALVACVGGGSNAIGLF--HPFVEDE--------------SVAMYGAEAAGLG
TRPB_STRPN       ----DLPDALVACVGGGSNAIGLF--HPFVEDE--------------SVAMYGTEAAGLG
TRPB_STRT2       ----KLPDAVMACIGGGSNAIGMF--YPFVNDK--------------SVAMYGAEASGLG
TRPB_STRT1       ----KLPDAVMACIGGGSNAIGMF--YPFVNDK--------------SVAMYGAEASGLG
TRPB_STRTD       ----KLPDAVMACIGGGSNAIGMF--YPFVNDK--------------SVAMYGAEASGLG
TRPB_STRMU       ----QLPDAVLACIGGGSNAIGLF--YPFVNDE--------------SVAMYGAEASGLG
TRPB_LISMF       ----KLPDAIVACVGGGSNAMGLF--YPFVDDV--------------SVQMHGVEAAGHG
TRPB_LISMO       ----KLPDAIVACVGGGSNAMGLF--YPFVDDA--------------SVQMHGVEAAGHG
TRPB_LISIN       ----KLPEAIVACVGGGSNAMGLF--YPFVDDS--------------SVQMHGVEAAGHG
TRPB_LISW6       ----KLPEAIVACVGGGSNAMGLF--YPFVDDS--------------SVQMHGVEAAGHG
TRPB_STAAN       ----RLPDAIVACIGGGSNAIGTF--YPFIKDD---------------VALYGVEAAGQG
TRPB_STAA1       ----RLPDAIVACIGGGSNAIGTF--YPFIKDD---------------VALYGVEAAGQG
TRPB_STAAM       ----RLPDAIVACIGGGSNAIGTF--YPFIKDD---------------VALYGVEAAGQG
TRPB_STAA9       ----RLPDAIVACIGGGSNAIGTF--YPFIKDD---------------VALYGVEAAGQG
TRPB_STAA2       ----RLPDAIVACIGGGSNAIGTF--YPFIKDD---------------VALYGVEAAGQG
TRPB_STAAR       ----RLPDAIVACIGGGSNAIGTF--YPFIKDD---------------VALYGVEAAGQG
TRPB_STAAB       ----RLPDAIVACIGGGSNAIGTF--YPFIKDD---------------VALYGVEAAGQG
TRPB_STAAE       ----RLPDAIVACIGGGSNAIGTF--YPFIKDD---------------VALYGVEAAGQG
TRPB_STAA8       ----RLPDAIVACIGGGSNAIGTF--YPFIKDD---------------VALYGVEAAGQG
TRPB_STAA3       ----RLPDAIVACIGGGSNAIGTF--YPFIKDD---------------VALYGVEAAGQG
TRPB_STAAW       ----RLPDAIVACIGGGSNAIGTF--YPFIKDD---------------VALYGVEAAGQG
TRPB_STAAT       ----RLPDAIVACIGGGSNAIGTF--YPFIKDD---------------VALYGVEAAGQG
TRPB_STAAC       ----RLPDAIVACIGGGSNAIGTF--YPFIKDD---------------VALYGVEAAGQG
TRPB_STAAS       ----RLPDAIVACIGGGSNAIGTF--YPFIKDD---------------VALYGVEAAGQG
TRPB_STAS1       ----QLPDAIVACVGGGSNAIGTF--YPFVKDD---------------VKLYGVEAAGDG
TRPB_STAEQ       ----RLPDALVACVGGGSNSIGTF--YPFIQDD---------------VKLYGVEAAGKG
TRPB_STAES       ----RLPDALVACVGGGSNSIGTF--YPFIQDD---------------VKLYGVEAAGKG
TRPB_LEPIC       ----KLPNAVIACVGGGSNAIGMF--YGFIQDK--------------KVKLFGVEAGGYS
TRPB_LEPIN       ----KLPNAVIACVGGGSNAIGMF--YGFIQDK--------------KVKLFGVEAGGYS
TRPB_LEPBJ       ----KLPNAVIACVGGGSNSIGMF--YGFLRDK--------------KVKLFGVEAGGYS
TRPB_LEPBL       ----KLPNAVIACVGGGSNSIGMF--YGFLRDK--------------KVKLFGVEAGGYS
TRPB2_NOSS1      ----GLPDILLACVGGGSNAMGLF--YEFVNES--------------SIKLIGVEAAGEG
TRPB_TRIV2       ----GLPDILLACVGGGSNAMGLF--YEFVNES--------------SIRLIGVEAAGEG
TRPB1_NOSS1      ----GLPDILLACVGGGSNAIGLF--HEFIDEP--------------SIRLIGVEAAGEG
TRPB_TRIEI       ----GLPDILMACVGGGSNAMGLF--HEFINDP--------------SVRMIGVEAAGKG
TRPB_THEEB       ----GLPDILLACVGGGSNAMGLF--HEFVEEP--------------QVRLIGVEAAGQG
TRPB_SYNY3       ----GLPDILLACVGGGSNAMGLF--YDFIDEP--------------AVRLIGIEAAGES
TRPB_SYNJB       ----GLPDVLLACVGGGSNALGLF--NEFVRDP--------------QVRLIGIEAAGEG
TRPB_GLOVI       ----RLPDVLIACVGGGSNAIGLF--HDFLDER--------------AVRLVGIEAAGEG
TRPB_PROM1       ----RSPDVLLACVGGGSNAMGLF--HSFVEDK--------------SVRMIGVEAAGDG
TRPB_PROMT       ----RSPDVLLACVGGGSNAMGLF--HSFVEDK--------------SVRMIGVEAAGDG
TRPB_PROMA       ----RSPDVLLACVGGGSNAMGLF--HPFIEDR--------------SVRMIGVEAAGDG
TRPB_SYNPW       ----RLPDVLMACVGGGSNAMGLF--HPFVECT--------------DVRLIGVEAAGDG
TRPB_PROMM       ----RLPDVLLACVGGGSNAMGLF--HPFVQDR--------------SVRMIGVEAAGDG
TRPB_SYNSC       ----RLPDVLMACVGGGSNAMGLF--HPFVQDM--------------SVRLIGVEAAGDG
TRPB_SYNPX       ----RLPDVLMACVGGGSNAMGLF--HPFVECT--------------NVRLIGVEAAGDG
TRPB_SYNS9       ----RLPDVLMACVGGGSNAMGLF--HPFVQDT--------------SVRLIGVEAAGDG
TRPB_SYNS3       ----RLPDVLLACVGGGSNAMGLF--HPFVQDT--------------SVRLIGVEAAGDG
TRPB_PROMP       ----SLPDILLACVGGGSNAMGLF--HPFVKEK--------------SVRLIGVEAAGSG
TRPB_PROM5       ----SLPDILLACVGGGSNAMGLF--HPFVKEK--------------SVRLIGVEAAGSG
TRPB_PROMS       ----SLPDILLACVGGGSNAMGLF--HPFVKET--------------SVRLIGVEAAGSG
TRPB_PROM0       ----SFPDILLACVGGGSNAMGLF--HPFVKET--------------SVRLIGVEAAGSG
TRPB_PROM9       ----SLPDILLACVGGGSNAMGLF--HPFIKET--------------SVRLIGVEAAGSG
TRPB_PROM2       ----SLPDILLACVGGGSNAMGLF--HPFVKET--------------SVRLIGVEAAGGG
TRPB_MYCTU       ----RLPDAVVACVGGGSNAIGIF--HAFLDDP--------------GVRLVGFEAAGDG
TRPB_MYCBO       ----RLPDAVVACVGGGSNAIGIF--HAFLDDP--------------GVRLVGFEAAGDG
TRPB_MYCLE       ----RLPDAVTACIGGGSNAIGIF--HAFLDDP--------------GVRLVGFEAAGDG
TRPB_MYCIT       ----RLPDAVLACIGGGSNAIGIF--HPFIDDP--------------GVRLIGFEAAGDG
TRPB_STRAW       ----RLPDAAVACVGGGSNAIGLF--HAFIPDT--------------GVRLIGCEPAGHG
TRPB_STRCO       ----RLPDAAIACVGGGSNAIGLF--HAFIPDA--------------DVRLIGCEPAGHG
TRPB_LEIXX       ----RLPDAVAACVGGGSNAMGIF--HAFLDDE--------------NVRLVGFEAGGEG
TRPB_SHIFL       ----RLPDAVIACVGGGSNAIGMF--ADFINE--------------TNVGLIGVEPGGHG
TRPB_ECOLC       ----RLPDAVIACVGGGSNAIGMF--ADFINE--------------TNVGLIGVEPGGHG
TRPB_SHIF8       ----RLPDAVIACVGGGSNAIGMF--ADFINE--------------TNVGLIGVEPGGHG
TRPB_ECOLI       ----RLPDAVIACVGGGSNAIGMF--ADFINE--------------TNVGLIGVEPGGHG
TRPB_ECO24       ----RLPDAVIACVGGGSNAIGMF--ADFINE--------------TNVGLIGVEPGGHG
TRPB_ECOHS       ----RLPDAVIACVGGGSNAIGMF--ADFINE--------------TNVGLIGVEPGGHG
TRPB_SHISS       ----RLPDAVIACVGGGSNAIGMF--ADFINE--------------TNVGLIGVEPGGHG
TRPB_ECO57       ----RLPDAVIACVGGGSNAIGMF--ADFINE--------------TNVGLIGVEPGGHG
TRPB_SHIBS       ----RLPDAVIACVGGGSNAIGMF--ADFINE--------------TNVGLIGVEPGGHG
TRPB_ECOK1       ----RLPDAVIACVGGGSNAIGMF--ADFINE--------------TDVGLIGVEPGGHG
TRPB_ECOUT       ----RLPDAVIACVGGGSNAIGMF--ADFINE--------------TDVGLIGVEPGGHG
TRPB_SHIDS       ----RLPDAVIACVGGGSNAIGMF--ADFINE--------------TDVGLIGVEPGGHG
TRPB_ECOL5       ----RLPDAVIACVGGGSNAIGMF--ADFINE--------------TDVGLIGVEPGGHG
TRPB_ECOL6       ----RLPDAVIACVGGGSNAIGMF--ADFINE--------------TDVGLIGVEPGGHG
TRPB_CITK8       ----RLPDAVIACVGGGSNAIGMF--ADFINE--------------TSVGLIGVEPGGHG
TRPB_SALTY       ----RLPDAVIACVGGGSNAIGMF--ADFIND--------------TSVGLIGVEPGGHG
TRPB_SALPB       ----RLPDAVIACVGGGSNAIGMF--ADFIND--------------TSVGLIGVEPGGHG
TRPB_SALTI       ----RLPDAVIACVGGGSNAIGMF--ADFIND--------------TSVGLIGVEPGGHG
TRPB_SALPA       ----RLPDAVIACVGGGSNAIGMF--ADFIND--------------TSVGLIGVEPGGHG
TRPB_SALCH       ----RLPDAVIACVGGGSNAIGMF--ADFIND--------------TSVGLIGVEPGGHG
TRPB_SALAR       ----RLPDAVIACVGGGSNAIGMF--ADFIND--------------ASVGLIGVEPGGHG
TRPB_CROS8       ----RLPDAVIACVGGGSNAIGMF--ADFINE--------------TSVGLIGVEPAGHG
TRPB_KLEP7       ----RLPDAVIACVGGGSNAIGMF--ADFIEE--------------TNVGLIGVEPAGHG
TRPB_ENT38       ----RLPDAVIACVGGGSNAIGMF--ADFIDD--------------TSVGLIGVEPAGHG
TRPB_PECAS       ----RLPDAVLACVGGGSNAIGMF--ADFIDD--------------THVRLIGIEPGGLG
TRPB_YERPA       ----RLPDAVLACVGGGSNAIGMF--ADFIDE--------------PDVGLIGVEPAGLG
TRPB_YERPS       ----RLPDAVLACVGGGSNAIGMF--ADFIDE--------------PDVGLIGVEPAGLG
TRPB_YERPN       ----RLPDAVLACVGGGSNAIGMF--ADFIDE--------------PDVGLIGVEPAGLG
TRPB_YERPP       ----RLPDAVLACVGGGSNAIGMF--ADFIDE--------------PDVGLIGVEPAGLG
TRPB_YERP3       ----RLPDAVLACVGGGSNAIGMF--ADFIDE--------------PDVGLIGVEPAGLG
TRPB_YERPE       ----RLPDAVLACVGGGSNAIGMF--ADFIDE--------------PDVGLIGVEPAGLG
TRPB_YERE8       ----RLPDAVLACIGGGSNAIGMF--ADFIDE--------------PGVGLIGVEPAGLG
TRPB_SERP5       ----RLPDAVLACVGGGSNAIGMF--ADFIDD--------------TSVGLIGVEPAGLG
TRPB_SODGM       ----RLPDAVIACVGGGSNAIGMF--ADFIDE--------------PAVRLIGVEPGGLG
TRPB_PHOLL       ----RLPDAVLACVGGGSNAIGMF--AEFIPE--------------TSVRLIGIEPAGLG
TRPB_HAEIN       ----RLPDTVIAAVGGGSNAIGMF--ADFIDE--------------SNVRLIGVEPAGKG
TRPB_HAEIE       ----RLPDAVIAAVGGGSNAIGMF--ADFIDE--------------SNVRLIGVEPAGKG
TRPB_HAEIG       ----RLPDAVIAAVGGGSNAIGMF--ADFIDE--------------SNVRLIGVEPAGKG
TRPB_HAEI8       ----RLPDAVIAAVGGGSNAIGMF--TDFIDE--------------PNVRLIGVEPAGKG
TRPB_ACTSZ       ----CLPDAVIAAVGGGSNAIGMF--TDFIDE--------------TNVRLIGVEPAGKG
TRPB_HISS2       ----RLPDAVIAAVGGGSNAIGMF--AEFIAE--------------KSVQLIGIEPAGNG
TRPB_ACTP2       ----RLPDAVIAAVGGGSNAIGMF--ADFIEE--------------KSVQLIGVEPAGKG
TRPB_PASMU       ----RLPDAVIAAVGGGSNAIGMF--NDFIEE--------------TSVRLIGVEPAGKG
TRPB_MANSM       ----RLPDAVIACVGGGSNAIGMF--TDFINE--------------TSVRLIGVEPAGKG
TRPB_BUCAP       ----RLPDAIIACVGGGSNAIGIF--SDFIDE--------------D-VNLIGVEPAGQG
TRPB_BUCAI       ----KLPDSIIACIGGGSNAIGIF--SDFIND--------------K-VNLIGVEPAGYG
TRPB_BUCDN       ----KLPNAIIACVGGGSNAIGIF--SNFIND--------------KEVSLIGVEPGGKG
TRPB_BUCMH       ----CLPNAVIACVGGGSNAIGIF--SSFISD--------------NSVSLIGVEPGGKG
TRPB_BUCSC       ----CLPNSVIACVGGGSNAIGIF--SSFIED--------------TSVNLIGVEPGGIG
TRPB_BUCBP       ----CLPNIIIACIGGGSNAIGIF--SEFIKD--------------KSVCLIGVEPAGKG
TRPB_BLOPB       ----CLPDAIIACVGGGSNAIGIF--SDFVDI--------------PSVQLLGVEAGGLG
TRPB_BLOFL       ----KLPDAVIACIGGGSNAIGIF--SGFIDI--------------PSVQLLGVEAGGLG
TRPB1_VIBPA      ----RLPDAVIACVGGGSNAIGMF--ADFIEE--------------ESVRLIGVEPAGKG
TRPB_VIBCB       ----RLPDAVIACVGGGSNAIGMF--ADFIEE--------------ESVRLIGVEPAGKG
TRPB_VIBVU       ----RLPDAVIACVGGGSNAIGMF--ADFIEE--------------ETVRLIGVEPAGKG
TRPB_VIBVY       ----RLPDAVIACVGGGSNAIGMF--ADFIEE--------------ETVRLIGVEPAGKG
TRPB_ALIF1       ----RLPDAVIACVGGGSNAIGMF--ADFIEE--------------ESVKLIGVEPAGKG
TRPB_VIBC3       ----RLPDAVIACVGGGSNAIGMF--ADFIEE--------------ESVRLIGIEPAGKG
TRPB_VIBCH       ----RLPDAVIACVGGGSNAIGMF--ADFIEE--------------ESVRLIGIEPAGKG
TRPB_VIBME       ----RLPDAVLACIGGGSNAIGMF--ADFIDE--------------ANVRLIGIEPAGKG
TRPB_PHOPR       ----RLPDAVIACVGGGSNAIGMF--ADFIDE--------------KDVSLIGVEPAGKG
TRPB_FRAT1       ----RLPDAVIACVGGGSNAIGMF--ADFIDE--------------KNVKLIGVEPAGKG
TRPB_FRATT       ----RLPDAVIACVGGGSNAIGMF--ADFIDE--------------KNVKLIGVEPAGKG
TRPB_FRATH       ----RLPDAVIACVGGGSNAIGMF--ADFIDE--------------KNVKLIGVEPAGKG
TRPB_FRATF       ----RLPDAVIACVGGGSNAIGMF--ADFIDE--------------KNVKLIGVEPAGKG
TRPB_FRATO       ----RLPDAVIACVGGGSNAIGMF--ADFIDE--------------KNVKLIGVEPAGKG
TRPB_FRATW       ----RLPDAVIACVGGGSNAIGMF--ADFIDE--------------KNVKLIGVEPAGKG
TRPB_FRATN       ----RLPDAVIACVGGGSNAIGMF--ADFIDE--------------KNVKLIGVEPAGKG
TRPB_FRAP2       ----KLPDAVIACVGGGSNAIGMF--ADFIDE--------------TSVQLIGVEPAGKG
TRPB_AERHH       ----RLPDAVIACVGGGSNAIGMF--ADFIDE--------------PSVRLIGVEPGGHG
TRPB_AERS4       ----RLPDAVIACVGGGSNAIGMF--ADFIDN--------------KEVRLIGVEPGGHG
TRPB_PSYIN       ----VLPDKVIACVGGGSNAIGIF--NDFIDD--------------PSVELIGVEPGGRG
TRPB_SHEPA       ----RLPDAVIACVGGGSNAIGMF--ADFIDE--------------EEVALIGVEPAGKG
TRPB_SHEHH       ----RLPDAVIACVGGGSNAIGMF--ADFIDE--------------PEVALIGVEPAGKG
TRPB_SHELP       ----RLPDAVIACVGGGSNAIGMF--ADFIDE--------------PSVKLIGVEPAGLG
TRPB_SHESM       ----RLPDAVIACVGGGSNAIGMF--ADFIDE--------------TSVELIGVEPAGKG
TRPB_SHESA       ----RLPDAVIACVGGGSNAIGMF--ADFIDE--------------TSVELIGVEPAGKG
TRPB_SHESR       ----RLPDAVIACVGGGSNAIGMF--ADFIDE--------------TSVELIGVEPAGKG
TRPB_SHEON       ----RLPDAVIACVGGGSNAIGMF--ADFIDE--------------TNVELIGVEPAGKG
TRPB_SHEB8       ----RLPDAVIACVGGGSNAIGMF--ADFIDE--------------PSVELIGVEPAGKG
TRPB_SHEB5       ----RLPDAVIACVGGGSNAIGMF--ADFIDE--------------PSVELIGVEPAGKG
TRPB_SHESW       ----RLPDAVIACVGGGSNAIGMF--ADFIDE--------------PSVELIGVEPAGKG
TRPB_SHEPC       ----RLPDAVIACVGGGSNAIGMF--ADFIDE--------------PSVELIGVEPAGKG
TRPB_SHEB9       ----RLPDAVIACVGGGSNAIGMF--ADFIDE--------------PSVELIGVEPAGKG
TRPB_SHEFN       ----RLPDAVIACVGGGSNAIGMF--ADFIDE--------------PSVELIGVEPAGKG
TRPB_SHEDO       ----RLPDAVIACVGGGSNAIGMF--ADFIDE--------------PSVELIGVEPAGKG
TRPB_SHEAM       ----RLPDAVIACVGGGSNAIGMF--ADFIDE--------------PSVKLIGVEPAGKG
TRPB_PSEA6       ----RLPDAVVACVGGGSNAIGMF--ADFIDE--------------PSVQLIGVEPAGKG
TRPB_HELPY       ----RLPDYVIACVGGGSNAIGIF--SAFLND--------------KEVKLIGVEPAGLG
TRPB_HELPJ       ----RLPDYVIACVGGGSNAIGIF--SAFLND--------------KEVKLIGVEPAGLG
TRPB_CORGL       ----KLPDVVVACVGGGSNAIGMF--ADFIDD--------------EGVELVGAEPAGEG
TRPB_CORGB       ----KLPDVVVACVGGGSNAIGMF--ADFIDD--------------EGVELVGAEPAGEG
TRPB1_COREF      ----KMPDVVVACVGGGSNAIGMF--ADFIDE--------------EGVELVGAEPAGEG
TRPB2_COREF      ----ALPDAVVACVGGGSNAIGAF--AQYLEDQPGN----------EKVRLIGVEPAGYG
TRPB_METJA       ----RLPDVIVACVGGGSNAIGAF--YEFLDDD---------------VELYAVEAGGKG
TRPB_METKA       ----GLPDAIVACTGGGSNSIGIF--YDFLDDEE--------------VALYAVEAGGKG
TRPB1_METTH      ----ELPDTVIACVGGGSNAIGIF--SAFMDDD---------------VELIGAEGGGEG
TRPB2_METTM      ----ELPDTIIACVGGGSNAIGIF--SAFLDDD---------------VELIGAEGGGEG
TRPB1_METMA      ----RLPDTIIACAGGGSNAMGTF--YPFIEDR--------------DVRLIAVEAGGKA
TRPB1_METAC      ----RLPDSIIACAGGGSNAMGTF--HPFIEDR--------------EVKLIAVEAGGKG
TRPB_HALVD       ----RLPDAVVACAGGGSNTMGAF--AEFVDDE--------------ETALYAVEAGGST
TRPB_HALSA       ----ELPAAVIACAGGGSNTMGAF--GAFVGSASLPGAPAGTHEPAPDVDLLAVEAGGSR
TRPB1_THEMA      ----RLPDYIVACVGGGSNAAGIF--YPFIDSG---------------VKLIGVEAGGEG
TRPB_METVO       ----RLPDYLVACIGGGSNAMGLF--HPFLSNNISTG-----NDDAKNVKMIGIEAAGKG
TRPB_META3       ----RLPDSIVACVGGGSNSIGIF--NEFKQD--------------KEVKLIGVEAAGEG
TRPB1_PYRFU      ----QLPDVIVACVGGGSNAMGIF--YPFVNDKK--------------VKLVGVEAGGKG
TRPB1_PYRAB      ----DLPDVIVACVGGGSNAMGIF--YPFVKDKS--------------VRLIGVEAGGKG
TRPB1_THEKO      ----TLPDAVVACVGGGSNAMGIF--YPFVNDR---------------VRLIGVEAGGKG
TRPB1_ARCFU      ----GMPDAIIACVGGGSNAMGIF--HPFLNDD---------------VRLIGVEAGGEG
TRPB2_CHLCV      ----FSPDLLIACVGGGSNAIGFF--HHFIPD--------------TRVKLVGVEAGGLG
TRPB1_CHLCV      ----RDPDILIACVGGGSNAIGFF--HHFIPN--------------TKVKLVGVEGGGLG
TRPB2_WOLSU      -----LPDYVIACIGGGSNAAGMF--ARFLDEE--------------SVRCIGIEAGGLG
TRPB_BACTN       -----HPDYLIACVGGGSNAAGTI--YHYINDG--------------RVGIILAEAGGKG
TRPB_HELHP       ----SLPDILVACVGGGSNAMGFF--THYLKEE--------------RVRLIGVEAGGIG
TRPB2_AQUAE      ------PDVIIGAVGGGSNFAGLS--FPFLADVLRGDKRK------EDLKVLAVEPEACP
TRPB2_ARCFU      ------PDVLIGCVGGGSNFAGLT--YPFVNDAKNGD-----------LEIIAVEPAACP
TRPB2_METMA      ------PDVVIGCCGGGSNLGGIG--LEFIKDRLEGKH---------NARVVAVEPSACP
TRPB2_METAC      ------PDVVIGCCGGGSNLGGIG--LEFIKDRLEGKH---------SARVVAVEPSACP
TRPB2_THEMA      ------PDILLGCHGGGSNFGGTI--LPFVPDKLSGRD----------IRFVACEPAACP
TRPB2_METTH      ------PDIMIGCVGGGSNFGGAI--FPFVKDKLDGKL---------DCEFIAAEPKSCP
TRPB2_PYRAB      ------PDVIIGCVGGGSNFAGLA--YPFVKDVLDGKS---------EYEFIAVEPKAAP
TRPB2_PYRFU      ------PDVIIGCVGGGSNFAGLA--YPFVKEVLDGDN---------EYEFIAVEPKAAP
TRPB_PYRHO       ------PDVIIGCVGGGSNFAGLS--YPFIKDVLDGKA---------EYEFIAVEPRAVP
TRPB2_THEKO      ------PDVIIGCVGGGSNFAGLA--YPFVRDVLKGEA---------EYEFIAVEPKAAP
TRPB2_AERPE      ------PDIMIGAVGGGSNFAGFT--YPFIRHRLKGSS---------STRFIAVEPKASP
TRPB1_SACS2      ------ADILIGCVGGGSNFGGFT--YPFIGNKKG-------------KRYIAVSSAEIP
TRPB1_SULTO      ------PDILIGCVGGGSNFGGFT--YPFIGAKKG-------------KKYIAVGAAEIP
TRPB_PICTO       ------PDVLFGCVGGGSNFGGFA--FPFLPINDD-------------IEIYATTAQEVP
TRPB2_SACS2      ------PDYIIGVVGGGSNYAALA--YPFLGDELRSGKV--------RRKYIASGSSEVP
TRPB2_SULTO      ------PDYIIGVVGGGSNYAALA--YPFLGEELRKGKV--------RRKYIASGAIEVP
TRPB_THEAC       ------PDYIVGVVGGGSNYAALA--FPFLADELSSGKI--------RRTYIASGSKEVP
TRPB_THEVO       ------PDYVVGVVGGGSNYAALA--FPFLADELQSGKV--------KRTYIASGSKEVP
TRPB1_AERPE      ------PDVVVACVGGGSNFGGFT--YPMIGARLRGEG-F------EKTRFIAAESTAAP
TRPB_PYRAE       ------PDVAVACVGGGSNFAGFT--YPMIGMKLRGEG-F------GRTRFVAVESEAAP
                            .  *****  .                                      

TRPB1_WOLSU      -KSLG-EHA------ASLSYGKE-GVMHGFNSIMLQNEDGSPASVHSVASGLDYPSVGPE
TRPB2_VIBPA      LDKVG-EHA------ATLTLGEP-GIMHGFKSYMLKDEQGEPQEVHSVASGLDYPSVGPQ
TRPB_CALS4       IETG--KHA------SAMAKGSV-GVLHGMMTYLLQDEEGKILPVHSISAGLDYPGVGPE
TRPB_CLOAB       IDTP--MHA------ATLTKGSV-GIIHGMMTYVLQDEDGQITPAYSVSAGLDYPGVGPQ
TRPB_CLOB8       IETG--EHA------ATITKKEK-GILHGMLSYVLQDNDGGVLEAYSISAGLDYPGVGPE
TRPB_FUSNN       LNTD--RHA------ATLTLGTV-DVLDGMKTYALFNEDGSVKPVYSISPGLDYPGIGPE
TRPB_CLONN       VETG--EHG------AAFADGRV-GVIHGMKTVIMEDDNGNVKEAYSISAGLDYPGVGPE
TRPB_LACP3       VDTD--RTA------ATIERGSV-GIFHGMKSLFMQNEDGQIDPVYSISAGLDYPGVGPE
TRPB_LACCA       ADTD--RTA------ATIERGSV-GIFHGMKSLFMQNEDGQIDPVYSISAGLDYPGVGPE
TRPB_LACPL       VQTP--LTA------ATIERGRT-GIFHGMKSLFLQDKAGQIAPVYSISAGLDYPGVGPE
TRPB_CAMJR       IDTP--YHA------ATLNKGKT-GIIHGMKTKVLQDDLGNILPVHSVSAGLDYPGIGPL
TRPB_CAMJE       IDTP--YHA------ATLNKGKT-GIIHGMKTKVLQDDLGNILPVHSVSAGLDYPGIGPL
TRPB_CAMJ8       IDTP--YHA------ATLNKGKT-GIIHGMKTKVLQDDLGNILPVHSVSAGLDYPGIGPL
TRPB_CAMJJ       IDTP--YHA------ATLNKGKT-GIIHGMKTKVLQDDLGNILPVHSVSAGLDYPGIGPL
TRPB_CAMJD       VDTL--YHA------ATLNKGET-GIIHGMKTKVLQDDLGNILPVHSVSAGLDYPGIGPL
TRPB_THET2       LST--GRHA------ASIGAGKR-GVLHGSYMYLLYDHDGQITPAHSVSAGLDYPGVGPE
TRPB_THET8       LST--GRHA------ASIGAGKR-GVLHGSYMYLLYDHDGQITPAHSVSAGLDYPGVGPE
TRPB_DEIRA       VDT--GMHA------ASVAWGRV-GVLHGSMMYLMNDDEGQIVPPHSISAGLDYPGIGPE
TRPB_CHLTE       LE---GKHA------ASLTKGEI-GVLHGSMMKLLQDEYGQVQEAHSISAGLDYPGVGPE
TRPB1_AQUAE      LET--GQHA------ASICGGSV-GILHGMKSYFLQDEEGQIQPTHSISAGLDYPGVGPE
TRPB_BRASB       L-TQ--LHA------ASIAGGRP-GVLHGNRTYLLMDEDGQIAEAHSISAGLDYPGIGPE
TRPB_BRASO       L-TQ--LHA------ASIAGGRP-GVLHGNRTYLLMDDDGQIAEAHSISAGLDYPGIGPE
TRPB_BRADU       L-TQ--LHA------ASIAGGRP-GVLHGNRTYLLMDADGQIQDAHSISAGLDYPGIGPE
TRPB_PARL1       LETG--EHC------ASLKGGAP-GVLHGNRTYLLQDDDGQIKDGHSISAGLDYPGIGPE
TRPB_CAUVC       VSTD--KHA------ASLTGGRP-GVLHGNRTYLLQDDDGQIIDAHSISAGLDYPGIGPE
TRPB_ACICJ       LDSG--EHA------ASLSRGRP-GVLHGNRTYLLQDDDGQILEAHSISAGLDYPGIGPE
TRPB_NOVAD       LDK---EHA------ASLAGGRP-GILHGNKTYLLQDEDGQITEGHSISAGLDYPGIGPE
TRPB_RHOS4       VDDRM-EHC------ASLTGGRP-GVLHGNRTYLLQDADGQILEGFSISAGLDYPGIGPE
TRPB_RUEST       VDEKM-EHC------ASLTGGRP-GVLHGNRTYLLQDDDGQILEGFSISAGLDYPGIGPE
TRPB_RUEPO       VNEKM-EHC------ASLTGGRP-GVLHGNRTYLLQDDDGQILEGYSISAGLDYPGIGPE
TRPB_DINSH       VNEKM-EHC------ASLTGGRP-GVLHGNRTYLLQDDDGQILEGFSISAGLDYPGIGPE
TRPB_ROSDO       VNAKM-EHC------ASLTGGRP-GVLHGNRTYLLQDDDGQILEGFSISAGLDYPGIGPE
TRPB_JANSC       VNEKM-EHC------ASLTGGRP-GVLHGNRTYLLQDEDGQILEGHSISAGLDYPGIGPE
TRPB_PARDP       VDERM-QHC------ASLTGGRP-GVLHGNRTYLLQDGEGQILEGHSISAGLDYPGIGPE
TRPB_BRUSU       LEGE--EHC------ASMSAGRP-GVLHGNRTYLLQNADGQILEGHSVSAGLDYPGVGPE
TRPB_BRUC2       LEGE--EHC------ASMSAGRP-GVLHGNRTYLLQNADGQILEGHSVSAGLDYPGVGPE
TRPB_BRUSI       LEGE--EHC------ASMSAGRP-SVLHGNRTYLLQNADGQILEGHSVSAGLDYPGVGPE
TRPB_BRUAB       LEGE--EHC------ASMSAGRP-GVLHGNRTYLLQNADGQILEGHSVSAGLDYPGVGPE
TRPB_BRUA2       LEGE--EHC------ASMSAGRP-GVLHGNRTYLLQNADGQILEGHSVSAGLDYPGVGPE
TRPB_BRUME       LEGE--EHC------ASMSAGRP-GVLHGNRTYLLQNADGQILEGHSVSAGLDYPGVGPE
TRPB_OCHA4       LDGE--EHC------ASMSAGRP-GVLHGNRTYLLQNDDGQILEGHSVSAGLDYPGVGPE
TRPB_RHILO       LDGI--EHC------ASMNAGSP-GVLHGNRTYLLQNADGQIMDGHSISAGLDYPGVGPE
TRPB_RHIEC       LQGD--EHC------ASITAGSP-GVLHGNRTYLLQDGDGQIKEGHSISAGLDYPGIGPE
TRPB_RHIL3       LQGD--EHC------ASITAGSP-GVLHGNRTYLLQDSDGQIKEGHSISAGLDYPGIGPE
TRPB_SINMW       LDGD--EHC------ASLTAGSP-GVLHGNRTYLLQDGDGQIKEGHSISAGLDYPGIGPE
TRPB_RHIME       LDGD--EHC------ASLTAGSP-GVLHGNRTYLLQDGDGQIKEGHSISAGLDYPGIGPE
TRPB_AGRFC       LSGE--EHC------ASITAGSP-GVLHGNRTYLLQDGDGQIKEGHSISAGLDYPGIGPE
TRPB_CHESB       LEGD--EHC------ASLTAGSP-GVLHGNRTYLLQDSDGQIKEGHSISAGLDYPGIGPE
TRPB_PSEPF       IETG--KHA------ASLNGGVP-GVLHGNRTFLLQDDDGQIIDAHSISAGLDYPGIGPE
TRPB_PSESY       IETG--KHA------ASLNGGVP-GVLHGNRTFLLQDDDGQIIDAHSISAGLDYPGIGPE
TRPB_PSEF5       IETG--KHA------ASLNGGVP-GVLHGNRTFLLQDDDGQIIDAHSISAGLDYPGIGPE
TRPB_PSEAE       IDTG--KHA------ASLNGGVP-GVLHGNRTFLLQDADGQIIDAHSISAGLDYPGIGPE
TRPB_PSESH       VDTD--KHA------ASLNGGVP-GVLHGNRTYLLQDGDGQITDPHSISAGLDYPGIGPE
TRPB_PSE14       VDTD--KHA------ASLNGGVP-GVLHGNRTYLLQDGDGQITDAHSISAGLDYPGIGPE
TRPB_PSEU2       VSTD--KHA------ASLNGGVP-GVLHGNRTYLLQDGDGQITDAHSISAGLDYPGIGPE
TRPB_PSESM       VDTD--KHA------ASLNGGVP-GVLHGNRTYLLQDNDGQITDAHSISAGLDYPGIGPE
TRPB_PSEPU       VHTD--KHA------ASLNGGVP-GVLHGNRTYLLQDEDGQITDAHSISAGLDYPGIGPE
TRPB_PSEPG       VHTD--KHA------ASLNGGVP-GVLHGNRTYLLQDADGQITDAHSISAGLDYPGIGPE
TRPB_PSEPK       VHTD--KHA------ASLNGGVP-GVLHGNRTYLLQDQDGQITDAHSISAGLDYPGIGPE
TRPB_PSEP1       VHTD--KHA------ASLNGGVP-GVLHGNRTYLLQDQDGQITDAHSISAGLDYPGIGPE
TRPB_PSEE4       VHTD--KHA------ASLNGGVP-GVLHGNRTYLLQDDDGQITDAHSISAGLDYPGIGPE
TRPB_ACICA       IETG--KHS------APLNAGHV-GVLHGNRTYLMSDPQGQIIETHSISAGLDYPGVGPE
TRPB_ACIAD       IETG--KHS------APLNAGHV-GVLHGNRTYLMSDPQGQIIETHSISAGLDYPGVGPE
TRPB_LEGPA       IETG--EHS------ASLIAGKP-GVLHGNRTYLLCDEYGQVKDTHSVSAGLDYPGVGPE
TRPB_LEGPL       IETG--EHS------ASLIAGKP-GVLHGNRTYLLCDEYGQVKDTHSVSAGLDYPGVGPE
TRPB_LEGPH       IETG--EHS------ASLIAGKP-GVLHGNRTYLLCDEYGQVKDTHSVSAGLDYPGVGPE
TRPB_LEGPC       IETG--EHS------ASLIAGKP-GVLHGNRTYLLCDEYGQVKDTHSVSAGLDYPGVGPE
TRPB_BORBR       METG--RHA------ASLAAGQI-GVLHGNRTYVMQNADGQVQETHSVSAGLDYPGVGPE
TRPB_BORPA       METG--RHA------ASLAAGQI-GVLHGNRTYVMQNADGQVQETHSVSAGLDYPGVGPE
TRPB_BORPE       METG--RHA------ASLAAGQI-GVLHGNRTYVMQNADGQVQETHSVSAGLDYPGVGPE
TRPB_RALSO       LESG--RHA------ASLTGGSP-GVLHGNRTYLLQDEDGQIIETHSISAGLDYPGVGPE
TRPB_POLNA       LDSG--KHS------ASLQRGLP-GVLHGNRTYVLQNDDGQVTETHSISAGLDYPGVGPE
TRPB_POLSJ       LESG--KHS------ASLQRGLP-GVLHGNRTYVLQNDDGQVTETHSISAGLDYPGVGPE
TRPB_ACIAC       LDSG--KHS------ASLQRGSA-GVLHGNRTFILQDENGQITETHSISAGLDYPGVGPE
TRPB_METPP       LDSG--KHA------ASLSAGSP-GVLHGNRTYLLQDANGQIIETHSISAGLDYPGVGPE
TRPB_METFK       IDTG--RHA------APLTANSPAGVLHGNRTYLMQDENGQIIETHSISAGLDYPGVGPE
TRPB_NITEU       IDTH--EHA------ATLVTGRP-GVLHGNRTYLIQDENGQIIETHSISAGLDYPGVGPE
TRPB_NITEC       IDTQ--KHA------ATLVTGRP-GVLHGNRTYLIQDENGQIIETHSISAGLDYPGVGPE
TRPB_NITMU       VETD--QHA------ATLTKGRP-GVLHGNRTYLIQDENGQIVETHSISAGLDYPGVGPE
TRPB_METCA       IETG--RHS------APLSAGRP-GVLHGNRTYLMEDEDGEIIETHSISAGLDYPGVGPE
TRPB_XANAC       IATG--RHA------ASIAAGRP-GVLHGNRTYVICDDDGQITETHSISAGLDYPGVGPE
TRPB_XANC5       IATG--RHA------ASIAAGRP-GVLHGNRTYVICDDDGQITETHSISAGLDYPGVGPE
TRPB_XANOM       IATG--RHA------ASIAAGRP-GVLHGNRTYVICDDDGQITETHSISAGLDYPGVGPE
TRPB_XANCP       IASG--RHA------ASIAAGRP-GVLHGNRTYVICDDDGQIIETHSVSAGLDYPGVGPE
TRPB_XANC8       IASG--RHA------ASIAAGRP-GVLHGNRTYVICDDDGQIIETHSVSAGLDYPGVGPE
TRPB_XYLFA       IATG--RHA------ASIVAGRP-GVLHGNRTYVVCDDDGQILETHSVSAGLDYPGVGPE
TRPB_XYLFT       IATG--RHA------ASIVAGRP-GVLHGNRTYVVCDDDGQILETHSVSAGLDYPGVGPE
TRPB_VESOH       LEKGPSAHA------APLCAGNV-GVLHGNRTYLMGDENGQIIEGHSIAAGLDYPGVGPE
TRPB_RUTMC       LEKGPTAHS------APLCAGSV-GVLHGNRTYLMEDENGQIIEGHSISAGLDYPGVGPE
TRPB_NEIG1       VDTP--DHA------APITSGAPIGVLHGFRSYLMQDENGQVLGTHSVSAGLDYPGIGPE
TRPB_NEIGO       VDTP--DHA------APITSGAPIGVLHGFRSYLMQDENGQVLGTHSVSAGLDYPGIGPE
TRPB_NEIMF       VNTP--DHA------APITSGAPIGVLHGFRSYLMQDENGQVLGTHSVSAGLDYPGIGPE
TRPB_NEIMA       VNTP--DHA------APITSGAPIGVLHGFRSYLMQDENGQVLGTHSVSAGLDYPGIGPE
TRPB_NEIMB       VNTP--DHA------APITSGAPIGVLHGFRSYLMQDENGQVLGTHSVSAGLDYPGIGPE
TRPB_NEIM0       VNTP--DHA------APITSGAPIGVLHGFRSYLMQDENGQVLGTHSVSAGLDYPGIGPE
TRPB_CHRVO       VASG--KHA------APISSGAPVGVLHGSKSYLMQDADGQIVETHSVSAGLDYPGVGPE
TRPB_RHOBA       ATPG--DHA------SPLSYGNP-GVLHGSYSYVMQDEDGQTCDVHSMSAGLDYPGVGPE
TRPB_GEOSE       IDTP--YHA------ATITKGTK-GVIHGAMTYLLQDEYGQIVEPYSISAGLDYPGVGPE
TRPB_GEOTN       IDTP--HHA------ATIAKGTK-GVIHGAMTYLLQDEYGQIIEPYSISAGLDYPGVGPE
TRPB_BACVZ       IDTP--LHA------ATIAKGTL-GVIHGSMTYLIQDQYGQIIEPYSISAGLDYPGIGPE
TRPB_BACSU       IDTP--LHA------ATISKGTV-GVIHGSLTYLIQDEFGQIIEPYSISAGLDYPGIGPE
TRPB_BACLD       VDTP--LHA------ATITKGTK-GVIHGSLTYLIQDEYGQIIEPYSISAGLDYPGVGPE
TRPB_BACP2       IDTP--LHA------ATITKGTK-GVIHGSLTYLIQDEFGQIIEPYSISAGLDYPGIGPE
TRPB_BACHD       VETS--QHA------ATITKGRV-GVIHGSMTYLLQDDAGQITEPYSISAGLDYPGVGPE
TRPB_BACSK       LDTA--EHA------ATISKGSK-GIIHGSLTYLLQDESGQIKEPYSISAGLDYPGVGPE
TRPB_BACAN       VHTE--KHA------ATLTKGSV-GVLHGSMMYLLQNEEGQIQEAHSISAGLDYPGVGPE
TRPB_BACHK       VHTE--KHA------ATLTKGSV-GVLHGSMMYLLQNEEGQIQEAHSISAGLDYPGVGPE
TRPB_BACAH       VHTE--KHA------ATLTKGSV-GVLHGSMMYLLQNEEGQIQEAHSISAGLDYPGVGPE
TRPB_BACCZ       VHTE--KHA------ATLTKGSV-GVLHGSMMYLLQNEEGQIQEAHSISAGLDYPGVGPE
TRPB_BACCR       VHTE--KHA------ATLTKGSV-GVLHGSMMYLLQNEEGQIQEAHSISAGLDYPGVGPE
TRPB_BACC1       VHTE--QHA------ATLTKGSV-GVLHGSMMYLLQNEEGQIQEAHSISAGLDYPGVGPE
TRPB_OCEIH       LDTK--QHA------ATLTGGSP-GMLHGTFTYLLQDDCGQIEEAFSISAGLDYPGIGPE
TRPB_LACLS       IDTP--HHA------ATITKGRP-GVLHGTLMDVLQDENGQILEAFSISAGLDYPGIGPE
TRPB_LACLM       IDTP--HHA------ATITKGRP-GVLHGTLMDVLQDENGQILEAFSISAGLDYPGIGPE
TRPB_LACLA       IDTP--HHA------ATITKGRP-GVLHGTLMDVLQDENGQMLEAFSISAGLDYPGIGPE
TRPB_STRR6       VDTE--HHA------ATLTKGRP-GVLHGSLMDVLQDAHGQILEAFSISAGLDYPGIGPE
TRPB_STRP2       VDTE--HHA------ATLTKGRP-GVLHGSLMDVLQDAHGQILEAFSISAGLDYPGIGPE
TRPB_STRPN       VDTE--HHA------ATLTKGRP-GVLHGSLMDVLQDAHGQILEAFSISAGLDYPGIGPE
TRPB_STRT2       LDTE--KHA------ATFAKGRP-GILHGALMDVLQDAHGQIMEAFSISAGLDYPGVGPE
TRPB_STRT1       LDTE--KHA------ATFAKGRP-GILHGALMDVLQDAHGQIMEAFSISAGLDYPGVGPE
TRPB_STRTD       LDTE--KHA------ATFAKGRP-GILHGALMDVLQDAHGQIMEAFSISAGLDYPGVGPE
TRPB_STRMU       LDTD--KHA------ATFAKGRP-GVLHGALMDVLQDEHGQIMEAFSISAGLDYPGVGPE
TRPB_LISMF       LETE--FHA------ATISKGEI-GILHGAMMDVLQDENGQILEAFSISAGLDYPGIGPE
TRPB_LISMO       LETE--FHA------ATISKGEI-GILHGAMMDVLQDENGQILEAFSISAGLDYPGIGPE
TRPB_LISIN       LETE--FHA------ATISKGEI-GILHGAMMDVLQDENGQILEAFSISAGLDYPGIGPE
TRPB_LISW6       LETE--FHA------ATISKGEI-GILHGAMMDVLQDENGQILEAFSISAGLDYPGIGPE
TRPB_STAAN       EDTD--KHA------LAIGKGSP-GVLHGTKMYLIQDEGGQVQLAHSISAGLDYPGIGPE
TRPB_STAA1       EDTD--KHA------LAIGKGSP-GVLHGTKMYLIQDEGGQVQLAHSISAGLDYPGIGPE
TRPB_STAAM       EDTD--KHA------LAIGKGSP-GVLHGTKMYLIQDEGGQVQLAHSISAGLDYPGIGPE
TRPB_STAA9       EDTD--KHA------LAIGKGSP-GVLHGTKMYLIQDEGGQVQLAHSISAGLDYPGIGPE
TRPB_STAA2       EDTD--KHA------LAIGKGSP-GVLHGTKMYLIQDEGGQVQLAHSISAGLDYPGIGPE
TRPB_STAAR       EDTD--KHA------LAIGKGSP-GVLHGTKMYLIQDEGGQVQLAHSISAGLDYPGIGPE
TRPB_STAAB       EDTD--KHA------LAIGKGSP-GVLHGTKMYLIQDEGGQVQLAHSISAGLDYPGIGPE
TRPB_STAAE       DDTD--KHA------LAIGKGSP-GVLHGTKMYLIQDEDGQVQLAHSISAGLDYPGIGPE
TRPB_STAA8       DDTD--KHA------LAIGKGSP-GVLHGTKMYLIQDEDGQVQLAHSISAGLDYPGIGPE
TRPB_STAA3       DDTD--KHA------LAIGKGSP-GVLHGTKMYLIQDEDGQVQLAHSISAGLDYPGIGPE
TRPB_STAAW       DDTD--KHA------LAIGKGSP-GVLHGTKMYLIQDEDGQVQLAHSISAGLDYPGIGPE
TRPB_STAAT       DDTD--KHA------LAIGKGSP-GVLHGTKMYLIQDEDGQVQLAHSISAGLDYPGIGPE
TRPB_STAAC       DDTD--KHA------LAIGKGSP-GVLHGTKMYLIQDEDGQVQLAHSISAGLDYPGIGPE
TRPB_STAAS       DDTD--KHA------LAIGKGSP-GVLHGTKMYLIQDEDGQVQLAHSISAGLDYPGIGPE
TRPB_STAS1       IDSD--KHA------LAINKGKE-GVLHGTKMYLIQDDDGQIQLAHSISAGLDYPGVGPE
TRPB_STAEQ       SHTH--NHA------LAIGKGKP-GVLHGSKMYLIQNDDGQIELAHSISAGLDYPGIGPE
TRPB_STAES       SHTH--NHA------LAIGKGKP-GVLHGSKMYLIQNDDGQIELAHSISAGLDYPGIGPE
TRPB_LEPIC       SDPG--SHS------ATIQFGRT-GFLHGTKTLVIQDDFGQIVPAHSVSAGLDYPGVGPE
TRPB_LEPIN       SDPG--SHS------ATIQFGRT-GFLHGTKTLVIQDDFGQIVPAHSVSAGLDYPGVGPE
TRPB_LEPBJ       TEPG--HHS------ATIQFGRT-GFLHGTKTLVIQDEFGQIVPAHSVSAGLDYPGVGPE
TRPB_LEPBL       TEPG--HHS------ATIQFGRT-GFLHGTKTLVIQDEFGQIVPAHSVSAGLDYPGVGPE
TRPB2_NOSS1      VNTE--KHA------ATLTKGRV-GVLHGAMSYLLQDEDGQVIEAHSISAGLDYPGVGPE
TRPB_TRIV2       VNTE--KHA------ATLTKGRV-GVLHGAMSYLLQDEDGQVIEAHSISAGLDYPGVGPE
TRPB1_NOSS1      VDTD--KHA------ATLTLGRV-GVLHGAMSYLLQDEDGQVIEAHSISAGLDYPGVGPE
TRPB_TRIEI       VDTN--KHA------ATLTLGRV-GVLHGAMSYLLQDEEGQIIEPHSISAGLDYPGVGPE
TRPB_THEEB       LDTG--HHA------ATLTKGEV-GVLHGAMSYLLQDADGQVVEAHSISAGLDYPGVGPE
TRPB_SYNY3       IVSG--KHA------ATLTMGKP-GVLHGAMSYLLQDKEGQVTEAHSISAGLDYPGVGPE
TRPB_SYNJB       LHTP--RHA------ATLNRGRI-GVLHGAMSYLLQDEEGQVQEAHSISAGLDYPGVGPE
TRPB_GLOVI       IETG--KHA------ATLTAGRA-GVLHGAMSYVLQDEQGQVQEAHSLSAGLDYPGVGPE
TRPB_PROM1       VETG--RHA------ATITEGRV-GVLHGAMSLLLQDKDGQVEEAHSISAGLDYPGVGPE
TRPB_PROMT       VETG--RHA------ATITEGRI-GVLHGAMSLLLQDKDGQVEEAHSISAGLDYPGVGPE
TRPB_PROMA       VHTG--RHA------ATITEGRI-GVLHGAMSLLLQDSNGQVQEAHSISAGLDYPGVGPE
TRPB_SYNPW       VATG--RHA------ATITEGRV-GVLHGAMSLLLQDQDGQVQEAHSISAGLDYPGVGPE
TRPB_PROMM       VETG--RHA------ATITEGRV-GVLHGAMSLLLQDDEGQVQEAHSISAGLDYPGVGPE
TRPB_SYNSC       VASG--RHA------ATITEGRA-GVLHGAMSLLLQDGDGQVMEAHSISAGLDYPGVGPE
TRPB_SYNPX       VATG--RHA------ATITEGRA-GVLHGAMSLLLQDSDGQVQEAHSISAGLDYPGVGPE
TRPB_SYNS9       VNTP--RHA------ATITEGRA-GVLHGAMSLLLQDSDGQVQEAHSISAGLDYPGVGPE
TRPB_SYNS3       VATG--RHA------ATITEGRV-GVLHGAMSLLLQDQDGQVQEAHSISAGLDYPGVGPE
TRPB_PROMP       VNTE--KHA------ATITKGSV-GILHGSMSLLLQDKDGQVQEAHSISAGLDYPGVGPE
TRPB_PROM5       VNTD--KHA------ATITKGSV-GILHGSMSLLLQDKNGQVQEAHSISAGLDYPGVGPE
TRPB_PROMS       VDTD--KHA------ATITKGSV-GILHGSMSLLLQDDNGQVQEAHSISAGLDYPGVGPE
TRPB_PROM0       VDTD--KHA------ATITKGSV-GILHGSMSLLLQDDNGQVQEAHSISAGLDYPGVGPE
TRPB_PROM9       VDTD--KHA------ATITKGSV-GILHGSMSLLLQDDNGQVQEAHSISAGLDYPGVGPE
TRPB_PROM2       VDTD--KHA------ATITKGSV-GILHGSMSLLLQDDNGQVQEAHSISAGLDYPGVGPE
TRPB_MYCTU       VETG--RHA------ATFTAGSP-GAFHGSFSYLLQDEDGQTIESHSISAGLDYPGVGPE
TRPB_MYCBO       VETG--RHA------ATFTAGSP-GAFHGSFSYLLQDEDGQTIESHSISAGLDYPGVGPE
TRPB_MYCLE       VETG--RHA------ATLTGGLP-GAFQGTFSYLLQDEDGQTIESHSIAAGLDYPGVGPE
TRPB_MYCIT       VETG--RHA------ATFSGGSP-GAFQGSFSYLLQDEDGQTIESHSISAGLDYPGVGPE
TRPB_STRAW       LETG--EHA------ATLTAGEP-GILHGSRSYVLQDDEGQITEPYSISAGLDYPGIGPE
TRPB_STRCO       VETG--EHA------ATLTAGEP-GILHGSRSYVLQDDEGQITEPYSISAGLDYPGIGPE
TRPB_LEIXX       ADTP--RHA------ATITKGRP-GVLHGARSLLLQDEDGQTIESHSISAGLDYPGVGPE
TRPB_SHIFL       IETG--EHG------APLKHGRV-GIYFGMKAPMMQTEDGQIEESYSISAGLDFPSVGPQ
TRPB_ECOLC       IETG--EHG------APLKHGRV-GIYFGMKAPMMQTEDGQIEESYSISAGLDFPSVGPQ
TRPB_SHIF8       IETG--EHG------APLKHGRV-GIYFGMKAPMMQTEDGQIEESYSISAGLDFPSVGPQ
TRPB_ECOLI       IETG--EHG------APLKHGRV-GIYFGMKAPMMQTEDGQIEESYSISAGLDFPSVGPQ
TRPB_ECO24       IETG--EHG------APLKHGRV-GIYFGMKAPMMQTEDGQIEESYSISAGLDFPSVGPQ
TRPB_ECOHS       IETG--EHG------APLKHGRV-GIYFGMKAPMMQTEDGQIEESYSISAGLDFPSVGPQ
TRPB_SHISS       IETG--EHG------APLKHGRV-GIYFGMKAPMMQTEDGQIEESYSISAGLDFPSVGPQ
TRPB_ECO57       IETG--EHG------APLKHGRV-GIYFGMKAPMMQTEDGQIEESYSISAGLDFPSVGPQ
TRPB_SHIBS       IETG--EHG------APLKHGRV-GIYFGMKAPMMQTEDGQIEESYSISAGLDFPSVGPQ
TRPB_ECOK1       IETG--EHG------APLKHGRV-GIYFGMKAPMMQTEDGQIEESYSISAGLDFPSVGPQ
TRPB_ECOUT       IETG--EHG------APLKHGRV-GIYFGMKAPMMQTEDGQIEESYSISAGLDFPSVGPQ
TRPB_SHIDS       IETG--EHG------APLKHGRV-GIYFGMKAPMMQTEDGQIEESYSISAGLDFPSVGPQ
TRPB_ECOL5       IETG--EHG------APLKHGRV-GIYFGMKAPMMQTEDGQIEESYSISAGLDFPSVGPQ
TRPB_ECOL6       IETG--EHG------APLKHGRV-GIYFGMKAPMMQTEDGQIEESYSISAGLDFPSVGPQ
TRPB_CITK8       IETG--EHG------APLKHGRV-GIYFGMKAPMMQTEEGQIEESYSISAGLDFPSVGPQ
TRPB_SALTY       IETG--EHG------APLKHGRV-GIYFGMKAPMMQTADGQIEESYSISAGLDFPSVGPQ
TRPB_SALPB       IETG--EHG------APLKHGRV-GIYFGMKAPMMQTADGQIEESYSISAGLDFPSVGPQ
TRPB_SALTI       IETG--EHG------APLKHGRV-GIYFGMKAPMMQTADGQIEESYSISAGLDFPSVGPQ
TRPB_SALPA       IETG--EHG------APLKHGRV-GIYFGMKAPMMQTADGQIEESYSISAGLDFPSVGPQ
TRPB_SALCH       IETG--KHG------APLKHGRV-GIYFGMKAPMMQTADGQIEESYSISAGLDFPSVGPQ
TRPB_SALAR       IETG--EHG------APLKHGRV-GIYFGMKAPMMQTADGQIEESYSISAGLDFPSVGPQ
TRPB_CROS8       IETG--EHG------APLKHGRV-GIYFGMKAPMMQTDDGQIEESYSISAGLDFPSVGPQ
TRPB_KLEP7       IESG--EHG------APLKHGRV-GIYFGMKSPMMQTADGQIEESYSISAGLDFPSVGPQ
TRPB_ENT38       IESG--EHG------APLKHGRV-GIYFGMKSPMMQTDEGQIEESYSISAGLDFPSVGPQ
TRPB_PECAS       IESG--QHG------APLKHGRV-GIYFGMKSPMMQTSDGQIEESYSISAGLDFPSVGPQ
TRPB_YERPA       IETG--QHG------APLKHGKV-GIYFGMKSPMMQTSDGQIEESYSISAGLDFPSVGPQ
TRPB_YERPS       IETG--QHG------APLKHGKV-GIYFGMKSPMMQTSDGQIEESYSISAGLDFPSVGPQ
TRPB_YERPN       IETG--QHG------APLKHGKV-GIYFGMKSPMMQTSDGQIEESYSISAGLDFPSVGPQ
TRPB_YERPP       IETG--QHG------APLKHGKV-GIYFGMKSPMMQTSDGQIEESYSISAGLDFPSVGPQ
TRPB_YERP3       IETG--QHG------APLKHGKV-GIYFGMKSPMMQTSDGQIEESYSISAGLDFPSVGPQ
TRPB_YERPE       IETG--QHG------APLKHGKV-GIYFGMKSPMMQTSDGQIEESYSISAGLDFPSVGPQ
TRPB_YERE8       IETG--QHG------APLKHGKV-GIYFGMKSPMMQTSDGQIEESYSISAGLDFPSVGPQ
TRPB_SERP5       IETG--QHG------APLKHGHV-GIYFGMKAPMMQTSEGQIEESYSISAGLDFPSVGPQ
TRPB_SODGM       IETR--QHG------ASLKHGRT-GIYFGMKSPMMQSAEGQIEESYSISAGLDFPSVGPQ
TRPB_PHOLL       IETG--KHG------APLKHGKL-GIYFGMKSPMMQTDEGQIEESYSISAGLDFPSVGPQ
TRPB_HAEIN       IETG--EHG------APLKHGTT-GIYFGMKSPIMQDKDGQIEESYSISAGLDFPSVGPQ
TRPB_HAEIE       IETG--EHG------APLKHGTT-GIYFGMKSPIMQDKDGQIEESYSISAGLDFPSVGPQ
TRPB_HAEIG       IETG--EHG------APLKHGTT-GIYFGMKSPIMQDKDGQIEESYSISAGLDFPSVGPQ
TRPB_HAEI8       IESG--EHG------APLGHAKV-GIYFGMKSPLMQTEDGQVEESYSVSAGLDFPSVGPQ
TRPB_ACTSZ       IETG--EHG------APLKHGKT-GIYFGMKSPIMQTEDGQIEESYSISAGLDFPSVGPQ
TRPB_HISS2       IHTG--KHG------APLRHGSI-GIYFGMKSPIMQTQDGQIEESYSISAGLDFPSVGPE
TRPB_ACTP2       IETG--EHG------APLKHGTT-GIYFGMKSPIMQTKDGQIEESYSISAGLDFPSVGPQ
TRPB_PASMU       IATG--QHG------APLGHGTT-GIYFGMKAPLMQTPDGQIEESYSISAGLDFPSVGPQ
TRPB_MANSM       IETG--EHG------APLGHGKP-GIYFGMKSPIMQTEDGQIEESYSISAGLDFPSVGPQ
TRPB_BUCAP       IETG--KHG------APLNHGRT-GIYFGMKSHLMQSQEGQIEKSWSISAGLDFPSVGPE
TRPB_BUCAI       IHTG--KHG------APLKHGRT-GIYFGMKSHLMQNKQGQIQESWSISAGLDFPSVGPE
TRPB_BUCDN       IKTG--QHG------APLKHGRT-GIFFGMKSHLMQDQEGQIQESWSISAGLDFPSVGPE
TRPB_BUCMH       IHTN--KHG------APLTHGET-GIFFGMKTKIMQTEEGQIKESWSISAGLDFPAVGPE
TRPB_BUCSC       IHTE--KHG------ASLICGET-GIFFGMKSKVMQTHEGQIKESWSISAGLDFPAVGPE
TRPB_BUCBP       IKTG--KHG------APMQHGST-GIYFGMKAPVMQTSEGQIKESWSISAGLDFPAVGPE
TRPB_BLOPB       INTE--YHG------AALQHGSI-GIYFGMKTSILQSSEGQVKNSYSVSAGLDFPSVGPE
TRPB_BLOFL       LHTE--YHG------SSLQCGET-GIYFGMKSPILQSQEGQIKNSYSIAAGLDFPSVGPE
TRPB1_VIBPA      IDTD--QHG------APLKHGKT-GIFFGMKAPLMQDENGQVEESYSVSAGLDFPSVGPQ
TRPB_VIBCB       IDTD--QHG------APLKHGKT-GIFFGMKAPLMQDPNGQVEESYSVSAGLDFPSVGPQ
TRPB_VIBVU       IDTD--QHG------APLKHGKT-GIFFGMKAPLMQDENGQVEESYSVSAGLDFPSVGPQ
TRPB_VIBVY       IDTD--QHG------APLKHGKT-GIFFGMKAPLMQDENGQVEESYSVSAGLDFPSVGPQ
TRPB_ALIF1       IDTD--QHG------APLKHGKT-GIFFGMKAPLMQDEHGQIEESYSVSAGLDFPSVGPQ
TRPB_VIBC3       IHTH--QHG------APLKHGKT-GIFFGMKAPLMQDEHGQVEESYSVSAGLDFPSVGPQ
TRPB_VIBCH       IHTH--QHG------APLKHGKT-GIFFGMKAPLMQDEHGQVEESYSVSAGLDFPSVGPQ
TRPB_VIBME       IDTH--QHG------APLKHGKT-GIFFGMKAPLMQDSYGQVEESYSVSAGLDFPSVGPQ
TRPB_PHOPR       LDTK--MHG------APLKHGKL-GIFFGMKAPLMQDEHGQVEESYSVSAGLDFPSVGPQ
TRPB_FRAT1       IETG--EHG------APLKHGKT-GIFFGMKAPLMQNSDGQIEESYSISAGLDFPSVGPQ
TRPB_FRATT       IETG--EHG------APLKHGKT-GIFFGMKAPLMQNSDGQIEESYSISAGLDFPSVGPQ
TRPB_FRATH       IETG--EHG------APLKHGKT-GIFFGMKAPLMQNSDGQIEESYSISAGLDFPSVGPQ
TRPB_FRATF       IETG--EHG------APLKHGKT-GIFFGMKAPLMQNSDGQIEESYSISAGLDFPSVGPQ
TRPB_FRATO       IETG--EHG------APLKHGKT-GIFFGMKAPLMQNSDGQIEESYSISAGLDFPSVGPQ
TRPB_FRATW       IETG--EHG------APLKHGKT-GIFFGMKAPLMQNSDGQIEESYSISAGLDFPSVGPQ
TRPB_FRATN       IETG--EHG------APLKHGKT-GIFFGMKAPLMQNSDGQIEESYSISAGLDFPSVGPQ
TRPB_FRAP2       IETG--EHG------APLKHGKT-GIFFGMKAPLMQNSDGQIEESYSISAGLDFPSVGPQ
TRPB_AERHH       IESG--EHG------APLGHGSK-GVFFGMHSYLMQDTQGQIQESYSVSAGLDFPSVGPQ
TRPB_AERS4       IESG--EHG------APLGHGSK-GVFFGMHSYLMQDKQGQIQESYSVSAGLDFPSVGPQ
TRPB_PSYIN       IETG--KHG------CPITYGSK-GIFFGMHSLMMQDKHGQVKESYSISAGLDFPSVGPQ
TRPB_SHEPA       IDTP--MHG------APLKHGKT-GIFFGMKAPLMQDSEGQIEESYSVSAGLDFPSVGPQ
TRPB_SHEHH       IDTP--MHG------APLHHGKT-GIFFGMKAPLMQDSEGQVEESYSVSAGLDFPSVGPQ
TRPB_SHELP       IDTP--KHG------APLKHGKT-GIFFGMKAPLMQDKEGQIEESYSISAGLDFPSVGPQ
TRPB_SHESM       IDTH--MHG------APLKHGKT-GIFFGMKAPLMQDSEGQIEESYSISAGLDFPSVGPQ
TRPB_SHESA       IDTH--MHG------APLKHGKT-GIFFGMKAPLMQDSEGQIEESYSISAGLDFPSVGPQ
TRPB_SHESR       IDTH--MHG------APLKHGKT-GIFFGMKAPLMQDSEGQIEESYSISAGLDFPSVGPQ
TRPB_SHEON       IDTH--MHG------APLKHGKT-GIFFGMKAPLMQDSEGQIEESYSISAGLDFPSVGPQ
TRPB_SHEB8       IDTP--MHG------APLKHGKT-GIFFGMKAPLMQDSEGQIEESYSISAGLDFPSVGPQ
TRPB_SHEB5       IDTP--MHG------APLKHGKT-GIFFGMKAPLMQNSEGQIEESYSISAGLDFPSVGPQ
TRPB_SHESW       IDTP--MHG------APLKHGKT-GIFFGMKAPLMQDSEGQIEESYSISAGLDFPSVGPQ
TRPB_SHEPC       IDTP--MHG------APLKHGKT-GIFFGMKAPLMQDSEGQIEESYSISAGLDFPSVGPQ
TRPB_SHEB9       IDTP--MHG------APLKHGKT-GIFFGMKAPLMQDREGQIEESYSISAGLDFPSVGPQ
TRPB_SHEFN       IDTP--MHG------APLKHGKT-GIFFGMKSPLMQNSDGQIEESYSVSAGLDFPSVGPQ
TRPB_SHEDO       IDTP--MHG------APLKHGKT-GIFFGMKAPLMQDRDGQIEESYSVSAGLDFPSVGPQ
TRPB_SHEAM       IDTP--MHG------APLKHGKT-GIFFGMKAPLMQDAHGQIEESYSISAGLDFPSVGPQ
TRPB_PSEA6       LHTA--EHG------AAIGKGTT-GILHGAYSYIMQDEDGQIEESYSVSAGLDYPAVGPQ
TRPB_HELPY       LETN--KHG------ATLNKGRV-GILHGNKTYLLQDDEGQIAESHSISAGLDYPGVGPE
TRPB_HELPJ       LETN--KHG------ATLNKGRV-GILHGNKTYLLQDDEGQIAESHSISAGLDYPGVGPE
TRPB_CORGL       LDSG--KHG------ATITNGQI-GILHGTRSYLMRNSDGQVEESYSISAGLDYPGVGPQ
TRPB_CORGB       LDSG--KHG------ATITNGQI-GILHGTRSYLMRNSDGQVEESYSISAGLDYPGVGPQ
TRPB1_COREF      LDSG--KHG------ATITNGQI-GILHGTRSFLMRSSDGQVEESYSISAGLDYPGVGPQ
TRPB2_COREF      LDTD--LNG------APIHEGRT-MHLHGSNSYALLDEDGNLRNSHSVSAGLDYPGVGPE
TRPB_METJA       IETG--MHG------ASLCAGEV-GVLHGAKIYVKEDEFGQIEESYSISAGLDYPGVGPE
TRPB_METKA       LDTD--EHS------ASLCAGEV-GVLHGCRTKVLQDEHGQIRPTHSIAPGLDYPGVGPE
TRPB1_METTH      IESG--NHG------ATLSAGSE-GILHGSLSYVLQDGDGQISEAHSVSAGLDYPGVGPE
TRPB2_METTM      IESG--NHG------ATLSAGSE-GVLHGSLSYVLQDDDGQINEAHSVSAGLDYPGVGPE
TRPB1_METMA      LRCT--EKA--ALHSASLCAGEE-GILHGARTKVLQDKNGQILESESVSAGLDYSGVGPE
TRPB1_METAC      LKCT--EKA--ALHSASLCIGEE-GILHGARTKILQDKNGQILESESVSAGLDYSGVGPE
TRPB_HALVD       LEVD--EEAGVAPNSASLTTGSE-GILHGARTRLLQDRDGQIMESHSVSSGLDYAGVGPE
TRPB_HALSA       LGVD--DDAGYAPNSASLSTGTE-GVLHGARTKLLQTETGQIVESHSVSAGLDYAGVGPE
TRPB1_THEMA      LETG--KHA------ASLLKGKI-GYLHGSKTFVLQDDWGQVQVTHSVSAGLDYSGVGPE
TRPB_METVO       LNTS--LHG------ASITKGEK-GVLHGMLSYFLQDEDGQIEEAYSISAGLDYPGIGPE
TRPB_META3       LDTD--RHG------AAILKGKK-GVLHGMLSKFLQDDDGQIAETYSISAGLDYPGVGPE
TRPB1_PYRFU      LESG--KHS------ASLNAGQV-GVFHGMLSYFLQDEEGQIKPTHSIAPGLDYPGVGPE
TRPB1_PYRAB      IESG--KHS------ASLNAGEI-GVFHGMLSYFLQDEEGQIRTTHSIAPGLDYPGVGPE
TRPB1_THEKO      LETG--LHA------ASLNAGEL-GVFHGMLSYFLQNEEGQITPTHSVSAGLDYPGVGPE
TRPB1_ARCFU      IESG--RHS------ASLTAGSK-GVLHGMLSYFLQDEEGMMLDTHSVSAGLDYPGVGPE
TRPB2_CHLCV      IESG--HHA------ARFATGRP-GVLHGFYSYLLQDNEGQVLPTHSISAGLDYPAVGPD
TRPB1_CHLCV      VESG--KHA------ARFATGKP-GVVHGFHSYVLQDEDGNCADTYSISAGLDYVSVGPT
TRPB2_WOLSU      IESH--HHG------ASLAKGSP-GILHGQMSYLLQDSEGQIEEAYSISAGLDYPGIGPE
TRPB_BACTN       IETG--MTA------ATIQLGKM-GIIHGARTYVIQNEDGQIEEPYSISAGLDYPGIGPI
TRPB_HELHP       DKEG--ENAI-----RINTINASEGIAQGYKSLFLQDKDGQLSDTHSISAGLDYAGIGPQ
TRPB2_AQUAE      TLTK-----------GEYKYDFG-DSVGLTPLIKMYTLGHDFVPSPIHAGGLRYHGDAPL
TRPB2_ARCFU      TLTA-----------GEYKYDFG-DVAGLTPLLKMYTLGHDFIPPPIHAGGLRYHGDAPT
TRPB2_METMA      SLTK-----------GEYRYDFG-DTAEMTPLLKMYTLGHKHIPPAIHAGGLRYHGDSPI
TRPB2_METAC      SLTK-----------GEYRYDFG-DTAEMTPLLKMYTLGHKHVPPAIHAGGLRYHGDSPI
TRPB2_THEMA      SLTK-----------GNYDYDFG-DTAGLTPLLKMYTLGKDFIPPKIHAGGLRYHGSAPI
TRPB2_METTH      TLTA-----------GEYRYDFG-DTAGMTPLLKMYTLGHDFVPPSVHAGGLRYHGMSPQ
TRPB2_PYRAB      TMTR-----------GVYTYDYG-DSAGLTPKLKMHTLGHRYYVPPIHAGGLRYHGLAPT
TRPB2_PYRFU      SMTR-----------GVYTYDFG-DSGELTPKLKMHTLGHRYHVPPIHAGGLRYHGVAPT
TRPB_PYRHO       TMTK-----------GVYTYDYG-DSAGLTPKIKMYTLGHTYYVPPIHAGGLRYHGLAPT
TRPB2_THEKO      SMTR-----------GVYKYDYG-DSGGYTPKMKMHTLGHTYYVPPIHAGGLRYHGLAPT
TRPB2_AERPE      SMTR-----------GVYTYDYG-DTAGLTPLLKMHTLGHTYQVPPIHAGGLRYHGVAPT
TRPB1_SACS2      KFSK-----------GEYKYDFP-DSAGLLPLVKMITLGKDYVPPPIYAGGLRYHGVAPT
TRPB1_SULTO      KFST-----------GKYEYDYP-DTAGLLPLVKMITLGKDYVPPPIYAGGLRYHGVAPT
TRPB_PICTO       KFSQ-----------GEYKYDLM-DTAGVLPAVRMYSLGADFVPPKIYAGGLRYHGAAPS
TRPB2_SACS2      KMTK-----------GVYKYDYP-DTAKLLPMLKMYTIGSDFVPPPVYAGGLRYHGVAPT
TRPB2_SULTO      KMTK-----------GVYKYDYP-DTAKILPMLKMYTIGSDFIPAPVYAGGLRYHAVAPT
TRPB_THEAC       KMTE-----------GEYRYDYP-DTGKVLPLLKMYTIGYDFIPPAVYAGGLRYHAVAPT
TRPB_THEVO       KMTE-----------GEYRYDYP-DTGKVLPLLKMYTIGYDFIPPAVYAGGLRYHAVAPT
TRPB1_AERPE      KLTR-----------GEYRYDGL-DSSLILPLAKMYTLGHRYTPPPSHAAGLRYHGVSPS
TRPB_PYRAE       KLTR-----------GEYKYDFP-DAVGVLPMLKMYTLGHDYVPPAIHAAGLRYHGAAPS
                                                                 : ** : . .* 

TRPB1_WOLSU      HAYLHEIGRTHSVGVSDEEAIK-NFFALSRLEGIIPAIESAHAIAYGMKLAKE-------
TRPB2_VIBPA      HSYLKDIGRVNYGSINDDEAID-AFFELSREEGIIPAIESSHAVAYAIKLAQQ-------
TRPB_CALS4       HAYLKEIGRAEYVYATDEEALA-AFMDLSRTEGIIPALESAHALAYAMKLAKKLD-----
TRPB_CLOAB       HSYLKEKERASYEAVTDKEALK-AFLYLSEKEGIIPALESSHAVAYAMKLAPSLS-----
TRPB_CLOB8       HAYLAETNRAEYESITDEEAVRDGFMYLTRIEGIVPALESSHAVAYAKKLAQTLS-----
TRPB_FUSNN       HAFLRDSKRAEYVSATDDEAVN-ALLLLTKKEGIIPAIESSHALAEVIKRAPKLN-----
TRPB_CLONN       HAYLNDIGRAKYVSITDEEAVE-AFKYLCANEGIIPALESSHAIAYTMKLAPNMD-----
TRPB_LACP3       HAALAQEGRAQYVGITDDEAVE-AFTYIAKQEGIVAAIESCHAIAYVEKIAPQMA-----
TRPB_LACCA       HAALAQEGRAQYVGITDDEAVE-AFTYIAKQEGIVAAIESCHAIAYVEKIAPQMA-----
TRPB_LACPL       HAYLAASGRAQYVGINDDQAVQ-AFELIAKVEGVICAIESAHAVAYVQQLAPTMR-----
TRPB_CAMJR       HAFLFESKRAQYHAISDEECMQ-ALKLLCKEEGIIAAIESSHALAFLEKLCPTLK-----
TRPB_CAMJE       HAFLFESKRAQYHAISDEECMQ-ALKLLCKEEGIIAAIESSHALAFLEKLCPTLK-----
TRPB_CAMJ8       HAFLFESKRAQYHAISDEECMQ-ALKLLCKEEGIIAAIESSHALAFLEKLCPTLK-----
TRPB_CAMJJ       HAFLFESKRAQYHAISDEECMQ-ALKLLCKEEGIIAAIESSHALAFLEKLCPTLK-----
TRPB_CAMJD       HAFLFESKRAQYHAISDEECMQ-ALKLLCKEEGIIAAIESSHALAFLEKLCPTLK-----
TRPB_THET2       HSYYADAGVAEYASVTDEEALE-GFKLLARLEGIIPALESAHAIAYAAKVVPE-------
TRPB_THET8       HSYYADAGVAEYASVTDEEALE-GFKLLARLEGIIPALESAHAIAYAAKVVPE-------
TRPB_DEIRA       HCYYSVMGMAEYVPVTDAQALE-GLQLLTRLEGIIPALESAHAISYAVQLARQ-------
TRPB_CHLTE       HCYLQKLGLVCYTSTTDKEALA-ALDALAKTEGIICALESAHAVHYAMKRAAE-------
TRPB1_AQUAE      HALFHEIKRAKYTTATDEEALE-GFKLLARTEGIIPALESAHAVIKAVEVARE-------
TRPB_BRASB       HSWLFEAKRVTYLSATDDEALA-AFQLLSRLEGIIPALEPAHAIAKVMELAPK-------
TRPB_BRASO       HSWLHEAKRVTYLSATDDEALD-AFLLLSRLEGIIPALEPAHAVAKVMQLAPN-------
TRPB_BRADU       HSWLHEIGRVNYLSATDDEALA-AFQLLSKLEGIIPALEPAHAIAKVMELAPK-------
TRPB_PARL1       HAWLHETGRAEYVSATDREALA-AFQLCSKLEGIIPALEPAHALAFVTKIASA-------
TRPB_CAUVC       HSFLHDIGRAEYVSTTDTEALE-AFKLCSTLEGIIPALEPAHALARVGEIAQE-------
TRPB_ACICJ       HSYLHDIGRVEYVSATDDEALA-AFQLCCRTEGIIPALEPSHALAHVAKIAPG-------
TRPB_NOVAD       HAWLKEIGRVDYTSVTDTEALD-AFQLLCRTEGIIPALEPAHAIAAVKKVAPT-------
TRPB_RHOS4       HAWLHDTGRAEYVSITDAEALE-AFQLCCALEGIIPALEPSHALAHVIKIAPT-------
TRPB_RUEST       HAWLHETGRAQYVSITDKEALE-AFQLSCAMEGIIPALEPSHALAHVTKIAPE-------
TRPB_RUEPO       HSWLHEVGRAKYVSITDMEALE-AFKLCCATEGIIPALEPSHALAHVMKLAPE-------
TRPB_DINSH       HAWLHDIGRAKYVSITDAEALD-AFQLCCETEGIIPALEPSHALAHVAKIAPD-------
TRPB_ROSDO       HAWLHDIGRAQYVSITDVEALE-AFQLCCELEGIIPALEPSHALAHVMKIAPD-------
TRPB_JANSC       HAWLHEIGRAQYVSITDREALD-AFQLSCETEGIIPALEPSHALAHVCKIAPD-------
TRPB_PARDP       HAWLKEQGRAEYVSVTDDEALA-AFQTLCRLEGIIPALEPSHALAHVVKIAPD-------
TRPB_BRUSU       HSWLKDSGRVDYVPILDNEALD-AFQLCTRTEGIIPALESAHAIAQAVKMAPT-------
TRPB_BRUC2       HSWLKDSGRVDYVPILDNEALD-AFQLCTRTEGIIPALESAHAIAQAVKMAPT-------
TRPB_BRUSI       HSWLKDSGRVDYVPILDNEALD-AFQLCTRTEGIIPALESAHAIAQAVKMAPT-------
TRPB_BRUAB       HSWLKDSGRVDYVPILDNEALD-AFQLCTRTEGIIPALESAHAIAQAVKMAPT-------
TRPB_BRUA2       HSWLKDSGRVDYVPILDNEALD-AFQLCTRTEGIIPALESAHAIAQAVKMAPT-------
TRPB_BRUME       HSWLKDSGRVDYVPILDNEALD-AFQLCTRTEGIIPALESAHAIAQAVKMAPT-------
TRPB_OCHA4       HSWLKDSGRVDYVPILDDEALD-AFQLCTRTEGIIPALESAHAIAQAVKMAPT-------
TRPB_RHILO       HSWLRDSGRVEYVPILDDEALE-AFKLTTRVEGIIPALESAHAIAHAVKIVPA-------
TRPB_RHIEC       HSWLSDIGRVDYVPIMDHEALE-AFQTLTRLEGIIPALEAAHAIAEVIKRAPKMG-----
TRPB_RHIL3       HSWLNDTGRVDYVPIMDHEALE-AFQTLTRLEGIIPALEPSHAIAEVIKRAPT-------
TRPB_SINMW       HAWLNDIGRVEYVPIMDHEALE-AFQILTRLEGIIPALEPSHALAEVIKRAPK-------
TRPB_RHIME       HAWLNDIGRVEYVPIMDHEALE-AFQTLTRLEGIIPALEPSHALAEVIKRAPK-------
TRPB_AGRFC       HSWLNDIGRVEYVPIMDHEALD-AFQMLTRLEGIIPALEPSHALAEVIKRAPK-------
TRPB_CHESB       HSWLKEAGRVEYVPIMDHEALE-AFQLLTRLEGIIPALEPSHALAEVIKRAPK-------
TRPB_PSEPF       HAWLHDIGRVQYTSVTDDEALA-AFHQCCRLEGIIPALESAHALAEVFKRAPK-------
TRPB_PSESY       HAWLHDIGRVQYTSVTDDEALD-AFHKCCRLEGIIPALESAHALAEVFKRAPT-------
TRPB_PSEF5       HAWLHDIGRVEYTSVTDDEALA-AFHQCCRLEGIIPALESAHALAEVFKRAPN-------
TRPB_PSEAE       HAWLHDTGRVEYTSITDDEALE-AFHTCCRLEGIIPALESSHALAEVFKRAPS-------
TRPB_PSESH       HAFLHEVKRVEYVSITDDEALD-AFHQCCLLEGIIPALETAHALAEAMKRATN-------
TRPB_PSE14       HAFLHEVKRVEYVSITDDEALD-AFHQCCLLEGIIPALETAHALAEAMKRATN-------
TRPB_PSEU2       HAFLHEVKRVEYVSITDDEALD-AFHQCCLLEGIIPALETAHALAEAMKRATN-------
TRPB_PSESM       HAYLHEVKRVEYVSITDEEALD-AFHQCCLLEGIIPALETAHALAEAMKRATN-------
TRPB_PSEPU       HAYLHEVKRVEYVSITDDEALD-AFHATCRLEGIIPALESSHALAEAIKRAPK-------
TRPB_PSEPG       HAYLHEVKRVEYVSITDDEALD-AFHATCRLEGIIPALESSHALAEAIKRAPK-------
TRPB_PSEPK       HAYLHEVKRVEYVSITDDEALD-AFHATCRLEGIIPALESSHALAEAIKRAPK-------
TRPB_PSEP1       HAYLHEVKRVEYVSITDDEALD-AFHATCRLEGIIPALESSHALAEAIKRAPK-------
TRPB_PSEE4       HAYLHEVKRVEYVSITDDEALD-AFHATCRLEGIIPALESSHALAEAIKRAPK-------
TRPB_ACICA       HSFLKDMHRVEYVPIDDNEALQ-GFRDLTRIEGIIPAIESAHAMAYVTKLAPT-------
TRPB_ACIAD       HSFLKDMHRVEYVPIDDNEALQ-GFRDLTRIEGIIPAIESAHAMAYVTKLAPT-------
TRPB_LEGPA       HAYLKDTGRVIYKAINDSEALD-AFRLLTHTEGIIPALESSHAVAYAIQLAKT-------
TRPB_LEGPL       HAYLKDTGRVIYKAINDSEALD-AFRLLTHTEGIIPALESSHAVAYAIQLAKT-------
TRPB_LEGPH       HAYLKDTGRVIYKAINDSEAMD-AFRLLTHTEGIIPALESSHAVAYAIQLAKT-------
TRPB_LEGPC       HAYLKDTGRVIYKAINDSEALD-AFRLLTHTEGIIPALESSHAVAYAIQLAKT-------
TRPB_BORBR       HAWLKDSGRAEYAGITDDEALA-AFHDCCRIEGIMPALESAHAIAQAVKMAPA-------
TRPB_BORPA       HAWLKDSGRAEYAGITDDEALA-AFHDCCRIEGIMPALESAHAIAQAVKMAPA-------
TRPB_BORPE       HAWLKDSGRAEYAGITDDEALA-AFHDCCRIEGIMPALESAHAIAQAVKMTPA-------
TRPB_RALSO       HAWLKDAGRAQYVGITDKEALQ-AFHDLCRMEGIIPALESSHALAYACKLAPT-------
TRPB_POLNA       HAYLKDIGRAEYVGITDTEALQ-AFHYLCRTEGIIPALESAHAVAYAMKLAKT-------
TRPB_POLSJ       HAFLKDIGRAEYVGITDTEALE-AFHYLCRTEGIIAALESSHAVAYAMKLAKT-------
TRPB_ACIAC       HAWLQEIGRAEYVGITDREALD-AFHYLCRTEGIIPALESSHAVAYAMQLART-------
TRPB_METPP       HAYLKDIGRAEYVGITDDEALQ-AFHRLCRTEGIIPALESSHAVAYAMKLAPT-------
TRPB_METFK       HAWLKDIKRAEYVAVTDDEAME-AFHTLCRTEGIIPALESSHALAYAMKLAET-------
TRPB_NITEU       HAWLKDCGRAEYVAVTDDEALA-AFHALCRFEGIIPALESSHALAYAAKLAPT-------
TRPB_NITEC       HAWLKDCGRAEYVAITDGEALA-AFHALCRFEGIMPALESSHALAYAAKLAPT-------
TRPB_NITMU       HAWLKDSGRAEYFGITDEQALE-AFHALCHYEGIIPALESSHALAYAARLAPA-------
TRPB_METCA       HAWLKDCGRASYVSATDAEALE-AFHILTRSEGIIPALESSHAVAYALKLAPT-------
TRPB_XANAC       HSFLSDSGRAVYQGITDDEAMA-AFHLLAHTEGILAALESSHAVAQSIKLARE-------
TRPB_XANC5       HSFLSDSGRAVYQGITDDEAMA-AFHLLAHTEGILAALESSHAVAQSIKLARE-------
TRPB_XANOM       HAFLSDSGRAVYQGITDDEAMA-AFHLLAHTEGILAALESSHAVAQSIKLARE-------
TRPB_XANCP       HAFLSDSGRAVYQGITDDEALA-AFHLLAHTEGILAALESSHAVAQSIKLARE-------
TRPB_XANC8       HAFLSDSGRAVYQGITDDEALA-AFHLLAHTEGILAALESSHAVAQSIKLARE-------
TRPB_XYLFA       HAFLADSGRVQYVGIRDEEALA-AFHLLAHTEGILAALESSHAVAHAMTLARD-------
TRPB_XYLFT       HAFLADSGRVQYVGIRDEEALA-AFHLLAHTEGILAALESSHAVAHTMTLARD-------
TRPB_VESOH       HAYLKDSGRAQYMAITDKEALE-AFHILTKIEGILPALESSHAVAYGIKLAKK-------
TRPB_RUTMC       HAYLKDSGRARYVAITDKEALE-AFHVLTKVEGILPALESSHAVAYGIKLAKE-------
TRPB_NEIG1       HSHLHDIKRVEYTVAKDDEALE-AFDLLCRFEGIIPALESSHAVAWAVKNAPK-------
TRPB_NEIGO       HSHLHDIKRVEYTVAKDDEALE-AFDLLCRFEGIIPALESSHVVGSGDKTRRK-------
TRPB_NEIMF       HSHLHDIKRVEYTVAKDDEALE-AFDLLCRFEGIIPALESSHAVAWAVKNAPK-------
TRPB_NEIMA       HSHLHDIKRVEYTVAKDDEALE-AFDLLCRFEGIIPALESSHAVAWAVKNAPK-------
TRPB_NEIMB       HSHLHDIKRVEYTVAKDDEALE-AFDLLCRFEGIIPALESSHAVAWAVKNAPK-------
TRPB_NEIM0       HSHLHDIKRVEYTVAKDDEALE-AFDLLCRFEGIIPALESSHAVAWAVKNAPK-------
TRPB_CHRVO       HCHLKDIGRAEYVSIDDDEALR-AFHDCCHLEGIIPALESSHALAWAAKVAPS-------
TRPB_RHOBA       HSYWKDTKRVDYIDCRDDEALT-AFERLASSEGILAALETSHAVAKAIEIAGK-------
TRPB_GEOSE       HAYLASIGRVRYESVTDEEAVA-AFRLLAQTEGIIPAIESAHAVAKAVELAQS-------
TRPB_GEOTN       HAYLASIGRVRYESVTDEEAVA-AFQLLAQTEGIIPAIESAHAVAKAVELARQ-------
TRPB_BACVZ       HAYLHKSGRVTYESVTDDEAIA-ALRLLSETEGILPAIESAHALAKAFEMAKD-------
TRPB_BACSU       HAYLHKSGRVTYDSITDEEAVD-ALKLLSEKEGILPAIESAHALAKAFKLAKG-------
TRPB_BACLD       HAHLHQTGRVTYESVTDDEAVS-ALRLLTETEGILPAIESAHALAKAFEIAKE-------
TRPB_BACP2       HAYLHASGRVQYVSATDQEALD-ALKLLTEKEGILPAIESAHALAKAFEMSRT-------
TRPB_BACHD       HAYLASTGRVKYDAVTDKEALD-ALKQLSVHEGIIPAVESAHALAKAFERAKQ-------
TRPB_BACSK       HAYLAAQKRVRYEAVTDKEALD-ALALLAKEEGIIPAIESAHALAKAFQMAKT-------
TRPB_BACAN       HSLLKDIGRVSYHSITDDEALE-AFQLLTKKEGIIPALESSHAVAYALKLAPQ-------
TRPB_BACHK       HSLLKDIGRVSYHSITDDEALE-AFQLLTKKEGIIPALESSHAVAYALKLAPQ-------
TRPB_BACAH       HSLLKDIGRVSYHSITDDEALE-AFQLLTKKEGIIPALESSHAVAYALKLAPQ-------
TRPB_BACCZ       HSLLKDIGRVSYHSITDDEALE-AFQLLTKKEGIIPALESSHAVAYALKLAPK-------
TRPB_BACCR       HSLLKDIGRVSYHSITDEEALE-AFQLLTKKEGIIPALESSHAVAYALKLAPQ-------
TRPB_BACC1       HSLLKDIGRVSYHSITDDEALE-AFQLLTKKEGIIPALESSHAVAYALKLAAQ-------
TRPB_OCEIH       HSHLHQTKRVTYSSITDEEALE-AFQLLSKTEGIIPALESAHAVSYATKLAKE-------
TRPB_LACLS       HSYFNAVGRAKYVDITDEEALE-GFKILSRTEGIIPALESSHAIAYAVKLAKE-------
TRPB_LACLM       HSYFNAVGRAKYVDITDEEALE-GFKILSRTEGIIPALESSHAIAYAVKLAKE-------
TRPB_LACLA       HSYFNAVGRAKYVDITDEEALE-GFKILSRTEGIIPALESSHAIAYAVKLAKE-------
TRPB_STRR6       HSHYHDIKRASYVPVTDEEALE-GFQLLSRVEGIIPALESSHAIAFAVKLAKE-------
TRPB_STRP2       HSHYHDIKRASYVPVTDEEALE-GFQLLSRVEGIIPALESSHAIAFAVKLAKE-------
TRPB_STRPN       HSHYHDIKRASYVPVTDEEALE-GFQLLSRVEGIIPALESSHAIAFAVKLAKE-------
TRPB_STRT2       HCYFNEIGRATYDSITDEEALE-GFKLLSRLEGIIPALESSHAIALAQKVAAK-------
TRPB_STRT1       HCYFNEIGRATYDSITDEEALE-GFKLLSCLEGIIPALESSHAIALAQKVAAK-------
TRPB_STRTD       HCYFNEIGRATYDSITDEEALE-GFKLLSRLEGIIPALESSHAIALAQKVAAK-------
TRPB_STRMU       HCYFNEIGRATYDSITDEEALE-SFKLLSRLEGIIPALESSHAIALTQKVAKE-------
TRPB_LISMF       HSFFRDLGRAAYHSVTDDEAVE-AFQLLCRTEGIIPALESSHAISYAVKLASQ-------
TRPB_LISMO       HSFFRDLGRAAYHSVTDDEAVE-AFQLLCRTEGIIPALESSHAISYAVKLASK-------
TRPB_LISIN       HSFFRDLGRAEYHSVTDDEAVE-AFQLLCRTEGIIPALESSHAISYAVKLASQ-------
TRPB_LISW6       HSFFRDLGRAEYHSVTDDEAVE-AFQLLCRTEGIIPALESSHAISYAVKLASK-------
TRPB_STAAN       HSYYHDIGRVTFENASDTQAMN-ALINFTKHEGIIPAIESAHALSYVERLAPT-------
TRPB_STAA1       HSYYHDIGRVTFENASDTQAMN-ALINFTKHEGIIPAIESAHALSYVERLAPT-------
TRPB_STAAM       HSYYHDIGRVTFENASDTQAMN-ALINFTKHEGIIPAIESAHALSYVERLAPT-------
TRPB_STAA9       HSYYHDIGRVTFENASDTQAMN-ALINFTKHEGIIPAIESAHALSYVERLAPT-------
TRPB_STAA2       HSYYHDIGRVTFENASDTQAMN-ALINFTKHEGIIPAIESAHALSYVERLAPT-------
TRPB_STAAR       HSYYHDIGRVTFENASDTQAMN-ALINFTKHEGIIPAIESAHALSYVERLAPT-------
TRPB_STAAB       HSYYHDIGRVTFENASDTQAMN-ALINFTKHEGTIPAIESAHALSYVERLAPT-------
TRPB_STAAE       HSYYHDIGRVTFENASDTQAMN-ALINFTKHEGIIPAIESAHALSYVERLAPT-------
TRPB_STAA8       HSYYHDIGRVTFENASDTQAMN-ALINFTKHEGIIPAIESAHALSYVERLAPT-------
TRPB_STAA3       HSYYHDIGRVTFENASDTQAMN-ALINFTKHEGIIPAIESAHALSYVERLAPT-------
TRPB_STAAW       HSYYHDIGRVTFENASDTQAMN-ALINFTKHEGIIPAIESAHALSYVERLAPT-------
TRPB_STAAT       HSYYHDIGRVTFENASDTQAMN-ALINFTKHEGIIPAIESAHALSYVERLAPT-------
TRPB_STAAC       HSYYHDIGRVTFENASDTQAMN-ALINFTKHEGIIPAIESAHALSYVERLAPT-------
TRPB_STAAS       HSYYHDIGRVTFENASDTQAMN-ALINFTKHEGIIPAIESAHALSYVERLAPT-------
TRPB_STAS1       HSYYHDIGRVKYATASDKQAMD-ALVRFTKAEGIIPAIESAHALSYVETLAPT-------
TRPB_STAEQ       HSYYNDIGRVSYVSATDNEAME-ALITFSKVEGIIPAIESAHALSYVEKLAPN-------
TRPB_STAES       HSYYNDIGRVSYVSATDNEAME-ALITFSKVEGIIPAIESAHALSYVEKLAPN-------
TRPB_LEPIC       HAYFHKSGRVEYVNVDDEGALD-AFIEVCRIEGIIPALETAHAFRYAKDLART-------
TRPB_LEPIN       HAYFHKSGRVEYVNVDDEGALD-AFIEVCRIEGIIPALETAHAFRYAKDLART-------
TRPB_LEPBJ       HAYFHKSGRVTYVNVDDDGALD-AFLEICQIEGIIPALETAHAFRFAKDLAKS-------
TRPB_LEPBL       HAYFHKSGRVTYVNVDDDGALD-AFLEICQIEGIIPALETAHAFRFAKDLAKS-------
TRPB2_NOSS1      HSYLKDVGRAEYYSVTDEEALA-AFQRLSRLEGIIPALETAHAIAYLETLCPQ-------
TRPB_TRIV2       HSYLKDVGRAEYYSVTDEQALA-AFQRLSRLEGIIPALETAHAIAYLETLCPQ-------
TRPB1_NOSS1      HSYLKDIRRAEYYSVTDKQALD-GFQQLSRLEGIIPALETSHAIAYLETLCPQ-------
TRPB_TRIEI       HSFLKDSGRVEYYSVTDNEAVA-AFQRLSQLEGIIPALETAHAIAYLETLCPQ-------
TRPB_THEEB       HSYLKDIGRAEYYSVTDTEAVA-ACVRLAQLEGILPALETAHALAYLETLCPQ-------
TRPB_SYNY3       HSYLKDAGRAEYYSVTDQEAIT-ALQRLSQLEGIIPALETAHAFAYLETLCPQ-------
TRPB_SYNJB       HSYLKEIGRAEYYAVTDDEAVE-ALLLLSRLEGIIPALETAHALAYLKTLAPQQGLRPAN
TRPB_GLOVI       HSYLKDIGRAEYYSVTDSEALA-ALSLVCSTEGIIPALETAHAFAYLGILASQ-------
TRPB_PROM1       HSYLKEIGRAEYAAVTDTEAIE-ALQLVSKLEGIIPALETAHAFAYLEKLCPT-------
TRPB_PROMT       HSYLKEIGRAEYAAVTDTEAIE-ALQLVSKLEGIIPALETAHAFAYLEKLCPT-------
TRPB_PROMA       HSYLKEIGRAEYAAVTDQEALS-ALQLLSEKEGIIPALETAHALAFLEKLCPT-------
TRPB_SYNPW       HSYLREIGRAEYGAVTDAEALE-ALQLVSRLEGIIPALETAHAFAWLETLCPT-------
TRPB_PROMM       HSYLCEIGRAEYAAVSDQQALD-ALRLVSELEGIIPALETAHAFAWLETLCPT-------
TRPB_SYNSC       HSYLREIGRAEYAAVTDQQALD-ALRLVSELEGIIPALETAHAFAWLEQLCPT-------
TRPB_SYNPX       HSYLREIGRAEYGAVTDQQALG-ALRLVSELEGIIPALETAHAFAWLEQLCPT-------
TRPB_SYNS9       HSYLKEIGRAEYAAVTDEQALD-GLRLVSELEGIIPALETAHAFAWLEQLCPT-------
TRPB_SYNS3       HSYLRDIGRAEYGAVTDDEAIT-ALRLVSELEGIIPALETAHAFAWLEMLCPT-------
TRPB_PROMP       HSYLKDIGRAEYGSVTDAEALD-ALKLVSELEGIIPALETAHAFAWLEKLCPT-------
TRPB_PROM5       HSYLKDIGRAEYGSVTDTEALN-ALKLVSELEGIIPALETAHAFAWLEKLCPT-------
TRPB_PROMS       HSHLKDIGRAEYGSVTDQEALD-ALKLVSELEGIIPALETAHAFAWLDKLCPT-------
TRPB_PROM0       HSHLKEIGRAEYGSVTDQEALD-ALKLVSELEGIIPALETSHAFAWLDKLCPT-------
TRPB_PROM9       HSHLKDIGRAEYGSVTDQEALD-ALRLVSELEGIIPALETSHAFAWLDKLCPT-------
TRPB_PROM2       HSHLKDIGRAEYGSVTDQEALD-SLRLVSELEGIIPALETSHAFAWLDKLCPT-------
TRPB_MYCTU       HAWLKEAGRVDYRPITDSEAMD-AFGLLCRMEGIIPAIESAHAVAGALKLGVE-------
TRPB_MYCBO       HAWLKEAGRVDYRPITDSEAMD-AFGLLCRMEGIIPAIESAHAVAGALKLGVE-------
TRPB_MYCLE       HAWLRETGRAEYQPITDSEAIE-AFRLLCRTEGILPALESAHAVAGALKLASE-------
TRPB_MYCIT       HAWLRERVSTTRGWVRNTRGCA-RFRTLCRTEGIIPAIESAHAVAGALKVAPE-------
TRPB_STRAW       HAYLKDSGRGEYRAVTDDAAMQ-ALRLLSRTEGIIPAIESAHALAGALEIGKE-------
TRPB_STRCO       HAYLKDSGRGEYRAVTDDAAMQ-ALRLLSRTEGIIPAIESAHALAGALEVGRE-------
TRPB_LEIXX       HAWLAAIGRAEYRPVSDAEAME-ALRLLSRTEGIIPAIESAHALAGALDLGRE-------
TRPB_SHIFL       HAYLNSTGRADYVSITDDEALE-AFKTLCLHEGIIPALESSHALAHALKMMRENPDKEQ-
TRPB_ECOLC       HAYLNSTGRADYVSITDDEALE-AFKTLCLHEGIIPALESSHALAHALKMMRENPDKEQ-
TRPB_SHIF8       HAYLNSTGRADYVSITDDEALE-AFKTLCLHEGIIPALESSHALAHALKMMRENPDKEQ-
TRPB_ECOLI       HAYLNSTGRADYVSITDDEALE-AFKTLCLHEGIIPALESSHALAHALKMMRENPDKEQ-
TRPB_ECO24       HAYLNSTGRADYVSITDDEALE-AFKTLCLHEGIIPALESSHALAHALKMMRENPDKEQ-
TRPB_ECOHS       HAYLNSTGRADYVSITDDEALE-AFKTLCLHEGIIPALESSHALAHALKMMRENPDKEQ-
TRPB_SHISS       HAYLNSTGRADYVSITDDEALE-AFKTLCLHEGIIPALESSHALAHALKMMRENPEKEQ-
TRPB_ECO57       HAYLNSTGRADYVSITDDEALE-AFKTLCLHEGIIPALESSHALAHALKMMRENPEKEQ-
TRPB_SHIBS       HAYLNSTGRADYVSITDDEALE-AFKTLCLHEGIIPALESSHALAHALKMMRETPEKEQ-
TRPB_ECOK1       HAYLNSTGRADYVSITDDEALE-AFKTLCLHEGIIPALESSHALAHALKMMRENPEKEQ-
TRPB_ECOUT       HAYLNSTGRADYVSITDDEALE-AFKTLCLHEGIIPALESSHALAHALKMMRENPEKEQ-
TRPB_SHIDS       HAYLNSTGRADYVSITDDEALE-AFKTLCLHEGIIPALESSHALAHALKMMRENPEKEQ-
TRPB_ECOL5       HAYLNSTGRADYVSITDDEALE-AFKTLCLHEGIIPALESSHALAHALKMMRENPEKEQ-
TRPB_ECOL6       HAYLNSTGRADYVSITDDEALE-AFKTLCLHEGIIPALESSHALAHALKMMRENPEKEQ-
TRPB_CITK8       HAYLNSIGRADYVSITDDEALE-AFKTLCLHEGIIPALESSHALAHALKMMRENPEKEQ-
TRPB_SALTY       HAYLNSIGRADYVSITDDEALE-AFKTLCRHEGIIPALESSHALAHALKMMREQPEKEQ-
TRPB_SALPB       HAYLNSIGRADYVSITDDEALE-AFKTLCRHEGIIPALESSHALAHALKMMREQPEKEQ-
TRPB_SALTI       HAYLNSIGRADYVSITDDEALE-AFKTLCRHEGIIPALESSHALAHALKMMREQPEKEQ-
TRPB_SALPA       HAYLNSIGRADYVSITDDEALE-AFKTLCRHEGIIPALESSHALAHALKMMREQPEKEQ-
TRPB_SALCH       HAYLNSIGRADYVSITDDEALE-AFKTLCRHEGIIPALESSHALAHALKMMREQPEKEQ-
TRPB_SALAR       HAHLNSIGRADYVSITDDEALE-AFKTLCRHEGIIPALESSHALAHALKMMREHPEKEQ-
TRPB_CROS8       HAYLNSTGRAEYVSITDDEALE-AFKTLCRQEGIIPALESSHALAHALKMMRAAPEKEQ-
TRPB_KLEP7       HAFLNSTGRADYVSITDDEALD-AFKALSRHEGIIPALESSHALAHALKMMRENPEKEQ-
TRPB_ENT38       HAHLNSIGRAEYVSITDDEALE-AFKTLCRNEGIIPALESSHALAYALKMIKEDPEKEQ-
TRPB_PECAS       HAYLNSIGRADYVSITDDEALD-AFKALCRGEGIIPALESSHALAHALKMIKAEPEKEQ-
TRPB_YERPA       HAYLNSIGRADYVSITDDEALD-AFKTLSCKEGIIPALESSHALAHALKMIKADPDKEQ-
TRPB_YERPS       HAYLNSIGRADYVSITDDEALD-AFKTLSCKEGIIPALESSHALAHALKMIKADPDKEQ-
TRPB_YERPN       HAYLNSIGRADYVSITDDEALD-AFKTLSCKEGIIPALESSHALAHALKMIKADPDKEQ-
TRPB_YERPP       HAYLNSIGRADYVSITDDEALD-AFKTLSCKEGIIPALESSHALAHALKMIKADPDKEQ-
TRPB_YERP3       HAYLNSIGRADYVSITDDEALD-AFKTLSCKEGIIPALESSHALAHALKMIKADPDKEQ-
TRPB_YERPE       HAYLNSIGRADYVSITDDEALD-AFKTLSCKEGIIPALESSHALAHALKMIKADPDKEQ-
TRPB_YERE8       HAYLNSIGRADYVSVTDDEALD-AFKALSCNEGIIPALESSHALAHALKMIKAEPEKEQ-
TRPB_SERP5       HAYLNSIGRAEYVSITDDEALD-AFKALSRSEGIIPALESSHALAHALKMIRETPQKEQ-
TRPB_SODGM       HAYLDSIGRAEYISATDEEALD-AFRRLSRHEGIIPALESSHALAHALRMIQAEPEKEQ-
TRPB_PHOLL       HAYLNSIGRADYVSITDDEALE-AFKTLSREEGIIPALESSHALAYALKMIHQAPDKEQ-
TRPB_HAEIN       HAYLNEIGRADYVSITDEEALN-AFQELAKHEGIIPALESSHALAYALKLIKQNPEKEQ-
TRPB_HAEIE       HAYLNEIGRADYVSITDEEALN-AFQELAKHEGIIPALESSHALAYALKLIKQNPEKEQ-
TRPB_HAEIG       HAYLNEIGRAEYVSITDEEALN-AFQELAKHEGIIPALESSHALAYALKLIKQNPEKEQ-
TRPB_HAEI8       HAYLNEIGRADYVSITDEEALN-AFQELAKHEGIIPALESSHALAYALKLIKQNPEKEQ-
TRPB_ACTSZ       HAYLNSIGRAEYPSITDDEALA-AFKELAKHEGIIPALESSHALAQALKMIKSNPEKEQ-
TRPB_HISS2       HAYLHTIGRAQYESITDDEAIE-AFQALAKHEGIIPALESSHALAYALKLIVQNPEKEQ-
TRPB_ACTP2       HAYLNSIGRAEYVSITDQEALD-AFQALAQHEGIIPALESSHALAYALKLIAQNPDKEQ-
TRPB_PASMU       HAHLQAIGRAQYESITDDEALS-AFQALARHEGIIPALESAHALAYALKLIQRQPEKEQ-
TRPB_MANSM       HAYLNSIGRAEYPSITDDEALE-AFKELAQHEGIIPALESSHALAYALKMARQNPMREQ-
TRPB_BUCAP       HSWLNSIHRAKYVSITDIEALE-AFQILSKKEGIIPALESSHALAYALKLMYLDPKKEQ-
TRPB_BUCAI       HAWLNSINRAKYVSITDEEAIS-AFQVLSRKEGIIPALESSHALAYALKLMKKDPTIEQ-
TRPB_BUCDN       HAWLNSINRAQYVSITDQEALD-TFQLLCKKEGIIPALESSHALAYALKLMNLSPKKEQ-
TRPB_BUCMH       HAWLYSTKRAQYVSITDHEAVN-AFRCLSKSEGIIPALESSHALAYALKLMNNHPQKNQ-
TRPB_BUCSC       HAWLDSIKRVTYVSITDSEAVH-AFQHLSKLEGIIPALESSHALAYAIKLMNNYPNKNQ-
TRPB_BUCBP       HAWLKHIGRATYVSITDCEAIN-AFKILCKLEGIIPALESSHALAYALKLISKDTNKKQ-
TRPB_BLOPB       HVYLKNTGRVQYVSINDIEAIT-AFKKLSIHEGIIPALESAHALAHALKIIQKQPDKAQ-
TRPB_BLOFL       HAYLKKINRVKYVSINDEEAIN-AFQELSLYEGIIPALESAHALAHALKIIRKTPKKKQ-
TRPB1_VIBPA      HAHLNAIGRAEYDNVTDDEALE-AFQELARSEGIIPALESSHALAHALRMARENPEKEQ-
TRPB_VIBCB       HAHLNAIGRAEYDNVTDDEALE-AFQEIARHEGIIPALESSHAVAHALRMARENPEKEQ-
TRPB_VIBVU       HAHLNAIGRAEYDSITDDEALD-AFQELARSEGIIPALESSHALAHALKMARNNPEKEQ-
TRPB_VIBVY       HAHLNAIGRAEYDSITDDEALD-AFQELARSEGIIPALESSHALAHALKMARNNPEKEQ-
TRPB_ALIF1       HAHLNAIGRAEYGAVTDDEALD-AFKILARNEGIIPALESSHALAYALQLAQAEPEKEQ-
TRPB_VIBC3       HAYLNAIGRAEYESITDDEALD-AFQALARNEGIIPALESSHALAHAIKMAYAEPDKEQ-
TRPB_VIBCH       HAYLNAIGRAEYESITDDEALD-AFQALARNEGIIPALESSHALAHAIKMAYAEPDKEQ-
TRPB_VIBME       HAHLNAIGRANYESITDDEALE-AFQSIARNEGIIAALESSHALAYAIKMARIDPDKEQ-
TRPB_PHOPR       HAHLNAIGRAEYGSVTDDEALD-AFQLLARKEGIIPALESAHALAYALKMIEAEPEKEQ-
TRPB_FRAT1       HAHLLAIGRAKYASATDDEALD-AFKLLCKKEGIIPALESSHALAHALKLAYEDPNKEQ-
TRPB_FRATT       HAHLLAIGRAKYASATDDEALD-AFKLLCKKEGIIPALESSHALAHALKLAYEDPNKEQ-
TRPB_FRATH       HAHLLAIGRAKYASATDDEALD-AFKLLCKKEGIIPALESSHALAHALKLAYEDPNKEQ-
TRPB_FRATF       HAHLLAIGRAKYASATDDEALD-AFKLLCKKEGIIPALESSHALAHALKLAYEDPNKEQ-
TRPB_FRATO       HAHLLAIGRAKYASATDDEALD-AFKLLCKKEGIIPALESSHALAHALKLAYEDPNKEQ-
TRPB_FRATW       HAHLLAICRAKYASATDDEALD-AFKLLCKKEGIIPALESSHALAHALKLAYEDPNKEQ-
TRPB_FRATN       HAHLLAIGRAEYASATDDEALD-AFKLLCKKEGIIPALESSHALAHALKLAYEDPNKEQ-
TRPB_FRAP2       HAHLLAIGRAEYASATDNEALD-AFKLLCKKEGIIPALESSHALAYALKLAYENPDKEQ-
TRPB_AERHH       HAHLAAIGRAEYPSVTDKEALD-AFQELAKSEGIIPALESSHALAHALKMARSEPEKEQ-
TRPB_AERS4       HAHLASIGRAEYVSITDKEALD-AFQELAKSEGIIPALESSHALAHALKMARSEPEKEL-
TRPB_PSYIN       HAHLAETGRAQYVYATDDEALD-AFHELSLKEGIIPALESAHALAHALKLIKHD-DKEQ-
TRPB_SHEPA       HAHLAATGRATYESATDDEALE-AFQLLARSEGIIPALESAHALAYAVKLAKEA-TKET-
TRPB_SHEHH       HAHLAAIGRATYESATDDEALE-TFQLLARCEGIIPALESAHAIAYAVKLAKEA-TKET-
TRPB_SHELP       HAHLAATGRATYESATDDEALA-AFQLLARSEGIIPALESAHALAYAIKLAEAA-TEET-
TRPB_SHESM       HAHLNAIGRARYESATDDEALE-AFQLLARSEGIIPALESAHALAYALRLAKEC-TKET-
TRPB_SHESA       HAHLNAIGRARYESATDDEALE-AFQLLARSEGIIPALESAHALAYALRLAKEC-TKET-
TRPB_SHESR       HAHLNAIGRARYESATDDEALE-AFQLLARSEGIIPALESAHALAYALRLAREC-TKET-
TRPB_SHEON       HAHLNAIGRARYESATDDEALE-AFQLLARCEGIIPALESAHALAYALRLAKEC-TKET-
TRPB_SHEB8       HAHLNATGRARYESATDDEALE-AFQQLARCEGIIPALESAHAIAYAVKMAREC-TKET-
TRPB_SHEB5       HAHLNATGRARYESATDDEALE-AFQQLARCEGIIPALESAHAIAYAVKMAREC-TKET-
TRPB_SHESW       HAHLNATGRARYESATDDEALE-AFQQLARCEGIIPALESAHAIAYAVKMAREC-TKET-
TRPB_SHEPC       HAHLNATGRARYESATDDEALE-AFQQLARCEGIIPALESAHAIAYAVKMAREC-TKET-
TRPB_SHEB9       HAHLNATGRARYESATDDEALE-AFQQLARCEGIIPALESAHAIAYAVKMAREC-TKET-
TRPB_SHEFN       HAHLNAIGRARYESATDDEALE-MFQTLARCEGIIPALESAHALAYAVRMAKEA-TKET-
TRPB_SHEDO       HAHLNAIGRARYESATDDEALA-MFQQLARCEGIIPALESAHALAYAVKLAKTA-TKET-
TRPB_SHEAM       HAYLNATGRATYESATDDEALE-AFQLLARSEGIIPALESAHALAYALRLAKDA-TEEQ-
TRPB_PSEA6       HAHLHDIGRATYAAVTDDEALY-AFQLLSRKEGIIPALESSHALAHALNMADEA-EDGT-
TRPB_HELPY       HSYLKESGRAVYESASDAEALE-AFKLLCQKEGIIPALESSHALAYALKLAQKC-EEES-
TRPB_HELPJ       HSYLKEIGRAVYESASDIEALE-AFRLLCQKEGIIPALESSHALAYALKLAQKC-AQEK-
TRPB_CORGL       HAHLHATGRATYVGITDAEALQ-AFQYLARYEGIIPALESSHAFAYALKRAKTAEEEGQN
TRPB_CORGB       HAHLHATGRATYVGITDAEALQ-AFQYLARYEGIIPALESSHAFAYALKRAKTAEEEGQN
TRPB1_COREF      HAHLHSTGRATYVGITDAEALI-AFQYLARYEGIIAALESSHALAYALKRAKLAEEEGKQ
TRPB2_COREF      HAHLKDTGRAEYVGATDAEALQ-AFRMLSRYEGIIPALESSHALAHALKMAAEATEP---
TRPB_METJA       LSFLKDEGRIKAVCVTDDEALE-AFQLLCRLEGILPALESSHALAYAVKLADK--LDK--
TRPB_METKA       LAFLVDEGRVTADAVTDEEALR-GFVMLNETEGILPALESAHAVYYVKKLVERGELDR--
TRPB1_METTH      HAHLMDTGRARYEPVTDTEALR-GFRLLSRYEGIMPALESAHAIACLERYAEKPENR---
TRPB2_METTM      HAYLMETGRAMYEPITDAEALR-GFKLLSRCEGIMPALESAHAIACLEKYASKPENR---
TRPB1_METMA      LASLAESGRVTARYVTDDEAVE-AFNELSRLEGIIPALESSHALAYLKKAAE--SGE---
TRPB1_METAC      LAYLSESGRVTARYVTDDEALD-AFNELSRLEGIIPALESSHALAYLKKAAE--SGE---
TRPB_HALVD       LAHLVDTGRVTAVNVDDDAALT-AFHRLSQMEGIIPALESAHAFGYLESVVGPDAPDAE-
TRPB_HALSA       LAHLVDTGRITPTNVDDDAALA-AFHRLSRDEGVIPALETSHAVAALDQYDG--DGP---
TRPB1_THEMA      HAYWRETGKVLYDAVTDEEALD-AFIELSRLEGIIPALESSHALAYLKKINI--------
TRPB_METVO       HAYLHNLGRVQYASATDKQALK-AFMELTRTEGIIPALESSHAIAYAIENAGNMDKD---
TRPB_META3       HAYLDEIKRVEYAGITDVEALD-AFSTLSKTEGIIPALESSHAVAHGMKIAKEMDKD---
TRPB1_PYRFU      HAYLKKIQRAEYVTVTDEEALK-AFHELSRTEGIIPALESAHAVAYAMKLAKEMSRD---
TRPB1_PYRAB      HAYLKESGRAEYVTVTDEEALR-AFHELSRTEGIIPALESAHAVAYAIKLAREMSRD---
TRPB1_THEKO      HAYLKDSGRAEYVTVTDEEALR-AFHELSRTEGILPALESAHAVAYAMKIAPEMDKD---
TRPB1_ARCFU      HAYLKETGRCEYVTVNDEEALR-AFKTLSKLEGIIPALESAHAIAYAMKMAEEMQRD---
TRPB2_CHLCV      HAVLYESGRASYTVATDKAALE-AFFLLSRLEGIIPALESSHALAELINIAPTLPKES--
TRPB1_CHLCV      HAEMHESGRAQYTYATDDEALE-AFRLLSKTEGIIPALESSHALAHMIKIAPSLDKDT--
TRPB2_WOLSU      HAYLFESGAAEYDHVTDAEALE-AFVWLSQKEGIIPAFESAHAIAYLKKARER-------
TRPB_BACTN       HANLAAQRRATVLAVNDDEAIE-AAYELTKLEGIIPALESAHALGALKKLKFK-------
TRPB_HELHP       LAHLYEVGRVEFQSATDKEALE-ALSFFAQYEGIIPALESSHALAAVIRLCKDIK-----
TRPB2_AQUAE      VCKLYNLGYIDAVAYKQTEVFE-AAVTFARTEGIVPAPESAHAIKAAIDEALKCKETGE-
TRPB2_ARCFU      LCMLVKHGVIKARAVKQLPTFE-AGLLFARTEGIIPAPETNHAVRAAIDEAIKARENNE-
TRPB2_METMA      ISKLCAEGLMEAVSYGQKEVFD-AAVQFARTEGIVPAPESSHAIRCAIDEALEAKQKGE-
TRPB2_METAC      ISKLCSEGLMEAVSYDQQEVFD-AAVQFARTEGIVPAPESSHAIRCAIDEALAAKQTGE-
TRPB2_THEMA      IARLVKEGLVEAQAFDQDETFE-AAKIFAKLEGIIPAPESAHAIAGAIREAKKAKEEGK-
TRPB2_METTH      VALLVREGVINARAVPQHTIFE-SGVKFAKAEGVVPAPETCHAISVAIDEARKCRETGE-
TRPB2_PYRAB      LSVLINHGIVKPIAYHQTEVFE-AAVLFAKAEGIVPAPESAHAVKAVIDKALEARREGK-
TRPB2_PYRFU      LSVLVNNGIVKPIAYHQTEVFE-AAALFAKLEGIVPAPESAHAIKATIDKAIEAKREGK-
TRPB_PYRHO       LSVLMNHGIVKPMAYHQTEVFE-AAVLFAKAEGIVPAPESAHAVRAVIDKALEAKRKGE-
TRPB2_THEKO      LSVLINHGIVKPVAYHQNEVFQ-AAHLFAKTEGIVPAPESAHAIKGAIDRALEAKREGR-
TRPB2_AERPE      LSVLLKHGIVEARAYHQREVFR-AAHMFAKAEGIVPAPESAHAVKAAIDEAIKARDEGR-
TRPB1_SACS2      LSLLTKEGIVEWREYNEREIFE-AAKIFIENQGIVPAPESAHAIRAVVDEAIEARKNNE-
TRPB1_SULTO      LSLLIKEKIVEWREYKEEEIYE-AAKIFMKTQGIVPAPESAHAIKAVIDEALKAKTEKE-
TRPB_PICTO       LSLLINHGRIKSDEVTEEQVKN-AIKTFANTQGFIIAPESGHAVATAIKYAREHK--DE-
TRPB2_SACS2      LSLLISKGIVQARDYSQEESFK-WAKLFSELEGYIPAPETSHALPILAEIAEEAKKSGE-
TRPB2_SULTO      LSLLMYKGIVQARDYSQEEAFS-WAKLFSQIEGWVPAPETSHALPILKEIVEEAKKSGE-
TRPB_THEAC       LSLLMNKGIVSARDYDQEEAFK-WARIFSETEGYIPAPETSHALPILKEIADKNRGE---
TRPB_THEVO       LSLLMNKGIVQARDYDQEEAFK-WARIFSEKEGYIPAPETSHALPILKEIADSNRGERE-
TRPB1_AERPE      LSILRRLGLVEAEAIPQEEALA-SILLMARSEGVVPAPESSHAVALAARIARKLP---D-
TRPB_PYRAE       LSLLRKLGIVEAVAYPQEEVMR-AALLFARTEGIVPAPESAHAIKAAVDLAKKLP---R-
                                 :              :* : * *. *..                

TRPB1_WOLSU      ---RLGEKILINLSGRGDKDIDYVSETFG-------FGGEE-------------------
TRPB2_VIBPA      ---GESGSILVNLSGRGDKDIDFVVENYGAK-----YGIESLI-----------------
TRPB_CALS4       ----EDKIIVVNLSGRGDKDVNTVAKVMGVEL----------------------------
TRPB_CLOAB       ----KDEIVIINLSGRGDKDVNTVMKNMEENKNGK-------------------------
TRPB_CLOB8       ----SDKIIIVNISGRGDKDMDAVLAYLGEK-----------------------------
TRPB_FUSNN       ----KNKIIIVNISGRGDKDVAAIAEYLKNK-----------------------------
TRPB_CLONN       ----KDKIIVVNLSGRGDKDVETISEYLNK------------------------------
TRPB_LACP3       ----KDQIIICTLSGRGDKDVASIAKYKGVDVDE--------------------------
TRPB_LACCA       ----KDQIIICTLSGRGDKDVASIAKYKGVDVDE--------------------------
TRPB_LACPL       ----RDQTIICTLSGRGDKDVAAIAKYRGVTIDD--------------------------
TRPB_CAMJR       ----KKSVIVVNLSGRGDKDMQMIRDYKKGVIYG--------------------------
TRPB_CAMJE       ----KKSVIVVNLSGRGDKDMQMIRDYKKGVIYG--------------------------
TRPB_CAMJ8       ----KKSVIVVNLSGRGDKDMQMIRDYKKGVIYG--------------------------
TRPB_CAMJJ       ----KKSVIVVNLSGRGDKDMQMIRDYKKGVIYG--------------------------
TRPB_CAMJD       ----KKSVIVINLSGRGDKDMQMIREYKKGVIYG--------------------------
TRPB_THET2       --MDKDQVVVINLSGRGDKDVTEVMRLL---------GGEL-------------------
TRPB_THET8       --MDKDQVVVINLSGRGDKDVTEVMRLL---------GGEL-------------------
TRPB_DEIRA       --MKPEEIVVVNLSGRGDKDVTEVMRLLEQSENKQAEGQEVKA-----------------
TRPB_CHLTE       --MPKESIIVVNLSGRGDKDMGTIMQEL-----------KL-------------------
TRPB1_AQUAE      --LGKDGIVVINLSGRGDKDMAHVMKHL-----------SLEG-----------------
TRPB_BRASB       --KPKEHLMVVNLCGRGDKDVPQVGEIL---------RKRAKES----------------
TRPB_BRASO       --KPKDHLMVVNLCGRGDKDVPQVGEIL---------RKRAKQS----------------
TRPB_BRADU       --RAKDHLMVVNLSGRGDKDVPQVGDIL---------RGKSK------------------
TRPB_PARL1       --LPKDHLMVMNMCGRGDKDVFAVADHL---------GVTL-------------------
TRPB_CAUVC       --LGKGKIVVMNLCGRGDKDIFTVAEAL---------GRKI-------------------
TRPB_ACICJ       --MDKESIILMNLCGRGDKDIFTVARHL---------GEQI-------------------
TRPB_NOVAD       --MGKDEIILANLCGRGDKDIFSVAEHL---------GVSL-------------------
TRPB_RHOS4       --LPRDHIIVMNMCGRGDKDIFTVAKHL---------GFDMKI-----------------
TRPB_RUEST       --LPKDHIIVMNMCGRGDKDIFTVARHL---------GFDMSDTEEGRDLEE--------
TRPB_RUEPO       --LPKDHIIIMNMCGRGDKDIFTVAKFL---------GFDMSDTE-GRDAED--------
TRPB_DINSH       --LPRDHIICMNMCGRGDKDIFTVAKAL---------GQDMSGAV---------------
TRPB_ROSDO       --LPSDHIICMNMCGRGDKDIFTVAKAL---------GFEMGEFA---------------
TRPB_JANSC       --MPRDHLLVMNMCGRGDKDIFTVARAL---------GWDMDGA----------------
TRPB_PARDP       --LPRDHIMVVNLSGRGDKDIFTVAKHL---------GVDIRT-----------------
TRPB_BRUSU       --MGKDKVMIVNLSGRGDKDVHTVGKLL---------GMDI-------------------
TRPB_BRUC2       --MGKDKVMIVNLSGRGDKDVHTVGKLL---------GMDI-------------------
TRPB_BRUSI       --MGKDKVMIVNLSGRGDKDVHTVGKLL---------GMDI-------------------
TRPB_BRUAB       --MGKDKVMIVNLSGRGDKDVHTVGKLL---------GMDI-------------------
TRPB_BRUA2       --MGKDKVMIVNLSGRGDKDVHTVGKLL---------GMDI-------------------
TRPB_BRUME       --MGKDKVMIVNLSGRGDKDVHTVGKLL---------GMDI-------------------
TRPB_OCHA4       --MGKDQVMIVNLSGRGDKDVHTVGKLL---------GMDI-------------------
TRPB_RHILO       --MDKDQIVIVNLSGRGDKDVHTVASML---------GMEI-------------------
TRPB_RHIEC       ----KDEIILMNLSGRGDKDIFTVGKILGMGL----------------------------
TRPB_RHIL3       --MGKDEIILMNLSGRGDKDIFTVGKIL---------GMGL-------------------
TRPB_SINMW       --MGKDEIILMNLSGRGDKDIFTVGKIL---------GMGQ-------------------
TRPB_RHIME       --MGKDEIILMNLSGRGDKDIFTVGKIL---------GMGQ-------------------
TRPB_AGRFC       --MGKDEIILMNLSGRGDKDVHTVSKFL---------GMDV-------------------
TRPB_CHESB       --MGKDQIIVMNLSGRGDKDIFAVAKHL---------KMDV-------------------
TRPB_PSEPF       --LPKDHLMVVNLSGRGDKDMQTVMHHM---------ETSKQEKH---------------
TRPB_PSESY       --LPKDHLMVVNLSGRGDKDMQTVMHHM---------ETTKQEKH---------------
TRPB_PSEF5       --LPKDHLMVVNLSGRGDKDMQTVMHHM---------QQSQQEKH---------------
TRPB_PSEAE       --LPKEHIMVVNLSGRGDKDMQTVMHHM---------QQESKA-----------------
TRPB_PSESH       --LRDDHLMVVCLSGRGDKDMQTVMNHM---------AAAEKTQEKLV------------
TRPB_PSE14       --LRDDHLMVVCLSGRGDKDMQTVMNHM---------AAAEKTQEKLV------------
TRPB_PSEU2       --LRDDHLMVVCLSGRGDKDMQTVMNHM---------AAAEHTQEQLV------------
TRPB_PSESM       --LRDDHLMVVCLSGRGDKDMQTVMNHM---------AAADNTQEKLV------------
TRPB_PSEPU       --LPKDHLMVVCLSGRGDKDMQTVMNHM---------AAQEKQA----------------
TRPB_PSEPG       --LPKDHLMVVCLSGRGDKDMQTVMNHM---------AAQEKQA----------------
TRPB_PSEPK       --LPKDHLMVVCLSGRGDKDMQTVMNHM---------AAQEKQA----------------
TRPB_PSEP1       --LPKDHLMVVCLSGRGDKDMQTVMNHM---------AAQEKHA----------------
TRPB_PSEE4       --LPKDHLMVICLSGRGDKDMQTVMNHM---------AAQEKQA----------------
TRPB_ACICA       --MDKDQIIIANVSGRGDKDLMTVARID---------GIEMVEM----------------
TRPB_ACIAD       --MDKDQIIIANVSGRGDKDLMTVARID---------GIEMVEM----------------
TRPB_LEGPA       --MSKEQSIIVNLSGRGDKDMHTVAAID---------GITI-------------------
TRPB_LEGPL       --MSKEQSIIVNLSGRGDKDMHTVAAID---------GITI-------------------
TRPB_LEGPH       --MSKEQSIIVNLSGRGDKDMHTVAAID---------GITI-------------------
TRPB_LEGPC       --MSKEQSIIVNLSGRGDKDMHTVAAID---------GITI-------------------
TRPB_BORBR       --LSKDKVILVNLSGRGDKDMHTVAERA---------GLQL-------------------
TRPB_BORPA       --LSKDKVILVNLSGRGDKDMHTVAERA---------GLQL-------------------
TRPB_BORPE       --LSKDKVILVNLSGRGDKDMHTVAERA---------GLQL-------------------
TRPB_RALSO       --LPKDKILLVNLSGRGDKDMHTVAELS---------GIDL-------------------
TRPB_POLNA       --MRSDQSILVNLSGRGDKDIGTVADLS---------GADFYDRPSMRGLGVKGGVATSP
TRPB_POLSJ       --MRSDQSILVNLSGRGDKDIGTVADLS---------GADFYDRPSMRGLAVKGGEQPKE
TRPB_ACIAC       --LRTDQSILVNLSGRGDKDIGTVADLS---------GVDFYDRPSMRGHAVKGGPAA--
TRPB_METPP       --MRSDQSLLVNLSGRGDKDIGTVADLS---------GAEFYDRPSSRGEKVKQ------
TRPB_METFK       --MSPDQALLVNLSGRGDKDINTVASLA---------GITL-------------------
TRPB_NITEU       --LNKDQLLLVNLSGRGDKDMATVAQQS---------GISL-------------------
TRPB_NITEC       --LRKDQLLLVNLSGRGDKDMATVAQQS---------GISL-------------------
TRPB_NITMU       --LTSDKLLLVNLSGRGDKDMPTVARAS---------HITF-------------------
TRPB_METCA       --LSSDKIVLVNLSGRGDKDIHTIATRE---------GIVL-------------------
TRPB_XANAC       --LPRDALVLCNLSGRGDKDVHTIAARE---------GIAL-------------------
TRPB_XANC5       --LPRDALVLCNLSGRGDKDVHTIAARE---------GIAL-------------------
TRPB_XANOM       --LPKDALVLCNLSGRGDKDVHTIAARE---------GLAL-------------------
TRPB_XANCP       --MPKDALVLCNLSGRGDKDVHTIAARE---------GMVL-------------------
TRPB_XANC8       --MPKDALVLCNLSGRGDKDVHTIAARE---------GMVL-------------------
TRPB_XYLFA       --LPKDALVLCNLSGRGDKDVHTIAARE---------GVRV-------------------
TRPB_XYLFT       --LPKDALVLCNLSGRGDKDVHTIAARE---------GVRV-------------------
TRPB_VESOH       --LGKNKSIIINLSGRGDKDIHTIAQIE---------GIEC-------------------
TRPB_RUTMC       --LGKDKHIIINLSGRGDKDIHTIAQIE---------GIEF-------------------
TRPB_NEIG1       --MGKDQVILVNLSGRGDKDINTVAKLK---------GIEL-------------------
TRPB_NEIGO       --MGKDQVILVNLSGRGDKDINTVAKLK---------GIEL-------------------
TRPB_NEIMF       --MGKDQVILVNLSGRGDKDINTVAKLK---------GIKL-------------------
TRPB_NEIMA       --MGKDQVILVNLSGRGDKDINTVAKLK---------GIKL-------------------
TRPB_NEIMB       --MGKDQVILVNLSGRGDKDINTVAKLK---------GIKL-------------------
TRPB_NEIM0       --MGKDQVILVNLSGRGDKDINTVAKLK---------GIKL-------------------
TRPB_CHRVO       --MGKDQVILVNLSGRGDKDINTVAGLA---------GITL-------------------
TRPB_RHOBA       --MSDQEHLVICLSGRGDKDSMEIARLR---------GEEW-------------------
TRPB_GEOSE       --MSPDETVLICLSGRGDKDVQTMMRHL---------GAKEGEDVAAIR-----------
TRPB_GEOTN       --MTPDETVLICLSGRGDKDVQMMMHHL---------GVKEGEDVASAR-----------
TRPB_BACVZ       --MDKDKIILVSLSGRGDKDVHTLMNVL---------ENGVGTHV---------------
TRPB_BACSU       --MDRGQLILVCLSGRGDKDVNTLMNVL---------EEEVKAHV---------------
TRPB_BACLD       --LPREKSVLVCLSGRGDKDVHTLMKVL---------EEEVNQDVQSEKTAVR-------
TRPB_BACP2       --MSEDEIILVCLSGRGDKDVHTLMNVL---------ESEGKTK----------------
TRPB_BACHD       --LSQEESILVCLSGRGDKDVHTLMKHF---------RGEGHE-----------------
TRPB_BACSK       --MTPNQSVLVCLSGRGDKDMHTLQRVY---------KEGYDE-----------------
TRPB_BACAN       --MKEDEGLVICLSGRGDKDVESIKRYM---------EEV--------------------
TRPB_BACHK       --MKEDEGLVICLSGRGDKDVESIKRYM---------EEV--------------------
TRPB_BACAH       --MKEDEGLVICLSGRGDKDVESIKRYM---------EEV--------------------
TRPB_BACCZ       --MKEDEGLVICLSGRGDKDVESIKRYM---------EEV--------------------
TRPB_BACCR       --MKKDEGLVICLSGRGDKDVESIKRYM---------EEV--------------------
TRPB_BACC1       --MKKDEGLVICLSGRGDKDVESIKRYM---------EEV--------------------
TRPB_OCEIH       --MNPEQSIVICLSGRGDKDVEQVKERL---------EGEQ-------------------
TRPB_LACLS       --LGSEKTMIVCLSGRGDKDVVQVKERL---------EAEKEVK----------------
TRPB_LACLM       --LGSEKTMIVCLSGRGDKDVVQVKERL---------EAEKEVK----------------
TRPB_LACLA       --LGADKSMIVCLSGRGDKDVVQVKERL---------EAEKEVKK---------------
TRPB_STRR6       --LGPEKSMIVCLSGRGDKDVVQVKDRL---------EADAAKKGEAHA-----------
TRPB_STRP2       --LGPEKSMIVCLSGRGDKDVVQVKDRL---------EADAAKKGEAHA-----------
TRPB_STRPN       --LGPEKSMIVCLSGRGDKDVVQVKDRL---------EADAAKKGEAHA-----------
TRPB_STRT2       --MSPDQSLIVCLSGRGDKDVMQVKERF---------EAEA--EGK--------------
TRPB_STRT1       --MSPDQSLIVCLSGRGDKDVMQVKERF---------EAEA--EGK--------------
TRPB_STRTD       --MSPDQSLIVCLSGRGDKDVMQVKERF---------EAEA--EGK--------------
TRPB_STRMU       --LGADKSIIVCLSGRGDKDVAQVKERL---------KQEAK-EGK--------------
TRPB_LISMF       --MRPEESMVVCLSGRGDKDVNQLKERL---------EGQIND-----------------
TRPB_LISMO       --MRPEESMVVCLSGRGDKDVNQLKERL---------EGQTND-----------------
TRPB_LISIN       --MRPDESMVVCLSGRGDKDVNQLKERL---------EGQTND-----------------
TRPB_LISW6       --MRPEESMVVCLSGRGDKDVNQLKERL---------EEQAND-----------------
TRPB_STAAN       --MSKEDIIVVTISGRGDKDMETIRQYM---------AERGLAND---------------
TRPB_STAA1       --MSKEDIIVVTISGRGDKDMETIRQYM---------AERGLAND---------------
TRPB_STAAM       --MSKEDIIVVTISGRGDKDMETIRQYM---------AERGLAND---------------
TRPB_STAA9       --MSKEDIIVVTISGRGDKDMETIRQYM---------AERGLAND---------------
TRPB_STAA2       --MSKEDIIVVTISGRGDKDMETIRQYM---------AERGLAND---------------
TRPB_STAAR       --MSKEDIIVVTISGRGDKDMETIRQYM---------AERGLAND---------------
TRPB_STAAB       --MSKEDIIVVTISGRGDKDMETIRQYM---------AERGLAND---------------
TRPB_STAAE       --MSKEDIIVVTISGRGDKDMETIRQYM---------VERGLAND---------------
TRPB_STAA8       --MSKEDIIVVTISGRGDKDMETIRQYM---------VERGLAND---------------
TRPB_STAA3       --MSKEDIIVVTISGRGDKDMETIRQYM---------VERGLAND---------------
TRPB_STAAW       --MSKEDIIVVTISGRGDKDMETIRQYM---------VERGLAND---------------
TRPB_STAAT       --MSKEDIIVVTISGRGDKDMETIRQYM---------VERGLAND---------------
TRPB_STAAC       --MSKEDIIVVTISGRGDKDMETIRQYM---------VERGLAND---------------
TRPB_STAAS       --MSKEDIIVVTISGRGDKDMETIRQYM---------VERGLAND---------------
TRPB_STAS1       --MRNDEILVVTVSGRGDKDMETIRNYM---------KQEGDTHA---------------
TRPB_STAEQ       --MDEKEIIVVTISGRGDKDMETIKQYK---------ENGGEQNE---------------
TRPB_STAES       --MDEKEIIVVTISGRGDKDMETIKQYK---------ENGGEQNE---------------
TRPB_LEPIC       --MSKKENILICLSGRGDKDVAEVSRLR---------KGEFI------------------
TRPB_LEPIN       --MSKKENILICLSGRGDKDVAEVSRLR---------KGEFI------------------
TRPB_LEPBJ       --MGKKEDILICLSGRGDKDVAEVARLR---------KGEFS------------------
TRPB_LEPBL       --MGKKEDILICLSGRGDKDVAEVARLR---------KGEFS------------------
TRPB2_NOSS1      --LDGSPRIVINCSGRGDKDVQTVAKFLI---------PQ--------------------
TRPB_TRIV2       --LDGSPRIIINCSGRGDKDVQTVAKFLI---------PQ--------------------
TRPB1_NOSS1      --LNGSPRIVINCSGRGDKDVQTVAKVLN---------Y---------------------
TRPB_TRIEI       --LSGSPRIVFNCSGRGDKDVQTVGKFLE---------G---------------------
TRPB_THEEB       --LTGQPRIVINCSGRGDKDVETIGRYFE---------AQ--------------------
TRPB_SYNY3       --LKNGERIVINCSGRGDKDVQTVAKYLQ---------MEI-------------------
TRPB_SYNJB       A-IGPQQRVVVNCSGRGDKDLNTVFKYLQ---------QRGRSF----------------
TRPB_GLOVI       --LHSEQIVVLNCSGRGDKDMGTVARAMG---------WGKEE-----------------
TRPB_PROM1       --LNHNSEIVINCSGRGDKDVNTVAEKLG---------SEI-------------------
TRPB_PROMT       --LNHNSEIVINCSGRGDKDVNTVAEKLG---------SEI-------------------
TRPB_PROMA       --LSSGKEIVINCSGRGDKDVNTVAEKLK---------TKN-------------------
TRPB_SYNPW       --LSAGTEVVLNCSGRGDKDVNTVAERLG---------DAL-------------------
TRPB_PROMM       --LAAGTEVVINCSGRGDKDVNTVAEKLG---------NQL-------------------
TRPB_SYNSC       --LADGTEVVINCSGRGDKDVNTVAEKLG---------DQL-------------------
TRPB_SYNPX       --LPDGSEVVINCSGRGDKDVNTVAEKLG---------DQL-------------------
TRPB_SYNS9       --LPQGCEVVINCSGRGDKDVNTVAEKLG---------DKL-------------------
TRPB_SYNS3       --LPNGSEIVINCSGRGDKDVNTVAEKLG---------NQL-------------------
TRPB_PROMP       --LDKDTEIVINCSGRGDKDVNTVASSLN---------ID--------------------
TRPB_PROM5       --LEKNTEIVINCSGRGDKDVNTVASSLD---------I---------------------
TRPB_PROMS       --LEKDTNIVINCSGRGDKDVNTVASSLD---------I---------------------
TRPB_PROM0       --LEKDTHIVINCSGRGDKDVNTVASSLD---------I---------------------
TRPB_PROM9       --LEKDTHIVINCSGRGDKDVNTVASSLD---------I---------------------
TRPB_PROM2       --LEKDTHIVINCSGRGDKDVNTVASSLD---------I---------------------
TRPB_MYCTU       --LGRGAVIVVNLSGRGDKDVETAAKWF---------GLLGND-----------------
TRPB_MYCBO       --LGRGAVIVVNLSGRGDKDVETAAKWF---------GLLGND-----------------
TRPB_MYCLE       --IGKGAVIVVNLSGRGDKDIEAAAKWF---------GLLGTR-----------------
TRPB_MYCIT       --LGKAAIIVVNLSGRGDKDVETAAQWF---------GLLGSSDR---------------
TRPB_STRAW       --LGKDGLILVNLSGRGDKDMDTAARYF---------GLYDTDASVAADADSDIAEIEGD
TRPB_STRCO       --LGRDGLLVVNLSGRGDKDMDTAARYF---------GLYDTDAEVAADG-TGAAEIEGD
TRPB_LEIXX       --LGPEGVVLVSLSGRGDKDMETAGRYF---------GLIEEGAVQS-------------
TRPB_SHIFL       -------LLVVNLSGRGDKDIFTVHDILKARGEI--------------------------
TRPB_ECOLC       -------LLVVNLSGRGDKDIFTVHDILKARGEI--------------------------
TRPB_SHIF8       -------LLVVNLSGRGDKDIFTVHDILKARGEI--------------------------
TRPB_ECOLI       -------LLVVNLSGRGDKDIFTVHDILKARGEI--------------------------
TRPB_ECO24       -------LLVVNLSGRGDKDIFTVHDILKARGEI--------------------------
TRPB_ECOHS       -------LLVVNLSGRGDKDIFTVHDILKARGEI--------------------------
TRPB_SHISS       -------LLVVNLSGRGDKDIFTVHDILKARGEI--------------------------
TRPB_ECO57       -------LLVVNLSGRGDKDIFTVHDILKARGEI--------------------------
TRPB_SHIBS       -------LLVVNLSGRGDKDIFTVHDILKARGEI--------------------------
TRPB_ECOK1       -------LLVVNLSGRGDKDIFTVHDILKARGEI--------------------------
TRPB_ECOUT       -------LLVVNLSGRGDKDIFTVHDILKARGEI--------------------------
TRPB_SHIDS       -------LLVVNLSGRGDKDIFTVHDILKARGEI--------------------------
TRPB_ECOL5       -------LLVVNLSGRGDKDIFTVHDILKARGEI--------------------------
TRPB_ECOL6       -------LLVVNLSGRGDKDIFTVHDILKARGEI--------------------------
TRPB_CITK8       -------LLVVNLSGRGDKDIFTVHDILKARGEI--------------------------
TRPB_SALTY       -------LLVVNLSGRGDKDIFTVHDILKARGEI--------------------------
TRPB_SALPB       -------LLVVNLSGRGDKDIFTVHDILKARGEI--------------------------
TRPB_SALTI       -------LLVVNLSGRGDKDIFTVHDILKARGEI--------------------------
TRPB_SALPA       -------LLVVNLSGRGDKDIFTVHDILKARGEI--------------------------
TRPB_SALCH       -------LLVVNLSGRGDKDIFTVHDILKARGEI--------------------------
TRPB_SALAR       -------LLVVNLSGRGDKDIFTVHDILKARGEI--------------------------
TRPB_CROS8       -------LLVVNLSGRGDKDIFTVHDIFKARGEM--------------------------
TRPB_KLEP7       -------LLVVNLSGRGDKDIFTVHDILKARGEI--------------------------
TRPB_ENT38       -------LLVVNLSGRGDKDIFTVHDILKARGEI--------------------------
TRPB_PECAS       -------LLVVNLSGRGDKDIFTVHDILKDRGEI--------------------------
TRPB_YERPA       -------ILVVNLSGRGDKDIFTVHDILKARGEI--------------------------
TRPB_YERPS       -------ILVVNLSGRGDKDIFTVHDILKARGEI--------------------------
TRPB_YERPN       -------ILVVNLSGRGDKDIFTVHDILKARGEI--------------------------
TRPB_YERPP       -------ILVVNLSGRGDKDIFTVHDILKARGEI--------------------------
TRPB_YERP3       -------ILVVNLSGRGDKDIFTVHDILKARGEI--------------------------
TRPB_YERPE       -------ILVVNLSGRGDKDIFTVHDILKARGEI--------------------------
TRPB_YERE8       -------ILVVNLSGRGDKDIFTVHDILKARGEI--------------------------
TRPB_SERP5       -------ILVVNLSGRGDKDIFTVHDILKARGEI--------------------------
TRPB_SODGM       -------ILVVNLSGRGDKDIFTVHDILKARGDI--------------------------
TRPB_PHOLL       -------LLIVNLSGRGDKDIFTVHDILKSRGEI--------------------------
TRPB_HAEIN       -------LLVVNLSGRGDKDIFTVDKILNGGAN---------------------------
TRPB_HAEIE       -------LLVVNLSGRGDKDIFTVDKILNGGTN---------------------------
TRPB_HAEIG       -------LLVVNLSGRGDKDIFTVDKILTEKGMK--------------------------
TRPB_HAEI8       -------LLVVNLSGRGDKDIFTVDKILNGGTN---------------------------
TRPB_ACTSZ       -------LLVVNLSGRGDKDIFTVDKILRAKGEL--------------------------
TRPB_HISS2       -------LLVVNLSGRGDKDIFTVDKILTEKGII--------------------------
TRPB_ACTP2       -------LLVVNLSGRGDKDIFTVDKILNGGN----------------------------
TRPB_PASMU       -------LLVVNLSGRGDKDIFTVDRILSQKGVSYAPF----------------------
TRPB_MANSM       -------LLVVNLSGRGDKDIFTVDKIFSERGML--------------------------
TRPB_BUCAP       -------VFIVNLSGRGDKDIFTVREILKKTEKKHESL----------------------
TRPB_BUCAI       -------ILIANLSVV-EIKIFLQYMMF--------------------------------
TRPB_BUCDN       -------IFVVNLSGRGDKDIFTVHDILKKTGKRI-------------------------
TRPB_BUCMH       -------ILIVNISGRGDKDIETVKNFLKM------------------------------
TRPB_BUCSC       -------TLIVNISGRGDKDLKTVEKFLNK------------------------------
TRPB_BUCBP       -------IIIVNISGRGDKDIDTIRKIDVYKE----------------------------
TRPB_BLOPB       -------ILVVNLSGRGDKDISTVHNALQ-KERDK-------------------------
TRPB_BLOFL       -------ILIVNLSGRGDKDIITVNNALLNKEICK-------------------------
TRPB1_VIBPA      -------LLVVNLSGRGDKDIFTVHAILEEKGVI--------------------------
TRPB_VIBCB       -------LLVVNLSGRGDKDIFTVHAILEEKGAI--------------------------
TRPB_VIBVU       -------LLVVNLSGRGDKDIFTVHAILEEKGAI--------------------------
TRPB_VIBVY       -------LLVVNLSGRGDKDIFTVHAILEEKGAI--------------------------
TRPB_ALIF1       -------LLVVNLSGRGDKDIFTVHDILKEKGEI--------------------------
TRPB_VIBC3       -------LLVVNLSGRGDKDIFTVHKLLEDKGAL--------------------------
TRPB_VIBCH       -------LLVVNLSGRGDKDIFTVHKLLEDKGAL--------------------------
TRPB_VIBME       -------LLVVNLSGRGDKDIFTVHQLLEERGAL--------------------------
TRPB_PHOPR       -------LLVVNLSGRGDKDIFTVHDILDAKGVL--------------------------
TRPB_FRAT1       -------LLVVNLSGRGDKDIFTVHDILKEKGEI--------------------------
TRPB_FRATT       -------LLVVNLSGRGDKDIFTVHDILKEKGEI--------------------------
TRPB_FRATH       -------LLVVNLSGRGDKDIFTVHDILKEKGEI--------------------------
TRPB_FRATF       -------LLVVNLSGRGDKDIFTVHDILKEKGEI--------------------------
TRPB_FRATO       -------LLVVNLSGRGDKDIFTVHDILKEKGEI--------------------------
TRPB_FRATW       -------LLVVNLSGRGDKDIFTVHDILKEKGEI--------------------------
TRPB_FRATN       -------LLVVNLSGRGDKDIFTVHDILKEKGEI--------------------------
TRPB_FRAP2       -------LLVVNLSGRGDKDIFTVHDILKEKGEM--------------------------
TRPB_AERHH       -------VLIVNLSGRGDKDIFTVADIFEKEGTLS-------------------------
TRPB_AERS4       -------VLIVNLSGRGDKDIFTVADIFEKEGTLS-------------------------
TRPB_PSYIN       -------IIIVNLSGRGDKDIFTVAEIFEERGIL--------------------------
TRPB_SHEPA       -------ILVVNLSGRGDKDIFTVADILEQQKVEQQEAEQQQTNNQNN------------
TRPB_SHEHH       -------LLVVNLSGRGDKDIFTVADILEQQKVEQQKVEQQKADNQNTEKNNQESGNE--
TRPB_SHELP       -------LLVVNLSGRGDKDIFTVADILEKQQANNEESGNE-------------------
TRPB_SHESM       -------ILVVNLSGRGDKDIFTVSDILNGK----EE-----------------------
TRPB_SHESA       -------ILVVNLSGRGDKDIFTVSDILNGK----EE-----------------------
TRPB_SHESR       -------ILVVNLSGRGDKDIFTVSDILNGK----EE-----------------------
TRPB_SHEON       -------ILVVNLSGRGDKDIFTVSDILNGK----EE-----------------------
TRPB_SHEB8       -------ILVVNLSGRGDKDIFTVSDILNGK----EV-----------------------
TRPB_SHEB5       -------ILVVNLSGRGDKDIFTVSDILNGK----EV-----------------------
TRPB_SHESW       -------ILVVNLSGRGDKDIFTVSDILNGK----EV-----------------------
TRPB_SHEPC       -------ILVVNLSGRGDKDIFTVSDILNGK----EV-----------------------
TRPB_SHEB9       -------ILVVNLSGRGDKDIFTVSDILNGK----EE-----------------------
TRPB_SHEFN       -------ILVVNLSGRGDKDIFTVADILEAKQKQQESGNE--------------------
TRPB_SHEDO       -------ILVVNLSGRGDKDIFTVSDILAAK--EQESGND--------------------
TRPB_SHEAM       -------IIVVNLSGRGDKDIFTVSDILDGK----ASA----------------------
TRPB_PSEA6       -------IIVVNLSGRGDKDLAHVHSILGGQTNE--------------------------
TRPB_HELPY       -------IIVVNLSGRGDKDLSTVYNALKGGLK---------------------------
TRPB_HELPJ       -------IIVVNLSGRGDKDLSTVYNALKGGLK---------------------------
TRPB_CORGL       ------LTILVSLSGRGDKDVDHVRRTLEENPELILKDNR--------------------
TRPB_CORGB       ------LTILVSLSGRGDKDVDHVRRTLEENPELILKDNR--------------------
TRPB1_COREF      ------ITILVSLSGRGDKDVDHIRRTLEEKPELILKEEER-------------------
TRPB2_COREF      ------INILVNLSGRGDKDVAYVRQLLGDHAALDPATDVLTEVDVLGVLEELTPQADTA
TRPB_METJA       -----DDIMVINLSGRGDKDVQTVAKALGREI----------------------------
TRPB_METKA       -----GDVVVVNLSGRGDKDVRIAAEELGVEI----------------------------
TRPB1_METTH      -----GKTVIVNLSGRGDKDMFMVAGLLGVGV----------------------------
TRPB2_METTM      -----GKTVIVNLSGRGDKDMFLAAGLLGVDL----------------------------
TRPB1_METMA      ----LGEFVVVNLSGRGDKDLETVLSLKRGI-----------------------------
TRPB1_METAC      ----LGEFVVVNLSGRGDKDLETVLSLRRGV-----------------------------
TRPB_HALVD       NADDLGEYVVVNVSGRGDKDLESAIEETYERDIDIAPNMDEFTGGL--------------
TRPB_HALSA       --------VVVNVSGRGDKDLDTVIEASAANDIDAAPDMEVFEQ----------------
TRPB1_THEMA      ----KGKVVVVNLSGRGDKDLESVLNHPYVRERIR-------------------------
TRPB_METVO       ------DIMVINLSGRGDKDLNTVINAVHKLGC---------------------------
TRPB_META3       ------EIIIINLSGRGDKDIHTVMNFIEF------------------------------
TRPB1_PYRFU      ------EIIIVNLSGRGDKDLDIVLKVSGNV-----------------------------
TRPB1_PYRAB      ------DVIIVNLSGRGDKDLDIVLKVSGNV-----------------------------
TRPB1_THEKO      ------EIIIVNLSGRGDKDLDIVRRV-GNV-----------------------------
TRPB1_ARCFU      ------DVLVVNLSGRGDKDMDIVRRRLA-------------------------------
TRPB2_CHLCV      -------VVVVNLSGRGDKDLEQITNLIKAGNNE--------------------------
TRPB1_CHLCV      -------IAIVNLSGRGDKDLSQIIDLDKRKKHS--------------------------
TRPB2_WOLSU      ---FKDKVVIVSLSGRGDKDMIQAKNLLNFH-----------------------------
TRPB_BACTN       ---PED-VVVLTVSGRGDKDIETYLSFNEK------------------------------
TRPB_HELHP       -----GKKIIANISGRGDKDIFITAKALTPEHWKTFLSEEIARIG---------------
TRPB2_AQUAE      -----EKVILFNLSGHGYFDLSAYDKYLHGELTD--------------------------
TRPB2_ARCFU      -----EKVIVFGFSGHGLLDLQAYDDYLAGRLADT-------------------------
TRPB2_METMA      -----EKVILFNLSGHGHFDMASYDKYFSGELE---------------------------
TRPB2_METAC      -----EKTILFNLSGHGHFDMSSYDKYFSGELM---------------------------
TRPB2_THEMA      -----ERVIVFTLSGHGLLDLTAYV-----------------------------------
TRPB2_METTH      -----EKTIVISFSGHGLLDLKGYGDYLEGKI----------------------------
TRPB2_PYRAB      -----EMVILFNLSGHGLLDLKGYEDYLDGKLEDYEPRDLPVKS----------------
TRPB2_PYRFU      -----EIVILFNLSGHGLLDLHGYEEYLEGRLQDYEPKDLPISNPLNPKP----------
TRPB_PYRHO       -----ETVILFNLSGHGLLDLKGYEDYLEGKLEDYEPQILNLSMAPRPPNAL--------
TRPB2_THEKO      -----EEVILFNLSGHGFLDLKGYEDYLDGKLEDYEPEHFPALDNY--------------
TRPB2_AERPE      -----RVVIAFNLSGHGLLDLQGYREYLDGTLEDYEPEEIPASRR---------------
TRPB1_SACS2      -----RKVIVFNLSGHGLLDLSNYESMMKRLNGNG-------------------------
TRPB1_SULTO      -----RRVIVFNLSGHGLLDLGNYESIRRRVEK---------------------------
TRPB_PICTO       -----KKTLLINVSGHGLLDLSIFSD----------------------------------
TRPB2_SACS2      -----RKTVLVSFSGHGLLDLGNYASVLFKE-----------------------------
TRPB2_SULTO      -----KKTVLISFSGHGLLDLANYADVLGFNKE---------------------------
TRPB_THEAC       -----KKTVLVSFSGHGLLDLGNYAEALHFE-----------------------------
TRPB_THEVO       -----KKTVLVSFSGHGLLDLGNYAEAMHFE-----------------------------
TRPB1_AERPE      -----GSVVAFNLSGHGLLDLDALQKALEIRGASMW------------------------
TRPB_PYRAE       -----GSVIAFNLSGHGLLDSDAYEKFLG-------------------------------
                              .     .                                        

TRPB1_WOLSU      ----------------------------
TRPB2_VIBPA      ----------------------------
TRPB_CALS4       ----------------------------
TRPB_CLOAB       ----------------------------
TRPB_CLOB8       ----------------------------
TRPB_FUSNN       ----------------------------
TRPB_CLONN       ----------------------------
TRPB_LACP3       ----------------------------
TRPB_LACCA       ----------------------------
TRPB_LACPL       ----------------------------
TRPB_CAMJR       ----------------------------
TRPB_CAMJE       ----------------------------
TRPB_CAMJ8       ----------------------------
TRPB_CAMJJ       ----------------------------
TRPB_CAMJD       ----------------------------
TRPB_THET2       ----------------------------
TRPB_THET8       ----------------------------
TRPB_DEIRA       ----------------------------
TRPB_CHLTE       ----------------------------
TRPB1_AQUAE      ----------------------------
TRPB_BRASB       ----------------------------
TRPB_BRASO       ----------------------------
TRPB_BRADU       ----------------------------
TRPB_PARL1       ----------------------------
TRPB_CAUVC       ----------------------------
TRPB_ACICJ       ----------------------------
TRPB_NOVAD       ----------------------------
TRPB_RHOS4       ----------------------------
TRPB_RUEST       ----------------------------
TRPB_RUEPO       ----------------------------
TRPB_DINSH       ----------------------------
TRPB_ROSDO       ----------------------------
TRPB_JANSC       ----------------------------
TRPB_PARDP       ----------------------------
TRPB_BRUSU       ----------------------------
TRPB_BRUC2       ----------------------------
TRPB_BRUSI       ----------------------------
TRPB_BRUAB       ----------------------------
TRPB_BRUA2       ----------------------------
TRPB_BRUME       ----------------------------
TRPB_OCHA4       ----------------------------
TRPB_RHILO       ----------------------------
TRPB_RHIEC       ----------------------------
TRPB_RHIL3       ----------------------------
TRPB_SINMW       ----------------------------
TRPB_RHIME       ----------------------------
TRPB_AGRFC       ----------------------------
TRPB_CHESB       ----------------------------
TRPB_PSEPF       ----------------------------
TRPB_PSESY       ----------------------------
TRPB_PSEF5       ----------------------------
TRPB_PSEAE       ----------------------------
TRPB_PSESH       ----------------------------
TRPB_PSE14       ----------------------------
TRPB_PSEU2       ----------------------------
TRPB_PSESM       ----------------------------
TRPB_PSEPU       ----------------------------
TRPB_PSEPG       ----------------------------
TRPB_PSEPK       ----------------------------
TRPB_PSEP1       ----------------------------
TRPB_PSEE4       ----------------------------
TRPB_ACICA       ----------------------------
TRPB_ACIAD       ----------------------------
TRPB_LEGPA       ----------------------------
TRPB_LEGPL       ----------------------------
TRPB_LEGPH       ----------------------------
TRPB_LEGPC       ----------------------------
TRPB_BORBR       ----------------------------
TRPB_BORPA       ----------------------------
TRPB_BORPE       ----------------------------
TRPB_RALSO       ----------------------------
TRPB_POLNA       ES-------FDASGAKGAGSQS------
TRPB_POLSJ       FSDGPPLGKLAPSGGSAVREATSVGARK
TRPB_ACIAC       ----------------------------
TRPB_METPP       ----------------------------
TRPB_METFK       ----------------------------
TRPB_NITEU       ----------------------------
TRPB_NITEC       ----------------------------
TRPB_NITMU       ----------------------------
TRPB_METCA       ----------------------------
TRPB_XANAC       ----------------------------
TRPB_XANC5       ----------------------------
TRPB_XANOM       ----------------------------
TRPB_XANCP       ----------------------------
TRPB_XANC8       ----------------------------
TRPB_XYLFA       ----------------------------
TRPB_XYLFT       ----------------------------
TRPB_VESOH       ----------------------------
TRPB_RUTMC       ----------------------------
TRPB_NEIG1       ----------------------------
TRPB_NEIGO       ----------------------------
TRPB_NEIMF       ----------------------------
TRPB_NEIMA       ----------------------------
TRPB_NEIMB       ----------------------------
TRPB_NEIM0       ----------------------------
TRPB_CHRVO       ----------------------------
TRPB_RHOBA       ----------------------------
TRPB_GEOSE       ----------------------------
TRPB_GEOTN       ----------------------------
TRPB_BACVZ       ----------------------------
TRPB_BACSU       ----------------------------
TRPB_BACLD       ----------------------------
TRPB_BACP2       ----------------------------
TRPB_BACHD       ----------------------------
TRPB_BACSK       ----------------------------
TRPB_BACAN       ----------------------------
TRPB_BACHK       ----------------------------
TRPB_BACAH       ----------------------------
TRPB_BACCZ       ----------------------------
TRPB_BACCR       ----------------------------
TRPB_BACC1       ----------------------------
TRPB_OCEIH       ----------------------------
TRPB_LACLS       ----------------------------
TRPB_LACLM       ----------------------------
TRPB_LACLA       ----------------------------
TRPB_STRR6       ----------------------------
TRPB_STRP2       ----------------------------
TRPB_STRPN       ----------------------------
TRPB_STRT2       ----------------------------
TRPB_STRT1       ----------------------------
TRPB_STRTD       ----------------------------
TRPB_STRMU       ----------------------------
TRPB_LISMF       ----------------------------
TRPB_LISMO       ----------------------------
TRPB_LISIN       ----------------------------
TRPB_LISW6       ----------------------------
TRPB_STAAN       ----------------------------
TRPB_STAA1       ----------------------------
TRPB_STAAM       ----------------------------
TRPB_STAA9       ----------------------------
TRPB_STAA2       ----------------------------
TRPB_STAAR       ----------------------------
TRPB_STAAB       ----------------------------
TRPB_STAAE       ----------------------------
TRPB_STAA8       ----------------------------
TRPB_STAA3       ----------------------------
TRPB_STAAW       ----------------------------
TRPB_STAAT       ----------------------------
TRPB_STAAC       ----------------------------
TRPB_STAAS       ----------------------------
TRPB_STAS1       ----------------------------
TRPB_STAEQ       ----------------------------
TRPB_STAES       ----------------------------
TRPB_LEPIC       ----------------------------
TRPB_LEPIN       ----------------------------
TRPB_LEPBJ       ----------------------------
TRPB_LEPBL       ----------------------------
TRPB2_NOSS1      ----------------------------
TRPB_TRIV2       ----------------------------
TRPB1_NOSS1      ----------------------------
TRPB_TRIEI       ----------------------------
TRPB_THEEB       ----------------------------
TRPB_SYNY3       ----------------------------
TRPB_SYNJB       ----------------------------
TRPB_GLOVI       ----------------------------
TRPB_PROM1       ----------------------------
TRPB_PROMT       ----------------------------
TRPB_PROMA       ----------------------------
TRPB_SYNPW       ----------------------------
TRPB_PROMM       ----------------------------
TRPB_SYNSC       ----------------------------
TRPB_SYNPX       ----------------------------
TRPB_SYNS9       ----------------------------
TRPB_SYNS3       ----------------------------
TRPB_PROMP       ----------------------------
TRPB_PROM5       ----------------------------
TRPB_PROMS       ----------------------------
TRPB_PROM0       ----------------------------
TRPB_PROM9       ----------------------------
TRPB_PROM2       ----------------------------
TRPB_MYCTU       ----------------------------
TRPB_MYCBO       ----------------------------
TRPB_MYCLE       ----------------------------
TRPB_MYCIT       ----------------------------
TRPB_STRAW       AK--------------------------
TRPB_STRCO       AK--------------------------
TRPB_LEIXX       ----------------------------
TRPB_SHIFL       ----------------------------
TRPB_ECOLC       ----------------------------
TRPB_SHIF8       ----------------------------
TRPB_ECOLI       ----------------------------
TRPB_ECO24       ----------------------------
TRPB_ECOHS       ----------------------------
TRPB_SHISS       ----------------------------
TRPB_ECO57       ----------------------------
TRPB_SHIBS       ----------------------------
TRPB_ECOK1       ----------------------------
TRPB_ECOUT       ----------------------------
TRPB_SHIDS       ----------------------------
TRPB_ECOL5       ----------------------------
TRPB_ECOL6       ----------------------------
TRPB_CITK8       ----------------------------
TRPB_SALTY       ----------------------------
TRPB_SALPB       ----------------------------
TRPB_SALTI       ----------------------------
TRPB_SALPA       ----------------------------
TRPB_SALCH       ----------------------------
TRPB_SALAR       ----------------------------
TRPB_CROS8       ----------------------------
TRPB_KLEP7       ----------------------------
TRPB_ENT38       ----------------------------
TRPB_PECAS       ----------------------------
TRPB_YERPA       ----------------------------
TRPB_YERPS       ----------------------------
TRPB_YERPN       ----------------------------
TRPB_YERPP       ----------------------------
TRPB_YERP3       ----------------------------
TRPB_YERPE       ----------------------------
TRPB_YERE8       ----------------------------
TRPB_SERP5       ----------------------------
TRPB_SODGM       ----------------------------
TRPB_PHOLL       ----------------------------
TRPB_HAEIN       ----------------------------
TRPB_HAEIE       ----------------------------
TRPB_HAEIG       ----------------------------
TRPB_HAEI8       ----------------------------
TRPB_ACTSZ       ----------------------------
TRPB_HISS2       ----------------------------
TRPB_ACTP2       ----------------------------
TRPB_PASMU       ----------------------------
TRPB_MANSM       ----------------------------
TRPB_BUCAP       ----------------------------
TRPB_BUCAI       ----------------------------
TRPB_BUCDN       ----------------------------
TRPB_BUCMH       ----------------------------
TRPB_BUCSC       ----------------------------
TRPB_BUCBP       ----------------------------
TRPB_BLOPB       ----------------------------
TRPB_BLOFL       ----------------------------
TRPB1_VIBPA      ----------------------------
TRPB_VIBCB       ----------------------------
TRPB_VIBVU       ----------------------------
TRPB_VIBVY       ----------------------------
TRPB_ALIF1       ----------------------------
TRPB_VIBC3       ----------------------------
TRPB_VIBCH       ----------------------------
TRPB_VIBME       ----------------------------
TRPB_PHOPR       ----------------------------
TRPB_FRAT1       ----------------------------
TRPB_FRATT       ----------------------------
TRPB_FRATH       ----------------------------
TRPB_FRATF       ----------------------------
TRPB_FRATO       ----------------------------
TRPB_FRATW       ----------------------------
TRPB_FRATN       ----------------------------
TRPB_FRAP2       ----------------------------
TRPB_AERHH       ----------------------------
TRPB_AERS4       ----------------------------
TRPB_PSYIN       ----------------------------
TRPB_SHEPA       ----------------------------
TRPB_SHEHH       ----------------------------
TRPB_SHELP       ----------------------------
TRPB_SHESM       ----------------------------
TRPB_SHESA       ----------------------------
TRPB_SHESR       ----------------------------
TRPB_SHEON       ----------------------------
TRPB_SHEB8       ----------------------------
TRPB_SHEB5       ----------------------------
TRPB_SHESW       ----------------------------
TRPB_SHEPC       ----------------------------
TRPB_SHEB9       ----------------------------
TRPB_SHEFN       ----------------------------
TRPB_SHEDO       ----------------------------
TRPB_SHEAM       ----------------------------
TRPB_PSEA6       ----------------------------
TRPB_HELPY       ----------------------------
TRPB_HELPJ       ----------------------------
TRPB_CORGL       ----------------------------
TRPB_CORGB       ----------------------------
TRPB1_COREF      ----------------------------
TRPB2_COREF      ----------------------------
TRPB_METJA       ----------------------------
TRPB_METKA       ----------------------------
TRPB1_METTH      ----------------------------
TRPB2_METTM      ----------------------------
TRPB1_METMA      ----------------------------
TRPB1_METAC      ----------------------------
TRPB_HALVD       ----------------------------
TRPB_HALSA       ----------------------------
TRPB1_THEMA      ----------------------------
TRPB_METVO       ----------------------------
TRPB_META3       ----------------------------
TRPB1_PYRFU      ----------------------------
TRPB1_PYRAB      ----------------------------
TRPB1_THEKO      ----------------------------
TRPB1_ARCFU      ----------------------------
TRPB2_CHLCV      ----------------------------
TRPB1_CHLCV      ----------------------------
TRPB2_WOLSU      ----------------------------
TRPB_BACTN       ----------------------------
TRPB_HELHP       ----------------------------
TRPB2_AQUAE      ----------------------------
TRPB2_ARCFU      ----------------------------
TRPB2_METMA      ----------------------------
TRPB2_METAC      ----------------------------
TRPB2_THEMA      ----------------------------
TRPB2_METTH      ----------------------------
TRPB2_PYRAB      ----------------------------
TRPB2_PYRFU      ----------------------------
TRPB_PYRHO       ----------------------------
TRPB2_THEKO      ----------------------------
TRPB2_AERPE      ----------------------------
TRPB1_SACS2      ----------------------------
TRPB1_SULTO      ----------------------------
TRPB_PICTO       ----------------------------
TRPB2_SACS2      ----------------------------
TRPB2_SULTO      ----------------------------
TRPB_THEAC       ----------------------------
TRPB_THEVO       ----------------------------
TRPB1_AERPE      ----------------------------
TRPB_PYRAE       ----------------------------