CLUSTAL format seed alignment for MF_00134_B

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

TRPC_LEPIC       ----------------------MSSSQPHRVLREIISTKQNEIKKISAW-----------
TRPC_THEMA       ----------------------------MRRLWEIVEAKKKDILEIDGE-----------
TRPC_CHLTE       ----------------------------MTYLTRILETKAREVAELKKLKPERRYREACG
TRPC_LACCA       -----------------------------MILDDLVAVTKIRLARHQRQQSLADLKQTVA
TRPC_PSEAE       -------------------------MSVPTVLQKILARKAEEVAERRARVNLAEVERLAR
TRPC_PSEPU       -------------------------MSVPTVLERIIARKFQEVAERSARVSLAELERLAK
TRPC_ACIAD       -----------------------MIQIQNTILGKIVDRKHEELADRLKQRNLKDVEQWVK
TRPC_RHOCB       ---------------------------MTNILDRIKAYKLEEVAAAKARVSFADLEAQAR
TRPC_RHOS4       ---------------------------MSTILDRIKAYKLEEIAARKAERPLVAVEDAAR
TRPC_AZOBR       ---------------------------MSDVLTRICDDKRALVQARKSARPLSAVEDDAR
TRPC_BRADU       ---------------------------MSDILTKIETYKREEIAAAKRAQPLSVVEATAK
TRPC_ZYMMT       ---------------------------MSNILTEICATKARHVADKKKHISETDLYNLTK
TRPC_SYNY3       MEIRRRPPNPPIKVDILQYQIKHPEAAPRHILEEIVWHKEKEVAQRRELVPLVKLQSLVK
TRPC_BACMQ       ------------------------------MLNKIIETKKEEIQNLQLP---------EQ
TRPC_BACSU       ------------------------------MLEKIIKQKKEEVKTLVLP---------VE
TRPC_MYCTU       -------------------------MSPATVLDSILEGVRADVAAREASVSLSEIKAAAA
TRPC_MYCLE       -------------------------MCPATVLDSILKGVRADVAAREACISLSEIKAAAA
TRPC1_STRCO      ----------------------------MSVLDEIIDGVRADLAERQARVSLDELKERAA
TRPC2_STRCO      ---------------------------MSGILAGLVAEAESQTGRRRALRTEAKLTELAA
TRPC_DEIRA       -----------------MTFSPPDLSRVPGVLGRIVTEREADY--RNADASLGEARAPHR
TRPC_AQUAE       ----------------------------MGFLEEVRSYK--ESQIDTSPEYLRKLEELIE
TRPC_LISMO       ----------------------------------MTFLEEILAQKEVEVAKMPLEQVAEK
TRPC_LACLA       -----------------------------MNIKKGKFLETILAEKRLEIAKMPEEQVGKV
TRPC_STAS1       ----------------------------MTILDEIVDYKRNLIKEGYYEEKLKTLNEVDI
TRPC_STAAN       ----------------------------MTILAEIVKYKQSLLQNGYYQDKLNTLKSVKI
TRPC_STAEQ       ----------------------------MTILNEIIEYKKTLLERKYYDKKLEILQDNGN
TRPC_STAHJ       ----------------------------MTILSEIVDYKEQLLKDGYYHDKLQNLKGVKH
TRPC_BUCAP       --------------------------MQETILNKIIKDKIDWIKYRKKIQPLIKFKNKIN
TRPC_BUCDN       --------------------------MKETILEKIVKNKYEWIKFRKKKQPLITFKNHIN
TRPC_BUCSC       -------------------------MVLENILEKIVKSKINWIKHRKKIQPLSSFQHNIT
TRPC_ECOLI       --------------------------MMQTVLAKIVADKAIWVEARKQQQPLASFQNEVQ
TRPC_SALTY       ---------------------------MQTVLAKIVADKAIWVEARKQQQPLASFQNEIQ
TRPC_VIBPA       ---MKMTDFNTQQANNLSEHVSKKEAEMAEVLAKIVRDKYQWVAERKASQHLSTFQSDLL
TRPC_HAEIN       ---------------MMITQDFTKPIDSATVLQKIVLDKAQWVKAKEKEFPLSQFKQNIQ
TRPC_HELPY       ---------------------------MPSVLENILKDKLLEVSDLKKNH---ALPININ
TRPC_HELPJ       ---------------------------MPSVLENILKDKLLEVAVLKKNH---ALPINIA
                                                                             

TRPC_LEPIC       DPLPHR-GLSLRDSLKSRT-FSIIAECKRKSPSAGELRADYRPVQIAKTYEELGASAISV
TRPC_THEMA       NLIVQRRNHRFLEVLSGKERVKIIAEFKKASPSAGDINADASLEDFIRMYDEL-ADAISI
TRPC_CHLTE       DLPATRDFRSAITSRDGG--INLIAEVKKASPSRGVLVEDFRPLDIAARYAELGASAFSV
TRPC_LACCA       KMPRNHKPDFLIRLKQPG--LHVIAEVKKASPSKGTIVTDFPYLAIAKAYDQAGADAISV
TRPC_PSEAE       SADAPRGFANALLERAKRKEPAVIAEIKKASPSKGVLREHFVPAEIARSYEAGGAACLSV
TRPC_PSEPU       TADAPRGFANALIEQAKRKQPAVIAEIKKASPSKGVIREHFVPAEIAVSYEKGGATCLSV
TRPC_ACIAD       EAPPVRGFAQSL--RSKR--PGVIAEIKKASPSKGVIRADFNPAEIAQQYEQAGAACLSV
TRPC_RHOCB       AQAPCRGFAEALRKKSAQG-YGLIAEIKKASPSKGLIRPDFDPPALARAYEDGGAACLSV
TRPC_RHOS4       AAPAPRGFARALSTAAATG-YGLIAEIKKASPSKGLIREDFDVPALARAYETGGATCLSV
TRPC_AZOBR       SADPAGGFIRALRRTVDGGRYGLIAEIKKASPSKGLIRPDFDPPSLARAYRGGGATCLSV
TRPC_BRADU       AQGAPRGFLRAIKAKHTNGDFALIAEVKKASPSKGLIRADFDPPQLAKAYEAGGAACLSV
TRPC_ZYMMT       NQTAPRGFRAALDKKRAEGKFSLIAEIKKASPSKGLIRPDFEPILHARSYQEGGAACLSV
TRPC_SYNY3       DMTPPLDFVGALRQSPRQ--PALIAEVKKASPSKGIIRADFDPVAIAKAYEAGGANCLSV
TRPC_BACMQ       QNVAKRSFLDALSNPNRE--LALIAEVKKASPSKGLIKENFQPVEIAKAYEKGKADALSV
TRPC_BACSU       QPFEKRSFKEALASPNRF--IGLIAEVKKASPSKGLIKEDFVPVQIAKDYEAAKADAISV
TRPC_MYCTU       AAPPPLDVMAALREPGIG----VIAEVKRASPSAGALATIADPAKLAQAYQDGGARIVSV
TRPC_MYCLE       AAPAPLDAMAALREPGIG----VIAEVKRASPSVGSLATIADPAKLAQAYEDGGARIISV
TRPC1_STRCO      KARPAKDGVAALRGDGVK----VICEVKRSSPSKGALAAIADPAGLAADYEAGGAAVISV
TRPC2_STRCO      AAPPARDFAAALREPGLA----VIAEMKPRSPSKGPLTDDYRPAELARAYQGGGAHAVSV
TRPC_DEIRA       RFEQALRLSPDDRGARLA----LIAEVKQASPSEGAIAAL-DPAQAARAYAEGGAAAISC
TRPC_AQUAE       ERKEFYDFEKALTSCGTK----IIAEVKKASPSEG-NIKEVNPEEQAKLYEKAGAIAISV
TRPC_LISMO       RKTYSFYEFLKA----NTNTMQLIAEVKRASPSKGEINMGVNPVLQAKSYQAAGAGMISV
TRPC_LACLA       RQTYNFYDYLKE----HSDQLQVIAEVKKASPSLGDINLEVDIVDQAKNYEQAGAAMISV
TRPC_STAS1       THKSSFKSQLD-----ESNQLAVIAEIKSKSPTLDQLP-NRDLAQQVKDYEANGANAVSI
TRPC_STAAN       QNKKSFINAIE-----KEPKLAIIAEIKSKSPTVNDLP-ERDLSQQISDYEKYGANAVSI
TRPC_STAEQ       VKRRKLIDSLN-----YDRTLSVIAEIKSKSPSVPQLP-QRDLVQQVKDYQKYGANAISI
TRPC_STAHJ       KNKSRLTDALI-----KNDNLTLIAEIKSKSPSVKAFQ-QTNIIKQVSDYERYGANAISV
TRPC_BUCAP       KETRNFYNSLKE------KRPFFILECKKSSPSLGIIRKKFNLIEIANIYKNY-ASAISV
TRPC_BUCDN       TKTRNFYNSLKE------KNPVFILECKKKSPSLGIIKKNFNLIDIAKIYNKY-ASAISV
TRPC_BUCSC       LSDRNFIQALKN------IHPALILEFKKHSPSLGIL-NDFNPEFVAKIYKKY-ASAISV
TRPC_ECOLI       PSTRHFYDALQG------ARTAFILECKKASPSKGVIRDDFDPARIAAIYKHY-ASAISV
TRPC_SALTY       PSTRHFYDALQG------ARTAFILECKKASPSKGVIRDDFDPARIASIYQHY-ASAISV
TRPC_VIBPA       PSDRSFYDALSG------DKTVFITECKKASPSKGLIRNDFDLDYIASVYNNY-ADAISV
TRPC_HAEIN       NSDRSFYDALAKG---THQKPAYILECKKASPSKGLIRAEFNLEEIANVYKHY-ASAVSV
TRPC_HELPY       PSDRDFKKALLE------KKTSFILECKKASPSKGLIRKDFDLLKITKTYEKF-ASCISV
TRPC_HELPJ       PSDRDFKKALLE------KKTSFILEYKKASPSKGLIRKDFDLLEITKTYEKF-ASCVSV
                                        * * *  **:                *    *  .* 

TRPC_LEPIC       LTDQNYFGGSLEDLKDVSS-ELKIPVLRKDFILDEIQIREARAFGASAILLIVRILTPE-
TRPC_THEMA       LTEKHYFKGDPAFVRAARN-LTCRPILAKDFYIDTVQVKLASSVGADAILIIARILTAE-
TRPC_CHLTE       LTDSHYFQGSPDYLKAITQ-QFSIPVLRKEFIIDESQIYETRLMGADAALLIVAALEPS-
TRPC_LACCA       LTEPDYFNGHLHYLKEISQ-QVSVPTLRKDFTIDPYMIYEAKANGAVIILLIVAILTDQ-
TRPC_PSEAE       LTDVDFFQGADAYLKEARA-ACALPVIRKDFMIDPYQIVEARAIGADCILLIVSALDDV-
TRPC_PSEPU       LTDVDYFQGADEYLQQARA-AVSLPVIRKDFMVDPYQIVEARALGADCVLLIVSALDDV-
TRPC_ACIAD       LTDVDFFQGADENIAIARQ-HCSLPALRKDFLIDPYNVVEARALQADCILLIVACLSDQ-
TRPC_RHOCB       LTDTPSFQGAPDYLIAARN-ACALPALRKDFLYDPYQVAEARAWGADCILIIMASVEDA-
TRPC_RHOS4       LTDGPSFQGADDFLRQARE-AVKLPCLRKDFLYDTYQVAEARALGADCILIIMASVTDS-
TRPC_AZOBR       LTDEPYFQGCDDYLLSARA-AVDLPVLRKDFMVDPYQIAESRALGADCILIIMAALSDA-
TRPC_BRADU       LTDTPSFQGHLDFMVAARA-ATSLPVLRKDFMFDAYQVVEARAHGADCILIIMAALDDA-
TRPC_ZYMMT       LTDQPYFQGHEDYLIAARN-EVTLPVLRKDFMIDPWQVTEARAIGADAILIIVAALEDN-
TRPC_SYNY3       LTDEKFFQGSFENLQLVRS-AVQLPLLCKEFIIYPYQIYLARSRGADAVLLIAAILSDK-
TRPC_BACMQ       LTDQHYFQGHRTFLSDIKQ-HVSVPVLRKDFIIDSIQVEESARIGADAILLIGEALEPL-
TRPC_BACSU       LTDTPFFQGENSYLSDVKR-AVSIPVLRKDFI-DSLQVEESRRIGADAILLIGEVLDPL-
TRPC_MYCTU       VTEQRRFQGSLDDLDAVRA-SVSIPVLRKDFVVQPYQIHEARAHGADMLLLIVAALEQS-
TRPC_MYCLE       LTEERRFNGSLDDLDAVRA-AVSVPVLRKDFVVQPYQIHEARAHGADMLLLIVAALDQS-
TRPC1_STRCO      LTEERRFGGSLADLDSVRA-RVDIPVLRKDFIVTSYQLWEARAHGADLVLLIVAALEQP-
TRPC2_STRCO      LTHEAGFGGSPDHLAVARA-ACELPVLRKDFVVDEYQILEARALGADALLLIVAALAPA-
TRPC_DEIRA       LTEPRHFGGSPEALRAVVA-ASEVPVLRKDFVVHPAMLREAAEWGAGAALLMVSVLGE--
TRPC_AQUAE       LTDEKYFKGSLEDLRNVRE-SVKLPLLRKDFTVHKVQILEAKAYGADIVLLIVRMLSDK-
TRPC_LISMO       LTDPVFFKGSIEDLREVAK-NVGIPVLCKDFIISEKQLIRARNAGATVVLLIISALTEE-
TRPC_LACLA       LTDPVFFKGNIEYLCEISE-NVQIPTLNKDFIIDKKQINRAVNAGATVILLIVAVFENQY
TRPC_STAS1       LTDEHYFGGSYERLQDLTL-QTTLPVLCKDFVVDKIQIDVAKKAGASIILLIVNVLTDQ-
TRPC_STAAN       LTDEKYFGGSFERLQALTT-KTTLPVLCKDFIIDPLQIDVAKQAGASMILLIVNILSDK-
TRPC_STAEQ       LTDEKYFGGSFERLNQLSK-ITSLPVLCKDFIIDKIQIDVAKRAGASIILLIVNILSDD-
TRPC_STAHJ       LTDERYFGGSFERLQQISE-TTQLPVLCKDFIIDPLQIDVAQKAGASIILLIVNILTDE-
TRPC_BUCAP       LTDEKYFHGNIEYINVVRR-CVSQPILCKDFFIDSYQVYLARYYSADAILLMLSVLNDS-
TRPC_BUCDN       LTDEKYFDGKLEFINIVRE-RVSQPILCKDFFIDPFQIYLARYYNADAILLMLSILDDF-
TRPC_BUCSC       LTDEKYFHGKFEFIPIIRNIAVQQPILCKDFFIDPYQIYLARYYQADSILLMLSILKDN-
TRPC_ECOLI       LTDEKYFQGSFNFLPIVSQ-IAPQPILCKDFIIDPYQIYLARYYQADACLLMLSVLDDD-
TRPC_SALTY       LTDEKYFQGSFDFLPVVSQ-SAPQPILCKDFIIDPYQIYLARYYQADACLLMLSVLDDE-
TRPC_VIBPA       LTDEKYFQGSFDFLPQVRR-QVKQPVLCKDFMVDTYQVYLARHYGADAVLLMLSVLNDE-
TRPC_HAEIN       LTDEKYFQGNFEFLPLVRD-IVSQPVLCKDFMISEYQVYLARYYQVDAILLMLSVVNDE-
TRPC_HELPY       LADSKYFLGSYENIKIVSQ-HSTKPILCKDFIIDAFQIKLARMMGANAVLLMLSVLDDK-
TRPC_HELPJ       LADSKYFLGSYENIKIVSQ-HSTKPILCKDFIIDAFQIKLARVMGSNAVLLMLSVLDDK-
                 ::.   * *    :          * : *:*      :  :        *::   .    

TRPC_LEPIC       -QIKSFLKLASSLGMDCLVEVHTSDEAKLALDC-GAEIIGINTRDLDTFQIHQNLVEEVS
TRPC_THEMA       -QIKEIYEAAEELGMDSLVEVHSREDLEKVFSVIRPKIIGINTRDLDTFEIKKNVLWELL
TRPC_CHLTE       -QLRDYLQLFAELGLHALVEVHDRRELDIA-IEQGSTIVGVNNRDLRDFTVDLMTSVNLK
TRPC_LACCA       -QLRDYRQLAEKLGMHAIVEAYTAAEVTRA-LQSGAKIIGINNRNLKDFRVDFTNSLKLR
TRPC_PSEAE       -LMAELAATAKSVGLDVLVEVHDGTELERALKTLDTPLVGINNRNLHTFEVSLETTLDLL
TRPC_PSEPU       -KMAELAATAKDVGLDVLVEVHDGDELERALKTLDTPLVGVNNRNLHTFEVSLETTLDLL
TRPC_ACIAD       -QLEEMSKTAFEYDLDVLVEVHDEQELERALKLSEQCLLGVNNRNLKTFDVDLNTSLRLK
TRPC_RHOCB       -LAVELEAAATGWGMDVLIEVHDGAELDRALKWLKSPLLGVNNRNLKTFEVTLDVTRQLA
TRPC_RHOS4       -QALELEAAASHWGMDVLVEVHSREELARA-EHLKSRLIGINNRNLDTFEVSLDVTRDLA
TRPC_AZOBR       -QAVEIEDAAIAWGLDVLVEVHNREELDRA-LALKTPLLGVNNRNLKTLAVDIATTEELA
TRPC_BRADU       -TAKDLEDTAIAFGMDVLIEIHDRAELDRA-LKLRSPMIGVNNRNLRTFETTLATSEALA
TRPC_ZYMMT       -QMQEIEAAALEYGMDALIEVHSTQEMERA-LRLKSRLIGVNNRDLRDFSVSFDRTYELI
TRPC_SYNY3       -DLRYFLKIIEGLGMAALVEVHTLEEMDRVLALDGVQLIGVNNRNLQTFTVDLQTTEDLF
TRPC_BACMQ       -KLQELYLQAAEKELDCLVEVHSLETLEKLLAVFTPKIIGINNRNLHTFETSLQQTKEIA
TRPC_BACSU       -HLHELYLEAGEKGMDVLVEVHDASTLEQILKVFTPDILGVNNRNLKTFETSVKQTEQIA
TRPC_MYCTU       -VLVSMLDRTESLGMTALVEVHTEQEADRA-LKAGAKVIGVNARDLMTLDVDRDCFARIA
TRPC_MYCLE       -ALMSMLDRTESLGMIALVEVRTEQEADRA-LKAGAKVIGVNARDLMTLEVDRDCFSRIA
TRPC1_STRCO      -ALESLIERAESIGLTPLVEVHDEDEVERA-VDAGAKVIGVNARNLKTLEVDRGTFERVA
TRPC2_STRCO      -RLAALLARTRACGMEALVEVHDEREVDVA-LEAGADVIGVNHRDLRDFSIDRTLSARLR
TRPC_DEIRA       -RLPEFLAMTEHLGLDALVEVHDERELDIA-LAAGPRILGINNRDLTTLKIDLGVSPHLM
TRPC_AQUAE       -ELKELLDFSEELGLSPLVEVFTLDEAKRA-LDAGAKIIGINNRDLETFKVDINKTKELA
TRPC_LISMO       -KLITLFEQALALDLEVLVEVHDQEELAVA-QKIGAQLIGVNNRNLHTFEVDIAVSERLA
TRPC_LACLA       PKLQNLYNYALSLGLEVLVETHNKAELEIA-HQLGAKIIGVNNRNLKTFEVILQNSVDLT
TRPC_STAS1       -QMKDLYQYATSLNLEVLVEVHDKEELERA-YKLKPQIIGVNNRDLKRFVTDVLHTNEIL
TRPC_STAAN       -QLKDLYNYAISQNLEVLIEVHDRHELERA-YKVNAKLIGVNNRDLKRFVTNVEHTNTIL
TRPC_STAEQ       -QLKELYSYATNHNLEALVEVHTIRELERA-HQINPKIIGVNNRDLKRFETDVLHTNKLL
TRPC_STAHJ       -KLRQLYQYASSKGLEVLVEVHDGIELQRA-YQLNPQIIGVNNRDLKSFNTDVKHTNQIL
TRPC_BUCAP       -QYLELSRIAKELNMGVLTEINNIKELKRA-IKLNASVIGINNRNLHDLSIDLNRTRTLS
TRPC_BUCDN       -QYQKLSKIAKELNMGILTEVNNTSELKRA-IKLNANIIGINNRNLHDLSINLNRTRILS
TRPC_BUCSC       -QYRALEKLAYSLNMAVLTEINNKMELDRA-INLNAKIIGINNRNLKNFSISTSNTYKLA
TRPC_ECOLI       -QYRQLAAVAHSLEMGVLTEVSNEEEQERA-IALGAKVVGINNRDLRDLSIDLNRTRELA
TRPC_SALTY       -QYRQLSAVAHSLKMGVLTEVSNDEERERA-IALGAKVVGINNRDLRDLSIDLNRTRQLA
TRPC_VIBPA       -EYKALEEAAHSLNMGILTEVSNEEELHRA-VQLGARVIGINNRNLRDLTTDLNRTKALA
TRPC_HAEIN       -TYRVLADLAHSLGMGVLTETSNEEEFERA-LALGAKIIGVNNRNLHDLTVDLNRVVELT
TRPC_HELPY       -NYLELFNLAKSLNMSVLTEVSNQQEIEHL-LKLQYDIIGINNRDLHTLKTDINHTLKLR
TRPC_HELPJ       -NYLELFNLAKSLNMSVLTEVSNQQEIERL-LKLQYDIIGINNRDLHTLKTDIFHTLELR
                               :  : *                 ::*:* *:*  :         : 

TRPC_LEPIC       AF----LPPN---IVKVGESGIKKRSDLDTFRKL-VDAALIGTYFMEKQDIRKAWLNLF-
TRPC_THEMA       PL----VPDD---TVVVAESGIKDPRELKDLRGK-VNAVLVGTSIMKAENPRRFLEEMRA
TRPC_CHLTE       RE----YPEG---VLSVAESGLKRRDDVLLMQDAGFDAVLIGEGLLASEELRQFSWG---
TRPC_LACCA       AM----VPDN---IPVVAESGIKTQEDVEKLAAAGFNAILIGETLMRSNQKKQLIAAFKE
TRPC_PSEAE       PE----IPRD---RLVVTESGILNRADVELMEVSEVYAFLVGEAFMRADDPGLELKRLFF
TRPC_PSEPU       PR----IPRD---RLAITESGILNRADVELMAINEVYSFLVGEAFMRAEQPGLELQRLFF
TRPC_ACIAD       KL----LDPS---RLLVTESGIATPQDVQLMQEHDIHSFLVGESFMKQPRPDQAFTELFG
TRPC_RHOCB       PV----ILAEG--RELVCESGIFTPADMAAMAAVGARRFLIGESLMRQADVAAATRALLA
TRPC_RHOS4       RR----VPED---RLIVSESGLHTPEDLADLARYGARCFLIGESLMRQADVEAATRAILA
TRPC_AZOBR       AH----VPAD---RMLVAESGLYSPADLSRMAAVGARCFLVGESLMRQEDVSAATRALLA
TRPC_BRADU       PL----IPGD---RLMVGESGIFTPADLARLERVGMSTFLVGESLMRQADVTAATRTLLA
TRPC_ZYMMT       KQ----APKE---CTFVAESGIQTHDDLVAMNQHNIGCFLVGETLMRQKDVKQATRDLLG
TRPC_SYNY3       AQRREQLTQGD--ITLVSESGIYELADLQRLQQAGARAVLVGESLVKQPDPQQAIAALYG
TRPC_BACMQ       KH----VPKD---QLLVSESGIYLYDDVSYVKEAGAKAILVGESLMRQDNQTKAIEKLFG
TRPC_BACSU       SL----VPKE---SLLVSESGIGSLEHLTFVNEHGARAVLIGESLMRQTSQRKAIHALFR
TRPC_MYCTU       PG----LPS---SVIRIAESGVRGTADLLAYAGAGADAVLVGEGLVTSGDPRAAVADLVT
TRPC_MYCLE       PG----LPS---NVIRIAESGVRGPADLLAYAGAGADAVLVGEGLVKSGDPRAAVADLVT
TRPC1_STRCO      PE----IPA---HIVKVAESGVRGPHDLIAYANEGADAVLVGESLVTGRDPKTAVSDLVA
TRPC2_STRCO      GR----VGT---GRVMVGESGVRGAPDARALEAAGVDAVLVGELLMRAGDPGTTIKGLVG
TRPC_DEIRA       AR----ARAAGFSGVLVAESGYRAPADLREVYGL-ADAVLVGTSLAGSGDLAGAARALLA
TRPC_AQUAE       PK-----IKDLGAKFVISESGISKREEILELMNYQVDGFLIGTSLMKSENPYRKLKELLG
TRPC_LISMO       SDFS-------SDACFISESGFRTAEDVARVSQK-YDAVLVGEALMREATPEVAAKSLKV
TRPC_LACLA       PYFK-------EDSIYISESGIFSANEAQKVSDT-FNGILVGTALMQSENLEKSLKDLKV
TRPC_STAS1       ENKK-------EGYYYISESGIRDEQDVANVVESGIDGLLIGESLMKCEDLSQFLPGLKL
TRPC_STAAN       ENKK-------PNHHYISESGIHDASDVRKILHSGIDGLLIGEALMRCDNLSEFLPQLKM
TRPC_STAEQ       KFKK-------SNCCYISESGIHTKEDVEKIVDSSIDGLLVGEALMKTNDLSQFLPSLKL
TRPC_STAHJ       KCKK-------ENYLYISESGIHSQQEVKQIVKSGIDGLLVGGALMNCNELEHFIPSLKL
TRPC_BUCAP       PLI--------KNKIIVSESGIKKNHQIKELSNI-VHGFLIGSSLMYRTNLETNIKSLII
TRPC_BUCDN       SLIP-------KNIIIISESGITKYKQIRYLSQF-VNGFLIGSHLMSEKQLEIGVRSLIL
TRPC_BUCSC       SKIS-------KNTIVISESGINSYNQLRKFKNL-VQGFLIGSALMSKKDLEHAVHKIIT
TRPC_ECOLI       P-------KLGHNVTVISESGINTYAQVRELSHF-ANGFLIGSALMAHDDLHAAVRRVLL
TRPC_SALTY       P-------KLGHGVTVISESGINTYGQVRELSHF-ANGFLIGSALMAHDDLNAAVRRVLL
TRPC_VIBPA       PTIR----KLAPNATVISESGIYTHQQVRDLAEY-ADGFLIGSSLMAEDNLELAVRKVTL
TRPC_HAEIN       KKYAD---CIPADVRIISESGIYNHKQIHQLQKV-AHGFLIGSSLMGNQDLNNAVRSVIF
TRPC_HELPY       PLLP-------KDALIISESGIYSHAQIKALAPY-VNGFLVGSSLMKEKDLKKACIKLIL
TRPC_HELPJ       PLLP-------KDAIIISESGIYSHAQIKALAPC-VNGFLVGSSLMKEKDLKKACIKLIL
                                 : ***     .            *:*  :               

TRPC_LEPIC       ------------------------------------------------------------
TRPC_THEMA       WSE---------------------------------------------------------
TRPC_CHLTE       ------------------------------------------------------------
TRPC_LACCA       RA----------------------------------------------------------
TRPC_PSEAE       QERGAVVLGADPD-----------------------------------------------
TRPC_PSEPU       PEQVKKTVQPLD------------------------------------------------
TRPC_ACIAD       VPKLV-------------------------------------------------------
TRPC_RHOCB       C-----------------------------------------------------------
TRPC_RHOS4       DPLTAQGGV---------------------------------------------------
TRPC_AZOBR       ------------------------------------------------------------
TRPC_BRADU       RETTARATGTR-------------------------------------------------
TRPC_ZYMMT       LN----------------------------------------------------------
TRPC_SYNY3       EV----------------------------------------------------------
TRPC_BACMQ       ESEYAH------------------------------------------------------
TRPC_BACSU       E-----------------------------------------------------------
TRPC_MYCTU       AGTHPSCPKPAR------------------------------------------------
TRPC_MYCLE       AGTHPSCPKPAR------------------------------------------------
TRPC1_STRCO      AGEHPALRHGRS------------------------------------------------
TRPC2_STRCO      ------------------------------------------------------------
TRPC_DEIRA       R-----------------------------------------------------------
TRPC_AQUAE       F-----------------------------------------------------------
TRPC_LISMO       TR----------------------------------------------------------
TRPC_LACLA       KRKTNEN-----------------------------------------------------
TRPC_STAS1       TKVTK-------------------------------------------------------
TRPC_STAAN       QKVKS-------------------------------------------------------
TRPC_STAEQ       KKNLYDS-----------------------------------------------------
TRPC_STAHJ       KKVKQ-------------------------------------------------------
TRPC_BUCAP       GDNKVCGLTRIIDAKIVESCGAVYGGLIFADNSLRKTNEKIAEKMIFENN-LRFIGVFQN
TRPC_BUCDN       GENKICGLTRSCDIEIAEKYGAVYGGLIFAPSSLRKISKNTAKKIIFNNT-LRNVGVFQN
TRPC_BUCSC       GNNKICGLTRVEDARMSKDFGAIYGGFIFCKSSKRYVNLKKAMNITKNVH-MKYIGVFCN
TRPC_ECOLI       GENKVCGLTRGQDAKAAYDAGAIYGGLIFVATSPRCVNVEQAQEVMAAAP-LQYVGVFRN
TRPC_SALTY       GENKVCGLTRAQDAKAACDAGAIYGGLIFVPSSPRAVSVEQAREVISGAP-LQYVGVFKN
TRPC_VIBPA       GENKVCGLTHPDDAAKAYQAGAVFGGLIFVEKSKRAVDFESARLTMSGAP-LNYVGVFQN
TRPC_HAEIN       GENKVCGLTRAQDVKIVYENGALYGGLIFAEHSKRSVSLRQAQELVTAAP-LRFVGVFQN
TRPC_HELPY       GENKVCGLTRIKDAKAVYKNHFIYGGLIFEKSSPRYIKPKEALKITKAVKKLDFVGVFVK
TRPC_HELPJ       GENKVCGLTRIKDAKAVYKNHFIYGGLIFEKSSPRYIKPKEALKITKAVKKLDFVGVFVK
                                                                             

TRPC_LEPIC       ------------------------------------------------------------
TRPC_THEMA       ------------------------------------------------------------
TRPC_CHLTE       ------------------------------------------------------------
TRPC_LACCA       ------------------------------------------------------------
TRPC_PSEAE       ------------------------------------------------------------
TRPC_PSEPU       ------------------------------------------------------------
TRPC_ACIAD       ------------------------------------------------------------
TRPC_RHOCB       ------------------------------------------------------------
TRPC_RHOS4       ------------------------------------------------------------
TRPC_AZOBR       ------------------------------------------------------------
TRPC_BRADU       ------------------------------------------------------------
TRPC_ZYMMT       ------------------------------------------------------------
TRPC_SYNY3       ------------------------------------------------------------
TRPC_BACMQ       ------------------------------------------------------------
TRPC_BACSU       ------------------------------------------------------------
TRPC_MYCTU       ------------------------------------------------------------
TRPC_MYCLE       ------------------------------------------------------------
TRPC1_STRCO      ------------------------------------------------------------
TRPC2_STRCO      ------------------------------------------------------------
TRPC_DEIRA       ------------------------------------------------------------
TRPC_AQUAE       ------------------------------------------------------------
TRPC_LISMO       ------------------------------------------------------------
TRPC_LACLA       ------------------------------------------------------------
TRPC_STAS1       ------------------------------------------------------------
TRPC_STAAN       ------------------------------------------------------------
TRPC_STAEQ       ------------------------------------------------------------
TRPC_STAHJ       ------------------------------------------------------------
TRPC_BUCAP       QDIEKIVNIAQRLSLYAVQLHGSENQKYINILRKKLCKKIKIWKAFSIQSTLPLLN----
TRPC_BUCDN       ENIEIVKNIAEELNLYAVQLHGQEDQKYVKKLRQTLSINIQIWKAFSIDSKIPDLN----
TRPC_BUCSC       ENISTISYIIDKIPLYAIQLHGNENQFYIDCLKKKIPKCVRVWKAISLNGEKKHANN--L
TRPC_ECOLI       HDIADVVDKAKVLSLAAVQLHGNEEQLYIDTLREALPAHVAIWKALSVGETLPA----RE
TRPC_SALTY       ADIADVCQKAAVLSLSAVQLHGSEDQAYVNALREALPKQVQIWKALSVSDALPA----RD
TRPC_VIBPA       HDVDYVASIVTSLGLKAVQLHGLEDQEYVNQLKTELPVGVEIWKAYGVADTKPS----LL
TRPC_HAEIN       QEIDFIVKIASQLQLYAVQLHGAETEAFITALRQQLPKNTQIWKAISVNTEAQSAVDFTD
TRPC_HELPY       DSIKKIQKIVKKLDLKAVQLYGYS-QKEIAQLKKALPKTCAIWQVISVMSAKDLVP---K
TRPC_HELPJ       DKIKKIAKIAKKLDLKAVQLYGYS-QKEIAQLKKSLPKTCAIWQVVSVADSKDLAP---K
                                                                             

TRPC_LEPIC       ------------------------------------------------------------
TRPC_THEMA       ------------------------------------------------------------
TRPC_CHLTE       ------------------------------------------------------------
TRPC_LACCA       ------------------------------------------------------------
TRPC_PSEAE       ------------------------------------------------------------
TRPC_PSEPU       ------------------------------------------------------------
TRPC_ACIAD       ------------------------------------------------------------
TRPC_RHOCB       ------------------------------------------------------------
TRPC_RHOS4       ------------------------------------------------------------
TRPC_AZOBR       ------------------------------------------------------------
TRPC_BRADU       ------------------------------------------------------------
TRPC_ZYMMT       ------------------------------------------------------------
TRPC_SYNY3       ------------------------------------------------------------
TRPC_BACMQ       ------------------------------------------------------------
TRPC_BACSU       ------------------------------------------------------------
TRPC_MYCTU       ------------------------------------------------------------
TRPC_MYCLE       ------------------------------------------------------------
TRPC1_STRCO      ------------------------------------------------------------
TRPC2_STRCO      ------------------------------------------------------------
TRPC_DEIRA       ------------------------------------------------------------
TRPC_AQUAE       ------------------------------------------------------------
TRPC_LISMO       ------------------------------------------------------------
TRPC_LACLA       ------------------------------------------------------------
TRPC_STAS1       ------------------------------------------------------------
TRPC_STAAN       ------------------------------------------------------------
TRPC_STAEQ       ------------------------------------------------------------
TRPC_STAHJ       ------------------------------------------------------------
TRPC_BUCAP       WDHIDKYIFD----SGSGGTNKTFNWSILKGSILENVILAGGINTDNVLIASQLNCSGLD
TRPC_BUCDN       WDHIHKYVLD----SQFGGSNKCFNWSILKHQILENVILAGGINSNNCIKASKLNCSGLD
TRPC_BUCSC       FDNVNKHVFD----NIHGGSGTPFNWYLLKNYNLKNVILAGGLNIKNCISASDLGCFGLD
TRPC_ECOLI       FQHVDKYVLD----NGQGGSGQRFDWSLLNGQSLGNVLLAGGLGADNCVEAAQTGCAGLD
TRPC_SALTY       YHHVDKYIFD----NGQGGSGQRFDWSLLQGQPLDNVLLAGGLAADNCVQAAQVGCAGLD
TRPC_VIBPA       ADNIDRHLLDAQVGTQTGGTGHVFDWSLIGDP--SQIMLAGGLSPENAQQAAKLGCLGLD
TRPC_HAEIN       DLNVDRYIFDSQTANQQGGTGKTFDWSLIPENLKHKIILAGGISPNNVEQAIAQGCLGLD
TRPC_HELPY       TKEASLILYDTK-GDKMGGNGVSFDWEILENV-KTPFMLAGGLNLDNIQKALKVEALGLD
TRPC_HELPJ       TKEASLILYDTK-GDKMGGNGVSFDWEILENA-KTPFMLAGGLNLDNIQKALKIKALGLD
                                                                             

TRPC_LEPIC       --------------------------------
TRPC_THEMA       --------------------------------
TRPC_CHLTE       --------------------------------
TRPC_LACCA       --------------------------------
TRPC_PSEAE       --------------------------------
TRPC_PSEPU       --------------------------------
TRPC_ACIAD       --------------------------------
TRPC_RHOCB       --------------------------------
TRPC_RHOS4       --------------------------------
TRPC_AZOBR       --------------------------------
TRPC_BRADU       --------------------------------
TRPC_ZYMMT       --------------------------------
TRPC_SYNY3       --------------------------------
TRPC_BACMQ       --------------------------------
TRPC_BACSU       --------------------------------
TRPC_MYCTU       --------------------------------
TRPC_MYCLE       --------------------------------
TRPC1_STRCO      --------------------------------
TRPC2_STRCO      --------------------------------
TRPC_DEIRA       --------------------------------
TRPC_AQUAE       --------------------------------
TRPC_LISMO       --------------------------------
TRPC_LACLA       --------------------------------
TRPC_STAS1       --------------------------------
TRPC_STAAN       --------------------------------
TRPC_STAEQ       --------------------------------
TRPC_STAHJ       --------------------------------
TRPC_BUCAP       FNSGVEKSPGIKDHKKISLIFKKLTF------
TRPC_BUCDN       LNSGIEVSPGIKDHKKIKSVFQKLRYY-----
TRPC_BUCSC       FNSGIEISPGLKDKKKTFLIFRSLREHKTIIH
TRPC_ECOLI       FNSAVESQPGIKDARLLASVFQTLRAY-----
TRPC_SALTY       FNSGVESQPGIKDARLLASVFQTLRAY-----
TRPC_VIBPA       LNSGVESAPGKKDSQKLQAAFHAIRNY-----
TRPC_HAEIN       LNSGVESSAGVKDQEKVRLVFNNIY-------
TRPC_HELPY       FNSGLEISPGIKNKDKIKRLARILREY-----
TRPC_HELPJ       FNSGLEISPGIKNKDKIKQLARILREY-----