CLUSTAL format seed alignment for MF_00137

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

PUR7_HAEIN        ---MTQQLPIL------SLKKIYSGKVRDLYEI------------------DDKRMLMVT
PUR7_POLNA        ---MTTTTSVLHTSALTSLPLLARGKVRDNYAV------------------GNDRLLMVA
PUR7_XANOM        ----MPVSTTLLQSDLPGLPLRHRGKVRDVFDIPRDRLP--------ADAPPGDYLLMVA
PUR7_XYLFA        ------MLTTLLQSDLPGLPLRHCGKVRDVFDIPHKRLP--------VDTRSGEYLLIVA
PUR7_THISH        ------MSQPLLQSHLTSLPLIHRGKVRDLYAV------------------GDDHLLIVT
PUR7_GEOLS        ------MSQPVKQTDFPGLKLVNRGKVRDIYDL-------------------GDALLMVT
PUR7_ELUMP        -----------MNNSQINLPLLKKGKVRDVYDA-------------------GKMLLIVA
PUR7_STRCO        ---MSGFVEKPEPIQVPGLVHLHTGKVRELYRNE------------------AGDLVMVA
PUR7_SALTO        ------------------MELLHSGKVRDVYAD-------------------GDDLILVA
PUR7_MYCA9        -----------MRPSLSDYQHVASGKVRELYRVD------------------DEHLLFVA
PUR7_VIBCH        MSLADQVLAVNDDLPIRTHQPVHSGKVRSVYWLTEQDSRRLIKEKGYPVAEDAPLAIMVI
PUR7_SHEB5        MSLADSVLAINNDLPIRTDSPVHSGKVRSVYWLTDADSRRLITTKGYNVPEDTPLAIMVI
PUR7_PSEAE        ---------------MEKREELYRGKAKSVYQTDDA-----------------DRLILLF
PUR7_PSEF5        ---------------MEKREELYRGKAKSVYKTDDA-----------------DRLILLF
PUR7_ECOLI        ---------------MQKQAELYRGKAKTVYSTENP-----------------DLLVLEF
PUR7_WIGBR        -------------MKIKKKNKIYQGKSKIIYSTNNS-----------------DVLILKF
PUR7_PYRHO        ---------------MVKLMEVYEGKAKKMIPIDD------------------DKLIMEF
PUR7_THESM        ---------------MVIVMEIYEGKAKKVIPLDD------------------GKVIIEF
PUR7_METJA        --------MEIKLEEILKKQPLYSGKAKSIYEIDD------------------DKVLIEF
PUR7_METAC        ----------------MKREQLYSGKAKTIYATDNP-----------------DTLIAEF
PUR7_COPPD        ---------------MEKLDLLYEGKAKRVYKTDDP-----------------RYYIIEY
PUR7_THEP3        ---------------MEKRELLYEGKAKKVYKTDEE-----------------NLYIIEY
PUR7_CLOBB        ---------------MEKLEMLYEGKAKQIYATDKA-----------------DEVVIYY
PUR7_CLOK1        ---------------MKKGEMIYQGKAKKVYETDDK-----------------DKVIIYY
PUR7_DEIRA        ---------------MTRGEMKYEGKAKRVYATENP-----------------HEYVVEY
PUR7_CHLP8        ---------------MNKLTLLHEGKAKKVWQTDDP-----------------DLIIQEF
PUR7_BACC2        ---------------MQKLELLYEGKAKRIYRTESA-----------------DMVWVEY
PUR7_BACSU        -------------MNIVKNELLYEGKAKKIYKTDDE-----------------NTLYVVY
PUR7_STRPI        ----------------MSKQLIYSGKAKDIYTTEDE-----------------NLIISTY
PUR7_STRTD        ----------------MSNQLIYTGKAKDIYSTEDE-----------------NVIKSVY
PUR7_OENOB        ----------------MTESLLYSGKAKNMFQTDDP-----------------EIVHIHY
PUR7_STAA8        ------------------MTLLYEGKAKRIFSTNQE-----------------NELRVEY
PUR7_STAES        ------------------MSLLYEGKAKRVFTTNID-----------------GQLRVEY
PUR7_LISW6        ----------------MTNELVYEGKAKQLFKTEEA-----------------GVLRVAY
PUR7_NOSP7        ---------------MSVNSKLYEGKAKILYTTDDP-----------------EVLLADF
PUR7_RHIME        ---------------MNRRRRIYEGKAKILYEGPEP-----------------GTLIQFF
PUR7_GLUOX        ---------------MARRRQLYEGKAKVLFEGPEP-----------------GTLVQYF
PUR7_SPHWW        ---------------MTRRRQIYEGKAKILYEGPEP-----------------GTLIQYF
PUR7_RICM5        -----------------MKKKIYEGSSKILYSAEED-----------------FLLIMAF
PUR7_RICTY        -----------------MKKKLYEGSSKILYSAEED-----------------FLLIMAF
PUR7_SACS2        ----------------MEVNKISEGKTKIVY-DFDK-----------------DHVLLEF
PUR7_THEMA        --------------------MNYEGKTKIV--KVTG-----------------DYALLEF
PUR7_HERA2        ---------------MQYGTKLAEGKTKIIYAHPEDQ----------------SLAYMVQ
PUR7_THEAC        ------------------MKIIAKGKVKDVYDDGD-------------------TLVFRF
PUR7_THEVO        ------------------MKLLTTGKVKDVYDDGD-------------------TLVFKF
PUR7_ARCFU        ------------------MGSVKDLVVLKEPAEKP------------------GLGRFIF
B5YAR6_DICT6      ------------------MGSVKDLIVIEKPTEKKL-----------------GRGRFLF
PUR7_HALSA        ------------------MASVKDRRVESPATDTDL-----------------GRGVFEF
M1XNN8_NATM8      ------------------MTSVKGFRIEEAATADSL-----------------GTGAFVF
PUR7_BACTN        -----MKALTKTDFNFPGQKSVYHGKVRDVYNINGE------------------KLVMVA
PUR7_CLOTE        ------------------MNVVYKGKTKDVFLLEDG------------------NYLLKF
                                                                              

PUR7_HAEIN        SDRLSAFDVILDDP-------IPRKGEILTQISNFWFNKLAHIMPNHFTGDSVY------
PUR7_POLNA        SDRLSAFDVILGEP-------IPGKGALLTQMALFWFDKLGSICPNHLTGEAPE------
PUR7_XANOM        TDRLSAFDVVLPDP-------IPGKGEMLCQVSNFWFHKTEHLMPNHLVDIRVE------
PUR7_XYLFA        TDRLSAFDVVLPDP-------IPGKGEILCQISNFWFQKTEHLMPNHLTGINVA------
PUR7_THISH        TDRVSAFDVILPTP-------IPGKGEVLTKISEFWFRKLEHIVPNQLADMSLA------
PUR7_GEOLS        SDRISAFDVIMNEP-------IPDKGKVLTQISKFWFSQMEDIIPNHIISTDVA------
PUR7_ELUMP        SDRVSVFDCVLPSQ-------IPDKGKILTQISNFWFAKTISIVPNHMISSDIN------
PUR7_STRCO        SDRISAYDWVLPTE-------IPDKGRVLTQLSLWWFDQLADLAPNHVLSTELP------
PUR7_SALTO        SDRVSVYDVVLPTP-------IPEKGKLLTALSLWWFDQLAELVPNHVLSA---------
PUR7_MYCA9        TDRISAFDFVLDTP-------IPDKGRILTAMSVFFFGLLT--VPNHLAGPPDD------
PUR7_VIBCH        SDRISAFDCIWHAEGGVHG--VPGKGAALNAISNHWFKLFKQHGLAESHILDIP------
PUR7_SHEB5        SDRISAFDCIFHGEGGLKG--IPGKGAALNAISNHWFKLFAENGLADSHILDIP------
PUR7_PSEAE        RNDTSAFDGKRIEQ-------LDRKGAVNNKFNAFIMQKLEAAGIPTQFDKLL-------
PUR7_PSEF5        RNDTSAFDGKRIEQ-------LDRKGMVNNKFNAFIMQKLEAAGVPTQFDKLL-------
PUR7_ECOLI        RNDTSAGDGARIEQ-------FDRKGMVNNKFNYFIMSKLAEAGIPTQMERLL-------
PUR7_WIGBR        KKDMSRLNGKYIKK-------FDNKDIINNKFNYYIMNKISSFNIKTHILSLL-------
PUR7_PYRHO        KDDATAFDGTKKAR-------FKGKGWLNAQLSVIFFKLLEEHGIKTHFIGVA-------
PUR7_THESM        KDDATAFNGKKKAQ-------FKGKGWLNAQISAILFKVLEEKGIKTHFIGVA-------
PUR7_METJA        RDDITAGNGAKHDV-------KQGKGYLNALISSKLFEALEENGVKTHYIKYI-------
PUR7_METAC        RNSLTAFNGEKKGE-------MEKKGYYNAQISKKIFEMLEASGIKTHFVSML-------
PUR7_COPPD        KDEATAFDGKKKGI-------IQGKGTVNNKVSAVFFQLLEENGVPTHFVELL-------
PUR7_THEP3        KDDATAFNGLKKGT-------IAEKGIVNNKVSAILFALLDKNNVPTHYVKRL-------
PUR7_CLOBB        KDDATAFNGEKKGQ-------ITDKGVMNNKITSILFEQLEKQGIKTHFIKKL-------
PUR7_CLOK1        KDDATAFNGEKKGQ-------ITDKGILNNNITSSLFELLEKNNIPTHFEKKL-------
PUR7_DEIRA        KDDATAFNAQKRGE-------WAGKGATNNAITAHLYPQLEAAGIPTHFLEKL-------
PUR7_CHLP8        KDDATAFNNKKKGS-------IADKGVTNNAIASRLFTMLGENGIPTHFVSKL-------
PUR7_BACC2        KDSATAFNGEKKET-------ITGKGRLNNEITTLLFRKLQEVGIKTHFVEKL-------
PUR7_BACSU        KDSATAFNGEKKAE-------ISGKGRLNNEISSLIFKHLHAKGINNHFIERI-------
PUR7_STRPI        KDQATAFNGVKKEQ-------IAGKGVLNNQISSFIFEKLNAAGVATHFVEKL-------
PUR7_STRTD        KDQATMLNGARKET-------IKGKGVLNNQISSLIFEKLNASGVATHFIERI-------
PUR7_OENOB        KDQATALNGKVKEK-------IEGKGQLTSHISALLFNYLTVQGIENHFQKEL-------
PUR7_STAA8        KDEVTAGNGAKKDT-------MAGKGRLNNQITSIIFKYLQENGIESHFIKQL-------
PUR7_STAES        KDEVTAGNGAKKDT-------MIGKGKLNNQITSIIFDYLTHNHIDNHFIKQL-------
PUR7_LISW6        KDDATALNGVRKES-------FAGKGELNNQITALIFSYLEEAGIRSHFIRAI-------
PUR7_NOSP7        KDDATAFNAQKRGS-------IQGKGKINCSISSQLFKQLEAYGIKTHFIDSP-------
PUR7_RHIME        KDDATAFNKKKHDV-------IDGKGVLNNRISEYIFTHLNKIGIPTHFIRRL-------
PUR7_GLUOX        KDDATAGNGAKSGI-------ITGKGVLNNRISEYLMLKLHEINIPTHFIRRL-------
PUR7_SPHWW        KDDATAFNAQKKGT-------INGKGVLNNRISEHIFTMLGTIGVATHFIRRL-------
PUR7_RICM5        SDKAILETGETVDI-------S-GKGVLNNNISSFLMDKLEMIGIENHFIEKI-------
PUR7_RICTY        SDKAVLETGETVDI-------S-GKGVLNNSISSFLMGKLEMIGIENHLIEKI-------
PUR7_SACS2        KDDITAGDGQKRDI-------LEGKGVLNAQTSAFFFRLLERNGIETHYVGMK-------
PUR7_THEMA        KDDITAGDGLKHDV-------LTGKGSICAETTAILMKYLSEKGIKTHLVEYI-------
PUR7_HERA2        KDSISAGDGARRNE-------IDGKGAISGRTSANVFALLNRSGVRTHYQSDP-------
PUR7_THEAC        SNRISVFD-KIIPTE------IENKGESLCRTSSFWFRYIGERGIKNHFIEMIDNRTMRV
PUR7_THEVO        SNRISVFD-KIIPNE------IDNKGESLCRTSAFWFQLIESYGMKSHFIELIDNRTMRV
PUR7_ARCFU        SNRYSVFDYGEMPDK------IEDKGRALCMVTAYFFEKLEEAGIATHYLGLVE-GGKVR
B5YAR6_DICT6      SDRYSVFDYGEMPDL------IDDKGKAICIATAYFFEKLENLGIKTHYIGLVE-DDKIK
PUR7_HALSA        SDRYSVFDWGEMPDH------VPGKGASLCTMGAYTFEQLAAAGVPTHYQGVRTPDGETV
M1XNN8_NATM8      TDDYSVFDWGKMPDA------IPNKGASLCAMGAANFERLEAEGIATHYRGVVSGGGAVT
PUR7_BACTN        TDRISAFDVVLPEG-------IPYKGQMLNQIAAKFLDATTDICPNWKMATPD-------
PUR7_CLOTE        KDDVTGENGVFDPGANSVGLTMEGAGRAALRLTKLFFERLKEEKIPTHYIDSNV------
                   .                       .                                  

PUR7_HAEIN        ----------------DVLP----KEEADLIRDRAVVCKRLNPIKIESIVRGYLT--GSG
PUR7_POLNA        ----------------SVVT----AAEIPQVAGRSMLVKRLKPIPVEAVVRGYLA--GSG
PUR7_XANOM        ----------------QVLPE---GVDPALYAKRAVVTRKLKPVPVEAIARGYLI--GSG
PUR7_XYLFA        ----------------SVLPD---GIDKTLYTQRAVVTKKLKPVRIEAIARGYLI--GSG
PUR7_THISH        ----------------EAVPD---AAERAPLEGRSLVVKRLKALPIEAVVRGYLI--GSG
PUR7_GEOLS        ----------------DYPAAC--QPYAEVLAGRSMLVKKAEPLAAECIVRGYVS--GSG
PUR7_ELUMP        ----------------EINIILKLGLDPQYYSGRTVLVKKCERIDFECVVRGYIT--GSA
PUR7_STRCO        ----------------PGAPA--------DWEGRALVCKSLRMVPVECVARGYLT--GSG
PUR7_SALTO        ----------------TDVPV--------ELAGRAIRCRRLEMVPVECVARGYLV--GGG
PUR7_MYCA9        ----------------PRIPE--------EVLGRALLVRRLDMLPVECVARGYLT--GSG
PUR7_VIBCH        ----------------HPFVW---------------IVQKARPIKIEAICRQYIT--GSM
PUR7_SHEB5        ----------------HPFVW---------------IVQKARPIKVEAICRQYIT--GSM
PUR7_PSEAE        -------------------------------SDTECLVKKLDMIPVECVVRNFAA--GSL
PUR7_PSEF5        -------------------------------GDNECLVKKLDMIPVECVVRNYAA--GSL
PUR7_ECOLI        -------------------------------SDTECLVKKLDMVPVECVVRNRAA--GSL
PUR7_WIGBR        -------------------------------SDNQVIVKKLKMIPIEFVVRNYAY--GSL
PUR7_PYRHO        -------------------------------GGNRLIVEKLDMYPLEVVVRNVVA--GSL
PUR7_THESM        -------------------------------GDNKLIVEKLKMYPVEVVVRNVIA--GSL
PUR7_METJA        -------------------------------EPRYMIAKKVEIIPIEVIVRNIAA--GSL
PUR7_METAC        -------------------------------SDIEMLVKKVEIIKIEVIVRNIAA--GSI
PUR7_COPPD        -------------------------------SPTEMLVKRVEIIPLEVIVRNYAA--GSI
PUR7_THEP3        -------------------------------SDREMLVKKVEIFPLEVIVRNYAA--GSI
PUR7_CLOBB        -------------------------------NDREQLCKKVSIVPLEVIVRNVAA--GSM
PUR7_CLOK1        -------------------------------NDREQLCKKVDIIPLEVIVRNVAA--GSM
PUR7_DEIRA        -------------------------------SDREQRVKAVTIVPVEVIVRNVAA--GSF
PUR7_CHLP8        -------------------------------NDRDMLCKKLDILLIEVVTRNVAA--GSL
PUR7_BACC2        -------------------------------SETEQLVKKVSIIPLEVVTRNVIA--GSL
PUR7_BACSU        -------------------------------SETEQLIKKVTIVPLEVVVRNVVA--GSM
PUR7_STRPI        -------------------------------SDTEQLNKKVKIIPLEVVLRNYTA--GSF
PUR7_STRTD        -------------------------------SDTEQLNKKVTIIPLEVVLRNVTA--GSF
PUR7_OENOB        -------------------------------ENGDALVRKVKIVPLEVVTRNFAA--GHF
PUR7_STAA8        -------------------------------SETEQLVKPVKIIPLEVVVRNIAS--GSI
PUR7_STAES        -------------------------------SQTEQLVQQVDIIPLEVVVRNIAT--GSI
PUR7_LISW6        -------------------------------SETEQLVKEVSIIPLEVVVRNVIA--GSL
PUR7_NOSP7        -------------------------------TPNQMLVKAVKILPLEVVIRNIAA--GSL
PUR7_RHIME        -------------------------------NMREQLIKEVEIIPLEIVVRNVAA--GSL
PUR7_GLUOX        -------------------------------NMREQLIREVEIIPLEVVVRNVAA--GSL
PUR7_SPHWW        -------------------------------NMREQLIRQVEIVPIEVVVRNVAA--GSL
PUR7_RICM5        -------------------------------NMREQLIQYVEVFPIQVIISSVAC--SRF
PUR7_RICTY        -------------------------------NMREQLIQYVEVFPIQVIISSVAC--GRF
PUR7_SACS2        -------------------------------DERTMIVKKLKMIPVEVVLRNIAT--GSI
PUR7_THEMA        -------------------------------PPRTLKVIPLKMFPLEVVVRLKKA--GSF
PUR7_HERA2        -------------------------------EPGVMLVERCEMLPLEVVMRRLAT--GSY
PUR7_THEAC        RKYDVPEKVS--------------------------PGSSGYVIPLEFITRHYV--AGSL
PUR7_THEVO        RKFAVPNKVS--------------------------LGSSNYVIPLEFITRYYV--AGSL
PUR7_ARCFU        RFDEVENAVNEMEVKLVRVIKPKNGD----YSIFKTLKG-NFLVPLEIIYRNSIPEGSSL
B5YAR6_DICT6      TLYELKEPTNVMEFKMVRVLKPELQENIYNYSIFKKERS-NFLIPLEVIYRNALPEGSSV
PUR7_HALSA        RLADAPEAPTQMVIDLTQVPTLPFEDGSYDYDRYHDAGGSNYLVPLEVVFRNAVPVGSSL
M1XNN8_NATM8      GLDSVATPPREMAIELTRVPDLPHEGREYDYTAYHDAAGENYLIPLEIVFRNTVPVGSSL
PUR7_BACTN        --------------------------------PMVTVGVLCEGFPVEMIVRGYLC--GSA
PUR7_CLOTE        -------------------------------EEGTMKVKPAKIFGNGLEVICRYRAVGSF
                                                                           .  

PUR7_HAEIN        LKDYKQ-TGTICGLKLPEGLVEASKLPEAIFTPSSKE-------EVGNHDINISYAECEK
PUR7_POLNA        WVEYQQ-SQSVCGVPLPAGLKNASKLPEPIFTPAAKA-------EVGEHDENISYEQVVK
PUR7_XANOM        WKDYQR-TGKISGIELPDGLRQAEKLPEPIFTPSTKA-------AVGDHDENIDFDAMVK
PUR7_XYLFA        WKDYQR-TGKVSGIQLPDGLQEAEKLPDPIFTPSTKA-------AVGHHDENIDFDTTVK
PUR7_THISH        WKDYQK-TGQVCGNPLPAGLQLADRLPEPIYTPSTKA-------AVGDHDENVDFDYTAE
PUR7_GEOLS        WKDYKA-TGSICGIKLPEGLKESDRLAEPIFTPSTKA-------ELGTHDENISFDEMVK
PUR7_ELUMP        WKEYQK-SGTVCGEKIKEGLKEAQKFPEPIFTPASKA-------DTG-HDENVSFAYMLS
PUR7_STRCO        LAEYDE-TRTVCGLALPEGLVDGSELPAPIFTPATKA-------EVGEHDENVSYEEVAR
PUR7_SALTO        FAEYQR-TGVVSGIELPRGMVEAAALPEPIFTPSTKA-------PVGEHDQPMTFGEVVD
PUR7_MYCA9        LLDYQR-TGAVCGHVLPQGLGEASRLDPPLFTPATKA-------DIGEHDMNVDFAAVVG
PUR7_VIBCH        WRAYAKGEREFCGITLPEGLEKDSQLPELLMTPSTKGILRGIPGVPEADDVNISRQDIEA
PUR7_SHEB5        WRAYSKGERVFCGITLPEGLEKAQKLPELLITPSTKGILTGIPGVPAQDDVNISRSDIEA
PUR7_PSEAE        VRRLG--------------VEEGIALTPPTFELFLKN------DALGDPFINESHVQAFG
PUR7_PSEF5        VKRLG--------------VEEGMKLNPYTFELFLKD------DAKGDPFINESHVVAFG
PUR7_ECOLI        VKRLG--------------IEEGIELNPPLFDLFLKN------DAMHDPMVNESYCETFG
PUR7_WIGBR        LKRFL--------------IKERSFINPPILEFFFKN------DGLKDPMINEYHCISFN
PUR7_PYRHO        KKRLP--------------LPEGYELPEPIVELYYKN------DELHDPMINYYHAKVLG
PUR7_THESM        KKRLP--------------LKEGTELSEPIVELYYKN------DDLGDPMINHYHAKVLG
PUR7_METJA        CRRYP--------------FEEGKELPFPIVQFDYKN------DEYGDPMLNEDIAVALG
PUR7_METAC        TKKYP--------------MKEGTIFESPVLVFDFKS------DEYGDPMLNDDIAVALG
PUR7_COPPD        SRRLG--------------LEEGIKFDQPIVEFCYKN------DELGDPMVNNYHILAMK
PUR7_THEP3        CKRLG--------------LEEGLKFKTPVLEFSYKN------DELKDPMINEYHIQALE
PUR7_CLOBB        AKRLG--------------LEEGTKLKTTVFEFSYKD------DELGDPLINSYHAVAIG
PUR7_CLOK1        AKRLG--------------LEEGTPLKTTVFELSYKD------DSLGDPIINDYHAVAIG
PUR7_DEIRA        SKRLG--------------VEEGTPLPRPVVEYCYKS------DALGDPLINTDTAVALG
PUR7_CHLP8        VRRYG--------------FAEGTVLEKPIVELYLKN------DDLDDPLMNEDHAVALG
PUR7_BACC2        SKRLG--------------MEEGTVLAEPIVEFYFKD------DDLGDPLVTEDHIRVLN
PUR7_BACSU        SKRLG--------------IPEGTELEQPIIEFYYKD------DALGDPLITEDHIWLLK
PUR7_STRPI        SKRFG--------------VDEGIALETPIVEFYYKN------DDLDDPFINDEHVKFLQ
PUR7_STRTD        SKRFG--------------VEEGLDLKTPIVEFYYKN------DDLDDPFINDEHVKFLN
PUR7_OENOB        ASRFN--------------VPMHKALKPAVHEFYFKS------DSLDDPFINNEQILALE
PUR7_STAA8        TKRLG--------------FENGEVFREPLVEFFYKN------DALNDPLITDDHVKLLN
PUR7_STAES        TKRLG--------------FKKGHTFEEPLVEFFYKK------DELNDPLITDDHVKLLG
PUR7_LISW6        AKRLG--------------KEEGEEIPSAIVEFYYKE------DALDDPFINDDHVLYLE
PUR7_NOSP7        CQQTG--------------LPVGTILKQPLVEFYYKN------DHLGDPLLTRDRLYLLE
PUR7_RHIME        AKRLG--------------IEEGTVLPRSIIEFYYKA------DALDDPMVSEEHITAFG
PUR7_GLUOX        SKRLG--------------IPEGTRLPRTIIEYYYKN------DALGDPMVSEEHIAAFN
PUR7_SPHWW        TKRLG--------------IEEGTQLPRTIIEYYYKD------DALGDPMVADEHIACFG
PUR7_RICM5        VKEFG--------------MDEGYVFDKPIIDFKVRS------REFKYPIVNEYQILNFG
PUR7_RICTY        VKEFG--------------MDEGYVFDKPIIDFKVRS------REFNYPIVNEYQIFNFG
PUR7_SACS2        VKRLP--------------IKEGEVFESPIVEFFLKD------DLRHDPLLNYYHMEHLK
PUR7_THEMA        VRRYG--------------GAEGEDLPVPLVEFFIKD------DERHDPMVCVDHLEILG
PUR7_HERA2        CRRHPE-------------TPEGTRFSPPLVEFFYKD------DANHDPQIYLEGIVEKG
PUR7_THEAC        YDRLKAGSTKPADIGLNHFPDYGEKLPSPVFEVTTKR-------EKTDRLLDIDEALEIS
PUR7_THEVO        YDRIKEGKVKPMDIGLKHVPEYGEKLIDPIFEATTKR-------EETDRLLTKKEAMEIG
PUR7_ARCFU        LRRIERGEAKPEDFGLTKI-EAGMRLERPIVDFSTKL-------EDVDRYLSHSEAKEIS
B5YAR6_DICT6      FKRLKEGSLNLEEIGLDKMPEPGQKLEKPIVDFSTKL-------EVNDRYLSKKEALEIS
PUR7_HALSA        RTRCAPADVGID---ADEWPQGPVELPETIVEFSTKY-------EEQDRYLSRSMADEIA
M1XNN8_NATM8      RSRADPGDFGLE---YDAWPDGPVDLPEPVVEFSTKY-------EESDRYLSRENADYVA
PUR7_BACTN        WRTYKSGVREICGVKLPDGMRENEKFPEPIVTPTTKA-----EMGLHDEDISKEEILKQG
PUR7_CLOTE        MRRYGM-------------YAKEGQVLDAFVEVTLKD------DERQDPPITKDALDMLG
                                           .         :                        

PUR7_HAEIN        LIGADLAAQVKEKAIALYTVAAEYAL------TKGIIICDTKFEFGLDEN----GTLTLM
PUR7_POLNA        VVGPELAAQIKTLSIAIYETAAAFAL------TKGIIIADTKFEFGLDEN----GTLTLM
PUR7_XANOM        TVGAELAERVRDATLRIYRFAADFAA------ECGILLADTKFEFGTDAD----GRLYVM
PUR7_XYLFA        MVGAELAERVRDATLRIYHFAAKYAA------ECGILLADTKFEFGTDID----GRLYVM
PUR7_THISH        LVGPELAAQVRQTALALYKAAAEYAL------ARGIIIADTKFEFGLDDE----GVLHLI
PUR7_GEOLS        VCGKELAEQAREATIRIYCRAREIAD------QKGIIIADTKFEFGVYE-----GKLIII
PUR7_ELUMP        HMDKNLAYKIKDTSIKLYNFAEEYLK------NCGIILADTKFEFGLID-----GDLILI
PUR7_STRCO        QVGADTAAALRQATLAVYSRARDIAR------ERGIVLADTKFEFGFDGD-----DLVLA
PUR7_SALTO        KVGAETAERLRQITLDVYRRGAELAA------DRGILIADTKIELGWAAD----GTLTVG
PUR7_MYCA9        LVGAVRANQLRDETIKIYTRAAAHAL------HKGIILADTKFEFGVDIE----GNLVLA
PUR7_VIBCH        NYAAFNFNQPQDIDHYETLLKQGFAVISEALKSVGQLFVDTKFEFGYVADQQGQQKLIYM
PUR7_SHEB5        NYQAFGFEKLSDIDLYEKLLKDGFKVISKALADIDQVFVDTKFEFGYVTDKDGNSKLIYM
PUR7_PSEAE        WATPEQLAQMKTYSFKVNEVLNKLFD------DAGLLLVDFKLEFGLF-HGQ-----IVL
PUR7_PSEF5        WGTAEQLARMKELSLKVNEVLSKLFD------DAGLLLVDFKLEFGVFSDGS-----IVL
PUR7_ECOLI        WVSKENLARMKELTYKANDVLKKLFD------DAGLILVDFKLEFGLY-KGE-----VVL
PUR7_WIGBR        LISENHIKKIKKILYKINNILKDIFY------KAELILVDFKLEFGLF-NGD-----LFL
PUR7_PYRHO        ISLDE-IKKIEEIALKVNEILKDYLA------KKGIILVDFKLEFGKDKNGD-----IVL
PUR7_THESM        VSERE-LKEIENIALKVNNILKEYFA------QRGIILVDFKLEFGKNERGE-----IIL
PUR7_METJA        LATREELNKIKEIALKVNEVLKKLFD------EKGIILVDFKIEIGKDREGN-----LLV
PUR7_METAC        IATREELATLRKLALRINELLVPYLD------EKGILLPDFKLEFGR-RDGE-----IIL
PUR7_COPPD        LANEEEINALTQQALRINQILSQFLL------GKNIILVDFKLEFGRTDEGD-----IVL
PUR7_THEP3        LATKEEIEIMTGMTFKVNEILSEYFL------SKDIILVDFKLEFGKSSEG------ILL
PUR7_CLOBB        AATFEEIDTILEMTAKINNILKEAFA------KENINLIDFKIEFGKCADGT-----IVL
PUR7_CLOK1        IATWDELKTIYDMTASINDILELFFR------KLGIKLIDFKLEFGKFKD-K-----IVL
PUR7_DEIRA        WASEDDLKRIRELALQIRDFLVPYFE------KRGVRLIDFKLEFGKLPSGE-----IVL
PUR7_CHLP8        LGTYEEVAQLKDMAEKINSLLVPWFA------ERKLRLVDFKLEFG-RHKGE-----ILL
PUR7_BACC2        VASPEQVSVLRDMALQINQVLIDHFA------SCRVRLVDFKLEFGVTEEGE-----IIL
PUR7_BACSU        AATPEQVETIKSITTIVNEELQSIFD------DCHVRLIDFKLEFGLDAEGQ-----VLL
PUR7_STRPI        IADDQQIAYLKEETRRINELLKVWFA------EIGLKLIDFKLEFGFDKDGK-----IIL
PUR7_STRTD        IANDEQIAYIKDETRRINELLKDWFE------QIGLRLIDFKLEFGFDKDGK-----IIL
PUR7_OENOB        IADKKTISQMKEEAELINQKLINLFD------QIGITLIDFKVEFGFTSQGK-----LLL
PUR7_STAA8        IASDEDIEILKSKALKINNVLKQLMD------AMNLKLVDFKIEFGKTETGQ-----ILL
PUR7_STAES        IANDEEIKQLKQMAKDINQVLIQLMN------EMSLRLVDFKVEFGKTNGGK-----ILL
PUR7_LISW6        IATTNEMEVIRKAARSINEVLQVLFN------QMNITLIDFKLEFGRDADGN-----ILL
PUR7_NOSP7        LATAEQVDAITHLALQINEFLNKFWQ------QCGITLVDFKLEFGLDSQQQ-----LLL
PUR7_RHIME        WASPQELDDIMALAIRINDFLSGLFL------GVGIQLVDFKVECGRLYEGDM--MRIVL
PUR7_GLUOX        WAAPQDMDDMNQLALRTNDFLMGMFT------AVGITLVDFKLEFGRIWEGEE--MRILL
PUR7_SPHWW        WASQEEMHDIADMAIRVNDFMCGLFA------GIGIRLVDFKLEFGRFWDNDY--SRVIL
PUR7_RICM5        WLTRDEIKAVKEQALRIYDFLSGLFI------GVGIRLVECKLEFGRVFNGEE--SIIML
PUR7_RICTY        WLTMDEIRTVQAQTLRIYDFLSGLFI------GIGIRLVECKLEFGRVFNGEE--SIIML
PUR7_SACS2        LMNRKEAQHIEDIMMKVNDVLFNFIK------SKGFILYDFKLEFGRLGD------KLVI
PUR7_THEMA        IATKKQAEKMKEAAVKITLALKEFFE------RANFELWDIKYEFGLDKDG-----NVVL
PUR7_HERA2        LATAEEVSFIEQEGTRVFELLEQTWA------ERGVQLVDLKIEFGRTADGS-----LIV
PUR7_THEAC        GLTREEYAEIRETILKIDEMMEQEVG------KRGLIHADGKKEVALGKEREP----IIV
PUR7_THEVO        GLTLEDYCEIMEAVFKIDRRIDMEVS------KRGLIHADGKKEIALDRERRI----VVV
PUR7_ARCFU        GLSDEEFEALKELVVKVDEIITREVS------KAGLINEDGKIEVALDDERNL----MVV
B5YAR6_DICT6      GLSETEFEKLRNLTLFIDDLITEETR------KINLNNEDGKVEYALDLERNI----MLV
PUR7_HALSA        GDAD--IAELDALARRVNETITDCAA------DAGFVHDDGKLECVY-VDGEV----RVA
M1XNN8_NATM8      GAAD--VDALESIARDVNRIITETAA------AAGLKHEDGKIECLY-YDGEI----RVA
PUR7_BACTN        LATPEEYETLEKYTLALFKRGTEIAA------ERGLILVDTKYEFGKHNGTI-----YLM
PUR7_CLOTE        ILSLREYDILKDLTKKISGIVKDELS------KKGIELYDIKLEFGRIDEDN----HIAL
                                                         : * *                

PUR7_HAEIN        DEVLTPDSSRFWSVDTYQA----GTNPPSFDKQFVRDWLEN-----------------S-
PUR7_POLNA        DEVLTPDSSRYWPVEGYEAAFAAGQNPPSYDKQFVRDWLEAVR--------------IN-
PUR7_XANOM        DEMLTPDSSRYWPADQYEL----GTSPPSYDKQFVRDYLETL------------------
PUR7_XYLFA        DEMLTPDSSRYWPIDEYQV----GTSPPSYDKQFVRNYLETL------------------
PUR7_THISH        DEALTPDSSRFWPADTYRP----GISPPSFDKQFVRDYLETL------------------
PUR7_GEOLS        DECLTPDSSRFWPKDQYQP----GGPQPSFDKQFLRDYLETL------------------
PUR7_ELUMP        DEILTPDSSRFWDAALYKT----GTNPPGFDKQFVRDYMEQT------------------
PUR7_STRCO        DEVLTPDSSRFWPADRWQP----GRAQPSYDKQFVRDWLTSA------------------
PUR7_SALTO        DELLTSDSSRFWPAESYQP----GRAQFSYDKQYVRDWAT--------------------
PUR7_MYCA9        DEVFTPDSSRYWDAAHYQP----GVVQDSFDKQFVRNWLTGP------------------
PUR7_VIBCH        DEVGTPDSSRIWDAQQYQQGKIVENSKEGFRQFLLNYFPDPDI--------------LLN
PUR7_SHEB5        DEVGTPDSSRIWDGAAYRDGKILENSKEGFRQFLLNHFPDPDV--------------LLN
PUR7_PSEAE        GDEFSPDGCRLWDKETRKK----------MDKDRFRQ-----------------------
PUR7_PSEF5        GDEFSPDGCRLWDKDTKKK----------MDKDRFRQ-----------------------
PUR7_ECOLI        GDEFSPDGSRLWDKETLEK----------MDKDRFRQ-----------------------
PUR7_WIGBR        GDEFSLDNSRVWDKNSFKK----------MDKDIFRE-----------------------
PUR7_PYRHO        ADEISPDTCRFWDAKTKRS----------LDKDVFRF-----------------------
PUR7_THESM        GDEISPDTCRFWDAETKES----------LDKDVFRF-----------------------
PUR7_METJA        ADEISPDTMRLWDKETRDV----------LDKDVFRK-----------------------
PUR7_METAC        SDEISCDTCRFWDKKTGQS----------MDKDVFRF-----------------------
PUR7_COPPD        ADEISPDTCRFWDSATMEK----------LDKDRFRR-----------------------
PUR7_THEP3        ADEISPDTCRFWDKNTMEK----------LDKDRFRK-----------------------
PUR7_CLOBB        ADEISPDTCRFWDATTGEK----------LDKDRFRR-----------------------
PUR7_CLOK1        ADEISPDTCRLWDAVTNEK----------LDKDRFRR-----------------------
PUR7_DEIRA        ADEISPDTCRFWDAETNEK----------MDKDRFRR-----------------------
PUR7_CHLP8        GDEISPDTCRFWDAESGEK----------LDKDRFRL-----------------------
PUR7_BACC2        ADEISPDTCRLWDETSNEK----------FDKDVFRR-----------------------
PUR7_BACSU        ADEISPDTCRLWDKETNEK----------LDKDLFRR-----------------------
PUR7_STRPI        ADEFSPDNCRLWDAD-GNH----------MDKDVFRR-----------------------
PUR7_STRTD        ADEFSPDNCRLWDAE-GHH----------MDKDVFRR-----------------------
PUR7_OENOB        ADELSPDNMRLLDKESGKS----------LDKDVFRQ-----------------------
PUR7_STAA8        ADEISPDTCRIWDKATNAN----------FDKDVYRN-----------------------
PUR7_STAES        ADEISPDTCRIWDKNTDTN----------FDKDVYRN-----------------------
PUR7_LISW6        ADEISPDTCRLWDKETKQK----------LDKDVFRR-----------------------
PUR7_NOSP7        ADEISPDTCRLWDTTEEDSN------RRIMDKDRFRR-----------------------
PUR7_RHIME        ADEISPDSCRLWDIETKEK----------MDKDRFRR-----------------------
PUR7_GLUOX        ADEISPDNCRLWDSKTNEK----------MDKDRFRR-----------------------
PUR7_SPHWW        ADEISPDGCRLWDMATGEK----------LDKDRFRQ-----------------------
PUR7_RICM5        TDEISPDNCRLWHINSNEK----------LGFELLEK-----------------------
PUR7_RICTY        TDEISPDNCRLWHINSNEK----------LGFELIEN-----------------------
PUR7_SACS2        GDEISLDSMRIRDGNSRIY-----------DKDLYRKG----------------------
PUR7_THEMA        GDEISPDTFRLRK-KGEIF-----------DKDVYRR-----------------------
PUR7_HERA2        ADMIDNDSWRLWPDGDKSK---------MLDKQIYRNLQTVT------------------
PUR7_THEAC        DTFGTADEDRFWEKKEYDAG-----RIVELSKEMVRQYYRST--GYHDRLYEARSRG---
PUR7_THEVO        DTFGTADEDRFWDEKEYDNG-----RVVELSKEMVRQYYRSI--GYHDKLYYARENG---
PUR7_ARCFU        DAVGTPDECRFSFDG------------FEVSKELLREYYRKT--EWYDKVRQLKGQE---
B5YAR6_DICT6      DALGTLDECRFTFEG------------IPVSKEIARIYYRKT--DWYKEVEEAKKKDR--
PUR7_HALSA        DVAGTFDENRFRFDG------------REVSKEAVRQFYKRSDPEWVGAVKDAKRAADER
M1XNN8_NATM8      DVVGTFDENRFSYAG------------QQLSKEVLRQYHKRTQPEWVEAVAEAKSEAKAE
PUR7_BACTN        DEIHTPDSSRYFYSDGYQERFEKGEPQKQLSKEFVREWLMENGFQ---------------
PUR7_CLOTE        IDEISGGNMRAYKDGEYIE-----------------------------------------
                        .  *                                                  

PUR7_HAEIN        -G--WNKQA--PAPKVPENIIQKTVDKYQEALDLLTK-----------------------
PUR7_POLNA        -GKPWDKTP--PSPHLPPDVISKTAAKYQEAMARLTA-----------------------
PUR7_XANOM        ---DWGKTA--PGPSLPADVIDRTRAKYAEALQRLAGISVD-------------------
PUR7_XYLFA        ---DWDKTA--PGPTLPQDIIDRTRAKYTKALQQLAGINID-------------------
PUR7_THISH        ---DWNKQA--PGPELPPDVVQKTTEKYREALLRLTGAS---------------------
PUR7_GEOLS        ---DWGKTA--PAPPLPEEIVTKTGEKYKEALFKLAGITV--------------------
PUR7_ELUMP        ---GWDKNP--PPPAMPQSIALAAAKKYKEALSRIEKGSV--------------------
PUR7_STRCO        -ESGWDRKSEQPPPPLPQQVVDATRAKYVEAYELLTGQSWS-------------------
PUR7_SALTO        -RSGWDRRS--PAPEVPDEVVDATRARYVDVYERLTGERWG-------------------
PUR7_MYCA9        -ESGWDRASDTPPPPLPDEVAVATRERYIEAYERISGLSFSDWIGPSA------------
PUR7_VIBCH        KDRMPEREALARDNALPLEALMDISRTYLGIAEKITGQPIHLSHQPKQEIIAILDKEYGL
PUR7_SHEB5        KDRMPEREALARDNDLPLEAMMQVSRTYTGVAEKVTGAPIPLPANPKADIIKILKDEYDL
PUR7_PSEAE        ------------------GLG-DVIEAYEEVAKRLGVPL---------------------
PUR7_PSEF5        ------------------GLG-DVIEAYEEVAQRLGVPL---------------------
PUR7_ECOLI        ------------------SLG-GLIEAYEAVARRLGVQLD--------------------
PUR7_WIGBR        ------------------QLNENVIESYKEVANRIGCLID--------------------
PUR7_PYRHO        ------------------DKG-DLIEAYKEIYERITGEKPEF------------------
PUR7_THESM        ------------------DKG-ELINAYEELYKRLTA-----------------------
PUR7_METJA        ------------------DLG-DVIAKYRIVAERLGLL----------------------
PUR7_METAC        ------------------DKG-DISKAYEEVARRIVPEIFE-------------------
PUR7_COPPD        ------------------DMG-GVEEAYMEIARRLGCV----------------------
PUR7_THEP3        ------------------DLG-KVEEAYLEILKRLGGM----------------------
PUR7_CLOBB        ------------------DLG-NVEDAYIEILKRISK-----------------------
PUR7_CLOK1        ------------------DMG-NVKEAYEEILRRISDN----------------------
PUR7_DEIRA        ------------------DLG-GEAEAYAEMLKRVTREV---------------------
PUR7_CHLP8        ------------------DLG-GVEDAYSEVKRRVLEQ----------------------
PUR7_BACC2        ------------------DLG-NLTEAYEEILKRLGGISHV-------------------
PUR7_BACSU        ------------------NLG-SLTDAYEEIFNRLGGIHHV-------------------
PUR7_STRPI        ------------------GLG-ELTDVYEIVWEKLQELK---------------------
PUR7_STRTD        ------------------DLG-SLTDVYEVVLEKLQGLK---------------------
PUR7_OENOB        ------------------KIG-DVRIGYQTVLDRLNNKLIAGEN----------------
PUR7_STAA8        ------------------NTG-SLIETYQIFLNKLEDLK---------------------
PUR7_STAES        ------------------NTG-SLIETYQTFLNKLEDLK---------------------
PUR7_LISW6        ------------------NIG-NLTDVYTEVLNRLKQVQN--------------------
PUR7_NOSP7        ------------------DLG-NVEDAYQEVLQRVLKAVETTN-----------------
PUR7_RHIME        ------------------DMG-GLVEAYQEVARRLGIINENEPPRGSGPVLVK-------
PUR7_GLUOX        ------------------DMG-RVEEAYQEVAKRLGILPESGNGDLKGPEAVQ-------
PUR7_SPHWW        ------------------DLG-GEVEAYQEIARRLGLMPDGENMILDLESHRKNRGK---
PUR7_RICM5        ------------------EPN-KVFESYQLIADRLKEK----------------------
PUR7_RICTY        ------------------EPN-KAFESYQLIANRLKEK----------------------
PUR7_SACS2        ------------------YDLKTVKSSYEEFLKRITS-----------------------
PUR7_THEMA        -------------------DLGDPLKKYREVLELCRSLNSQ-------------------
PUR7_HERA2        -----------------EEALQNLKAKYEEVRDITESFR---------------------
PUR7_THEAC        -------MPEPDIPPLPEDMARKVSDLYKTMYERITGQKW--------------------
PUR7_THEVO        -------LPEPDIPALSDDMVSKVSDLYRMMFEKITGQKW--------------------
PUR7_ARCFU        ---GWREAVGLPP-PLPDEVREGVSNLYRAFCNEVTGRKFFDAPKLKEVVSQLKEVLE--
B5YAR6_DICT6      --FNWKNYVSTPP-KLPKEIKDLISLIYKAYVNELTEIEWFETPPMKDLLTRLRELI---
PUR7_HALSA        GVADWKSLCEPSPDPLPPEILQAAADLYAAGANRYTAREWFDAPPLGDALDAFE------
M1XNN8_NATM8      DVADWRELCGVDPEPLPAHVVDAAREMYTAGTNAYLGRDLFDAPALEDAVAAIESF----
PUR7_BACTN        ------GKDGQKVPEMTPAIVQSISDRYIELFENITGEKFVKEDTSNIAERIEKNVMNFL
PUR7_CLOTE        -----------------------PLDLEKLIIE---------------------------
                                                                              

PUR7_HAEIN        ---
PUR7_POLNA        ---
PUR7_XANOM        ---
PUR7_XYLFA        ---
PUR7_THISH        ---
PUR7_GEOLS        ---
PUR7_ELUMP        ---
PUR7_STRCO        ---
PUR7_SALTO        ---
PUR7_MYCA9        ---
PUR7_VIBCH        IER
PUR7_SHEB5        IV-
PUR7_PSEAE        ---
PUR7_PSEF5        ---
PUR7_ECOLI        ---
PUR7_WIGBR        ---
PUR7_PYRHO        ---
PUR7_THESM        ---
PUR7_METJA        ---
PUR7_METAC        ---
PUR7_COPPD        ---
PUR7_THEP3        ---
PUR7_CLOBB        ---
PUR7_CLOK1        ---
PUR7_DEIRA        ---
PUR7_CHLP8        ---
PUR7_BACC2        ---
PUR7_BACSU        ---
PUR7_STRPI        ---
PUR7_STRTD        ---
PUR7_OENOB        ---
PUR7_STAA8        ---
PUR7_STAES        ---
PUR7_LISW6        ---
PUR7_NOSP7        ---
PUR7_RHIME        ---
PUR7_GLUOX        ---
PUR7_SPHWW        ---
PUR7_RICM5        ---
PUR7_RICTY        ---
PUR7_SACS2        ---
PUR7_THEMA        ---
PUR7_HERA2        ---
PUR7_THEAC        ---
PUR7_THEVO        ---
PUR7_ARCFU        ---
B5YAR6_DICT6      ---
PUR7_HALSA        ---
M1XNN8_NATM8      ---
PUR7_BACTN        SK-
PUR7_CLOTE        ---