CLUSTAL format seed alignment for MF_00139

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

PUR9_LEPIN       ---------------MIQIKRALISVSDKSGLVEFAKFLN-QNGVEIISTGGTLKLLKDN
PUR9_LEPBA       ---------------MIQIKRALVSVSDKTGITEICSFLT-KHGVEILSTGGTYDALSKA
PUR9_BUCAI       ------------MPSNNLIKNALISVSDKKNIVEVAEKLI-INKINLFSTGGTAQILKKN
PUR9_WIGBR       -----------MEQSFLPIRCALISVSDKTGIFSLAKNLI-KHKVKLITTSGTYKYLLEK
PUR9_SYNY3       -----------------MARLALLSVSDKSGIVELAQRLVNEFQFDLISSGGTAKTLKEA
PUR9_THEEB       -----------------MGRMALLSTSNKQGLVELARALVQEFGFTLLSSGGTAKALQTA
PUR9_PROMA       -----------------MPPIALLSVSNKEGLIPLAKELSIEYGFEIISSGGTAKTLQQA
PUR9_MOOTA       -----------------MSKRALISVSDKTGLVELARGLV-ELGWELLSTGGTARTLIAA
PUR9_BACAN       -----------------MKKRALVSVSDKTGVVEFVKGLL-EQGIEVISTGGTKKLLEEN
PUR9_BACCR       -----------------MKKRALVSVSDKTGVVEFVKGLL-EQGIEVISTGGTKKLLEEN
PUR9_BACC2       -----------------MKKRALVSVSDKTGVVEFVKGLL-EQGIEVISTGGTKKLLEAN
PUR9_BACSU       ----------------MTIKRALISVSDKTNLVPFVKELT-ELGVEVISTGGTKKLLQEN
PUR9_BACHD       -----------------MKRRALVSVSNKEGIVPFAKALV-EHEVEIVSTGGTKRALQEA
PUR9_LISMO       ------------------MKRALISVSDKNGIVPFAEKLV-ELGVEIISTGGTKAAFEQA
PUR9_LACPL       -----------------MTKRALLSVSDKQGLTDFAKGLV-ALDYELISTGGTKKALEAA
PUR9_STRP4       -----------------MTKRVLISVSDKAGIVEFAQELK-KLGWEIISTGGTKVALDNA
PUR9_STRR6       -----------------MTKRVLISVSDKAGIVEFAQELK-KLGWEIISTGGTKVALDNA
PUR9_STRPD       -----------------MTKRALISVSDKSGIVDFAKELK-NLGWDIISTGGTKVALDDA
PUR9_LACLA       -----------------MSKRALISVSDKEGIVEFAKEIR-ELGWEIISTGGTKAVLDQE
PUR9_ENTFA       -----------------MTKRALISVSDKTGVTTFAAGLV-ANGFEIISTGGTRTVLEEA
PUR9_STAA8       ------------------MKKAILSVSNKTGIVEFAKALT-QLNYELYSTGGTKRILDEA
PUR9_DEIRA       -----------------MTKRALISVSDKTGVVEFAAQLQ-QRGWELLSTGGTFATLSGA
PUR9_GEOSL       ---------------MAKITRALISVSDKTGILDFARELA-GYGVEILSTGGTAKLLRDA
PUR9_GEODF       ---------------MAKISRALISVSDKTGIVDFSKELA-GYGVEILSTGGTAKLLREA
PUR9_VIBPA       ------------MNNARPIRRALISVSDKTGIVEFAQALA-ERGVDILSTGGTARLLAEQ
PUR9_ALIF1       ------------MNNARPIRRALISVSDKTGIVEFAQALA-ERGVDILSTGGTARLLAEK
PUR9_VIBCH       ------------MNNARPIHRALLSVSDKTGIVEFAKALA-ERGVELLSTGGTARLLAEQ
PUR9_SHEON       ---------MTVANHARPIRRALLSVSDKTGILEFAKALH-AQGVELLSTGGTARLLADN
PUR9_COLP3       ------------MDTPRPIKRALLSVSDKAGIVEFAQRLS-EKGVDLLSTGGTAKLLAEN
PUR9_ECOSE       ------------MQQRRPVRRALLSVSDKAGIVEFAQALS-ARGVELLSTGGTARLLAEK
PUR9_SHIDS       ------------MQQRRPVRRALLSVSDKAGIVEFAQALS-ARGVELLSTGGTARLLAEK
PUR9_ECOLI       ------------MQQRRPVRRALLSVSDKAGIVEFAQALS-ARGVELLSTGGTARLLAEK
PUR9_SALTY       ------------MQQRRPVRRALLSVSDKAGIIEFAQALS-ARGVELLSTGGTARLLAEK
PUR9_YERPE       ------------MQQRRPIRRALLSVSDKAGIIEFAQALS-QRGIELLSTGGTARLLADA
PUR9_HAEIN       -------------MADRPIRQALLSVSDKTGIVEFAQGLV-KRGVKLLSTGGTAKLLAQN
PUR9_PSEAE       ---------MTDQTTRLPIRRALISVSDKTGVVDFARELV-ALGVEILSTGGTYKLLRDN
PUR9_PSEPW       ---------MTDQTTRLPVRRALISVSDKTGILEFARELQ-QLGVEILSTGGTYKLLKDN
PUR9_BURM9       -----------------MIKQALISVSDKTGIVDFAKALS-ALGVKLLSTGGTAKLLADA
PUR9_BURPS       -----------------MIKQALISVSDKTGIVDFAKALS-ALGVKLLSTGGTAKLLADA
PUR9_BURVG       -----------------MIKQALISVSDKTGIVDFAKSLS-DLGVKLLSTGGTAKLLADA
PUR9_NEIG1       ---------------MSVIKRALISLSDKAGAVEFAQNLH-KLGVEILSTGGTAKLLAGA
PUR9_NEIMB       ---------------MSSIKRALISLSDKTGAVEFAQTLH-KLGVEILSTGGTAKLLADA
PUR9_LARHH       ---------------MTKIERALISVSDKTGILEFARGLA-AHGVEILSTGGTAKLLADN
PUR9_XANCP       -----------MASDFLPVRRALLSVSDKTGLIDLARALV-ARNVELLSTGGTAKAIRDA
PUR9_MAGMM       ---------------MAKIKRALISVSDKTGLVPFCQGLA-EHGVSFLSTGGTARLLRES
PUR9_BRUSI       ---MAVSSKHIPAPDLHRVRRALLSVSDKTGLIDFAKALH-ANGVEILSTGGTAKSIAAA
PUR9_AGRFC       ---MAVVSKKIPAPDKVKIRTALLSVSDKTDIIELATVLS-KLGVKLLSTGGTAKAIAEA
PUR9_BRADU       -----------MTDHPRRVTRALLSVSDKTGLIEFAKALA-AHDVELVSTGGTAKAIAAA
PUR9_RHOS4       ------------MTNLVPVGRALLSVSDKSGLLDLARALA-DLEVELISTGGTAAALRAA
PUR9_PARDP       ------------MTDRIPLKRALISVSDKTGLVDFARALS-ARGVEILSTGGTAKTLREA
PUR9_RHORT       ------------MLHSLPIRRALISVSDKGGLVPFARFLA-DHDIEILSTGGSAKALADA
PUR9_CAUVC       ---MPAAPDYPSAPDLVAPKRALLSVSDKTGLVDAAKILH-AAGVELVSTGGTKAAIAAA
PUR9_CHLTE       -------------MLDPVIKRALVSVSDKTGIVDFCRELA-SMDVEIFSTGGTLKLLQGA
PUR9_PELPB       -------------MSDPVIKRALVSVSDKTGIVEFCRELS-GMGVEIFSTGGTLKSLQDS
PUR9_CHLAA       ------------MIGEERVVRALMSVYDKTGIVEFAQALH-NLGIEIISTGQTQRVLREA
PUR9_MYCSJ       MSGDQGQAGAKR-----PIRRALISVYDKSGLIDLARGLH-EAGVDIVSTGSTAKTIADK
PUR9_MYCTU       MSTDDG----RR-----PIRRALISVYDKTGLVDLAQGLS-AAGVEIISTGSTAKTIADT
PUR9_CORGL       MSDDRK-----------AIKRALISVYDKTGLEDLAQALH-RENVEIVSTGSTAAKIAEL
PUR9_STRCO       MTATAGSN--KR-----AIRRALVSVYDKTGLEDLARGLH-EAGVELVSTGSTAGRIAAA
PUR9_BIFLO       MTNTNR-----------PIRRALVSVFHKEGIEVLAEAFV-KAGTEVVSTGSTAKKLAEL
PUR9_LEIXX       MNGPRHDTSLFRERDVVPIRRALISVSDKTGLLDLAASLA-DAGVEIVSTGSTAQTIREA
PUR9_RHOBA       MSDVVP------------VRNALISVSDKMGLADFAAGLS-AAGVTIYSTGGTRAHLEQS
PUR9_BACTN       MSESKR------------IKTALVSVYHKEGLDEIITKLY-EEGVEFLSTGGTRQFIESL
PUR9_THEMA       ------------------MKRILVSLYEKEKYLDILRELH-EKGWEIWASSGTAKFLKSN
PUR9_THEYD       -----------------MIKRALISVSDKRGLVDFAKELD-KLGVEILSTGGTAKTLRDS
PUR9_AQUAE       -------------------MRAIISVYRKEGIDKLAKALQ-ELGYEIVSTGGTAKYLREK
PUR9_CLOBH       -----------------MIKRALISVFDKTGILDLAKFLE-SRDVEIISTGGTYKHLKEN
PUR9_CLOAB       -----------------MIKRALISVFNKNGILKLAKFLN-EKGVEILSTGGTYKHLKEN
PUR9_FUSNN       -----------------MRKRALISVYDKTGILDFAKFLV-SKGIEIISTGGTYKYLKEN
PUR9_DICDI       -------------------MQALLSVYNKSGIVEFSKILS-SKGFNLISTGGTAKSLVDN
PUR9_CAMJE       -------------------MRALLSVSDKEGIVEFGKELE-NLGFEILSTGGTFKLLKEN
PUR9_MOUSE       ---------------MAPSQLALFSVSDKTGLVEFARSLA-SLGLSLVASGGTAKAIRDA
PUR9_HUMAN       ---------------MAPGQLALFSVSDKTGLVEFARNLT-ALGLNLVASGGTAKALRDA
PUR92_YEAST      --------------MANYTKTAILSVYDKTGLLDLARGLI-EKNVRILASGGTARMIRDA
PUR91_YEAST      --------------MGKYTKTAILSVYDKTGLLDLAKGLV-ENNVRILASGGTANMVREA
PUR9_SCHPO       -------------------MYALLSVYDKTGLLELAKALT-SKGVKLLGSGGTAKMIRES
                                       :.*   *         :       .  :. :   .   

PUR9_LEPIN       GIAAIAIDDYTGFPEILDGRVKTLHPKVHGGLLGVISNPAHKQKMEELKIPKIDLVVVNL
PUR9_LEPBA       GIAVKKVDEFTGFPEILHGRVKTLHPKIHGGLLGDTTNPDHVKQMESNGIVPITLVIVNL
PUR9_BUCAI       NIPVTEISDYTKFPEIMDGRVKTLHPKIMGGILGQKQKDQEIMKL--YNICPIDIVIVNF
PUR9_WIGBR       GIFSTSVSEYINHPEIINGRVKTLHPKIHGGILSNN-KNINENKN--LNIKKIDMVITNF
PUR9_SYNY3       GVPVTKVSDYTGAPEILGGRVKTLHPRIHGGILARRDLPSDQADLEANDIRPLDLVVVNL
PUR9_THEEB       GIPVTTVSEYTGAPEILGGRVKTLHPKIHGGILARRDRPQDEADLQAQAIHPIDLVVVNL
PUR9_PROMA       GILVTPVAEYTGAPEILGGRVKTLHPKVHGGILAKKGDLFHQKDLKDQKIKAIDLVVVNL
PUR9_MOOTA       GLPVTEVAAVTGFPEILDGRVKTLHPKIHGGILARP-TPEHLAQLQEQGIQPIDLVVVNL
PUR9_BACAN       GLQVIGISEVTGFPEIMDGRVKTLHPNIHGGLLAVRDNETHVAQMNELGMEPIDFVVVNL
PUR9_BACCR       GLQVIGISEVTGFPEIMDGRVKTLHPNIHGGLLAVRDNETHVTQMNELGMEPIDFVVVNL
PUR9_BACC2       GLQVIGISEVTGFPEIMDGRVKTLHPNIHGGLLAVRDNETHVIQMNELGIQPIDFVVVNL
PUR9_BACSU       GVDVIGISEVTGFPEIMDGRLKTLHPNIHGGLLAVRGNEEHMAQINEHGIQPIDLVVVNL
PUR9_BACHD       GIPVTGISDVTGFPEILDGRVKTLHPNIHGGLLAMRERDEHLAQLNEHHIRPIDFVVVNL
PUR9_LISMO       GVPVTGIEEVTEFPEMLDGRVKTLHPAIHGGLLARRDTAEHMEAIAAHNIKPIDLVIVNL
PUR9_LACPL       DIPVIGIEEVTGFPEMLDGRVKTLHPKVHAGLLARRDLPAHMAQLKAAGIQPIDMVVVNL
PUR9_STRP4       GVDTIAIDDMTGFPEMMDGRVKTLHPNIHGGLLARRDLDSHLEAAKDNKIELIDLVVVNL
PUR9_STRR6       GVETIAIDDVTGFPEMMDGRVKTLHPNIHGGLLARRDLDSHLEAANENQIELIDLVVVNL
PUR9_STRPD       GVETIAIDDVTGFPEMMDGRVKTLHPNIHGGLLARRDADSHLQAAKDNNIELIDLVVVNL
PUR9_LACLA       EIPNIAIDEVTGFPEMMDGRLKTLHPLIHGALLGRRDLESHMKSMTEHHISPIDLVVVNL
PUR9_ENTFA       GVPTLAIDDITGFPEMLDGRVKTLHPNIHGGLLAKRGNQAHQKALTEQGIHFIDLVVVNL
PUR9_STAA8       NVPVRSVSDLTHFPEIMDGRVKTLHPAVHGGILADRNKPQHLNELSEQHIDLIDMVVVNL
PUR9_DEIRA       GIPVRQVSDVTGFPEMLDGRVKTLHPAIHGGILARR-EAGHLGQLAAQDIGTIDLVCVNL
PUR9_GEOSL       GLAVKDVSDFTGFPEMLDGRVKTLHPKVHGGLLGMRSNPDHVATMKAHGIEPIDLVVVNL
PUR9_GEODF       GLAVKDVSEFTGFPEMLDGRVKTLHPKVHGGLLGMRGNSEHVATMKAHGIEPIDMVVVNL
PUR9_VIBPA       GIAVTEVSDYTGFPEMMDGRVKTLHPKVHGGVLGRRGQDD--DVMAKHGINPIDMVVVNL
PUR9_ALIF1       GISVTEVSDYTGFPEMMDGRVKTLHPKVHGGVLGRRGQDD--DIMEQHGINPIDMVVVNL
PUR9_VIBCH       GLTVTEVSDYTGFPEMMDGRVKTLHPKVHGGILGRRGQDD--AVMNTHGIQPIDMVVVNL
PUR9_SHEON       GVPVIEVSDYTGHPEIMDGRVKTLHPKVHGGILARRGLDE--NVMAANNINAIDLVAVNL
PUR9_COLP3       GIKVTEVSDYTGHPEIMDGRVKTLHPKVHGGILARRGIDE--VVMDENGISAIDMVVVNL
PUR9_ECOSE       GLPVTEVSDYTGFPEMMDGRVKTLHPKVHGGILGRRGQDD--AIMEEHQIQPIDMVVVNL
PUR9_SHIDS       GLPVTEVSDYTGFPEMMDGRVKTLHPKVHGGILGRRGQDD--AIMEEHLIQPIDMVVVNL
PUR9_ECOLI       GLPVTEVSDYTGFPEMMDGRVKTLHPKVHGGILGRRGQDD--AIMEEHQIQPIDMVVVNL
PUR9_SALTY       GLPVTEVSDYTGFPEMMDGRVKTLHPKVHGGILGRRGQDD--AIMEQHHIAPIDMVVVNL
PUR9_YERPE       GLPVTEVSDYTGFPEMMDGRVKTLHPKVHGGILGRRGQDD--GIMAQHGIQPIDIVVVNL
PUR9_HAEIN       ALPVIEVSDYTGFPEMMDGRVKTLHPKVHGGILGRRGTDD--AIMQQHGIEGIDMVVVNL
PUR9_PSEAE       GISAVEVADYTGFPEMMDGRVKTLHPKVHGGILGRRDLDG--AVMEQHGIKPIDLVAVNL
PUR9_PSEPW       GVNAVEVADYTGFAEMMDGRVKTLHPKIHGGILGRRGVDD--AIMNEHGIKPIDLVAVNL
PUR9_BURM9       GLPVTEVADYTGFPEMLDGRVKTLHPKVHGGILARRDLPEHMQALEAHGIPTIDLLVVNL
PUR9_BURPS       GLPVTEVADYTGFPEMLDGRVKTLHPKVHGGILARRDLPEHMQALEAHGIPTIDLLVVNL
PUR9_BURVG       GLPVTEVADYTGFPEMLDGRVKTLHPKVHGGILARRDLPEHMQALEQHDIPTIDLLVVNL
PUR9_NEIG1       GVPVIEVADYTGFPEMLDGRVKTLHPKIHGGILGRRDLDEHVAKMEEHGIGNIDLVCVNL
PUR9_NEIMB       GVPVIEVADYTGFPEMLDGRVKTLHPKIHGGILGRRDLDEHVAKMEEHGIGNIDLVCVNL
PUR9_LARHH       NVPVIEVADYTGFPEMLDGRVKTLHPKIHGGILGRRDLPEHVAKMAEHGIGNIDLVCVNL
PUR9_XANCP       GLPVKDVAELTGFPEMMDGRVKTLHPLVHGGLLGRAGVDEAV--MAEHGIAPIDLLVLNL
PUR9_MAGMM       GLDVMDVSEFTGFPEMLDGRVKTLHPKVHGGLLGLRDNASHQQQMGEHGIEPIDMVVVNL
PUR9_BRUSI       GIPVKDVSEITGFPEIMDGRVKTLHPAVHGGLLAVRNDPEHVAAMEEHGIGGIDLAVINL
PUR9_AGRFC       GLAVTDVSDVTNFPEIMDGRVKTLHPNVHGGLLAIRDDAEHVEAMKAHGIEAIDLSVINL
PUR9_BRADU       GLKVKDVSELTGFPEMMDGRVKTLHPKVHGGLLAIRDNKDHADAMKAHGIAPIDLLVVNL
PUR9_RHOS4       GLKVRDVAEVTGFPEMMDGRVKTLHPMVHGGLLALRDDDEHLVAMAAHGIEPIDLLVVNL
PUR9_PARDP       GLSVVDVADVTGFPEMMDGRVKTLHPVVHGGLLALRDNDEHMAAAKSHRIGMIDLLVVNL
PUR9_RHORT       GIPVTEVADFTGFPEMLDGRVKTLHPKIHGGILGIRDNPEHQRAMAAHEILPIDLVVVNL
PUR9_CAUVC       GVPVKDVSDLTGFPEMMDGRVKTLHPVVHGGLLGVRDAADHAKAMADHGIGGIDILYVNL
PUR9_CHLTE       GIVAQSISTITGFPEIMDGRVKTLHPKIHGGLLAVRDNAEHQKAARENGIQFIDLVVVNL
PUR9_PELPB       GVSASSISTITGFPEIMDGRVKTLHPKIHGGLLAVRENPEHVKQATENGISFIDLVVVNL
PUR9_CHLAA       GIPALPVSDVTGFPEILDGRVKTLHPAIHAGLLARRDVPAHMAELAAHNLQPIDLVVVNL
PUR9_MYCSJ       GIPVTPVEFVTGFPEVLDGRVKTLHPHIHAGLLADTRKPEHVEALAKLGIAPFDLVVVNL
PUR9_MYCTU       GIPVTPVEQLTGFPEVLDGRVKTLHPRVHAGLLADLRKSEHAAALEQLGIEAFELVVVNL
PUR9_CORGL       GIPVTPVEELTGFPECLEGRVKTLHPKVHAGILADTRKEDHLRQLKELEVAPFQLVVVNL
PUR9_STRCO       GVPVTKVEELTGFPECLDGRVKTLHPKVHAGILADLRLESHRQQLDELGVAPFDLVVVNL
PUR9_BIFLO       GVKVTEVSDVTGFPECLDGRVKTLHPYIHAGILADMTNPEHAKQLEEFGIKPFDLVVVNL
PUR9_LEIXX       GHTVTDVASVTGFPESLDGRVKTLHPAIHSGLLADLRLASHEEQLKDLGIEPFELVVVNL
PUR9_RHOBA       GIKVEDVAEYTGFPEMLDGRVKTLHPRIFAGILARRDLDDHMDTIADHDIEPFDLVVVNL
PUR9_BACTN       GYPCKAVEDLTTYPSILGGRVKTLHPKIFGGILCRRDLEQDIQQIEKYEIPEIDLVIVDL
PUR9_THEMA       GIEANDVSTITGFENLLGGLVKTLHPEIFAGILGPE--------------PRWDVVFVDL
PUR9_THEYD       GIKVIDVSQYTGFPEIMDGRVKTLHPLIHGGILARRDNKEDIEAMERLGIKPIDMVVVNL
PUR9_AQUAE       GISVKEVSEITGFPEILEGRVKTLHPVVHGGILFRDWVEKDKEEIEKHGIKPIDVVVVNL
PUR9_CLOBH       GVKVIDIEEVTGFPEMLDGRVKTLNPLIHGGILAIRDNEEHMKVIEEKGINPIDMVVVNL
PUR9_CLOAB       GIPVIEVSEVTGFDEILDGRVKTLHPKIHGGILAIRDNKEHMDTIKNKGITPIDMVVVNL
PUR9_FUSNN       NIEVIEVSKITNFEEMLDGRVKTLHPNIHGGILALRDNEEHMRTLKERNIDTIDYVIVNL
PUR9_DICDI       GLKVQQVSDVTEYPEMLDGRVKTLHPKIHGGLLARPELAHHQADLNKYNIKPISIVVVNL
PUR9_CAMJE       GIKVIEVSDFTKSPELFEGRVKTLHPKIHGGILHKRSDENHIKQAKENEILGIDLVCVNL
PUR9_MOUSE       GLAVRDVSELTGFPEMLGGRVKTLHPAVHAGILARNIPEDA-ADMARLDFNLVRVVVCNL
PUR9_HUMAN       GLAVRDVSELTGFPEMLGGRVKTLHPAVHAGILARNIPEDN-ADMARLDFNLIRVVACNL
PUR92_YEAST      GFPIEDVSAITHAPEMLGGRVKTLHPAVHGGILARDIDSDE-KDLKEQHIEKVDYVVCNL
PUR91_YEAST      GFPVDDVSSITHAPEMLGGRVKTLHPAVHAGILARNLEGDE-KDLKEQHIDKVDFVVCNL
PUR9_SCHPO       GMEVADVSSITNAPEILGGRVKTLHPAVHGGILARDIPSDE-KDLVEQSIEKIDIVVCNL
                       :       . : * :***:* : ..:*                         ::

PUR9_LEPIN       YPFLKTVSKPEVQ------------LEEAIENIDIGGPSMIRSAAKNYKHTLVLTDPNDY
PUR9_LEPBA       YPFVKTVMKPDVT------------LEDAIENIDIGGPSMLRSAAKNHKNVVVLTDPKDY
PUR9_BUCAI       YPFEKIKNIKKND------------IDNVVNNIDIGGPTLVRASAKNYKNVIVIVDLDDF
PUR9_WIGBR       YPFKKKVKKENIK------------IENIIDNIDIGGVALARSAAKNYKYVTVVVNINQY
PUR9_SYNY3       YPFEQTIAKPGVT------------VAEAVEQIDIGGPAMIRATAKNFAHTTVLTNPNQY
PUR9_THEEB       YPFAETIAQPNVT------------LAEAIEQIDIGGPTLIRAAAKNHAHVTVLVDPSQY
PUR9_PROMA       YPFQETIKKPNIS------------WEEAIENIDIGGPAMVRAAAKNHESVSVLTRPEQY
PUR9_MOOTA       YPFRETIARPGVT------------PAEAIENIDIGGPAMVRAAAKNHERVGIVVDPASY
PUR9_BACAN       YPFKETIAKPDVT------------FADAIENIDIGGPTMIRSAAKNHKFVSVIVDPVDY
PUR9_BACCR       YPFKETIAKPDVT------------FADAIENIDIGGPTMIRSAAKNHKFVSVIVDPVDY
PUR9_BACC2       YPFKETIAKPDVT------------FADAIENIDIGGPTMIRSAAKNHQFVSVIVDPVDY
PUR9_BACSU       YPFKETISKEDVT------------YEEAIENIDIGGPGMLRAASKNHQDVTVIVDPADY
PUR9_BACHD       YPFQQTIAKPEAT------------FADAIENIDIGGPSMLRAAAKNHQHVTVVVDPVDY
PUR9_LISMO       YPFQETIQKPGVT------------LEEAIENIDIGGPSMLRSAAKNYAAVTVVVDTADY
PUR9_LACPL       YPFKATIQQPDVT------------QAEAIEQIDIGGPSMLRSAAKNFAAVLPIVDPADY
PUR9_STRP4       YPFKETILKPDVT------------YADAVENIDIGGPSMLRSAAKNHASVTVVVDPADY
PUR9_STRR6       YPFKETILKPDVT------------YADAVENIDIGGPSMLRSAAKNHASVTVVVDPADY
PUR9_STRPD       YPFKETILRPDIT------------YDLAVENIDIGGPSMLRSAAKNHASVTVVVDPADY
PUR9_LACLA       YPFKETLLAGG-S------------QAEMIEKIDIGGPSMLRSAAKNHASVTVVCDPNDY
PUR9_ENTFA       YPFKETILKPAIS------------EAEAIEMIDIGGPSMLRSAAKNYQDVTAVVDPSDY
PUR9_STAA8       YPFQQTVANPDVT------------MDEAIENIDIGGPTMLRAAAKNYKHVTTIVHPADY
PUR9_DEIRA       YPFRETV-ARGAP------------DPEVIENIDIGGPAMIRSAAKNHDAVLVLVDPADY
PUR9_GEOSL       YPFEATVAKPECT------------LEDAIENIDIGGPTMLRSAAKNNADVTVLVDPADY
PUR9_GEODF       YPFEATVAKPDCS------------LEDAIENIDIGGPTMLRSAAKNNADVTVLVDHNDY
PUR9_VIBPA       YPFAETVAKDGCT------------LADAVENIDIGGPTMVRSAAKNHKDVTIVVNASDY
PUR9_ALIF1       YPFAETVAKEGCT------------LADAVENIDIGGPTMVRSAAKNHKDVTIVVNAHDY
PUR9_VIBCH       YPFAQTVANPNCT------------LADAVENIDIGGPTMVRSAAKNHKDVAIVVNAHDY
PUR9_SHEON       YPFADTVAKAGCT------------LEDAIENIDIGGPTMVRAAAKNHKDVTIVVNAADY
PUR9_COLP3       YPFANAVSDENCS------------LENAIENIDIGGPTMVRAAAKNHKDVTIVVNASDY
PUR9_ECOSE       YPFAQTVAREGCS------------LEDAVENIDIGGPTMVRSAAKNHKDVAIVVKSSDY
PUR9_SHIDS       YPFAQTVAREGCS------------LEDAVENIDIGGPTMVRSAAKNHKDVAIVVKSSDY
PUR9_ECOLI       YPFAQTVAREGCS------------LEDAVENIDIGGPTMVRSAAKNHKDVAIVVKSSDY
PUR9_SALTY       YPFAETVAREGCS------------LEDAVENIDIGGPTMVRSAAKNHKDVAIVVKSSDY
PUR9_YERPE       YPFAQTVARPDCS------------LEDAVENIDIGGPTMVRSAAKNHKDVAIVVKSSDY
PUR9_HAEIN       YPFAATVAKPDCT------------LADAVENIDIGGPTMVRSAAKNHKDVAIVVNNHDF
PUR9_PSEAE       YPFEATVARPDCD------------LPTAIENIDIGGPTMVRSAAKNHKDVAIVVNAGDY
PUR9_PSEPW       YPFEATIAKPGCD------------LPTAIENIDIGGPTMVRSAAKNHKDVAIVVNASDY
PUR9_BURM9       YPFVQTIAKDDCT------------LADAIENIDIGGPTMLRSAAKNHRDVTVVVDPADY
PUR9_BURPS       YPFVQTIAKDDCT------------LADAIENIDIGGPTMLRSAAKNHRDVTVVVDPADY
PUR9_BURVG       YPFVATIAKDDCT------------LADAIENIDIGGPTMLRSAAKNHRDVTVVVDPADY
PUR9_NEIG1       YPFAATIAKPGCT------------LEDAIENIDIGGPTMVRSAAKNWKHVAIVTDTADF
PUR9_NEIMB       YLFAATIAKPNCT------------LEDAIENIDIGGPTMVRSAAKNWKHVAIVTDTADF
PUR9_LARHH       YPFEATIAKEGCA------------LEDAIENIDIGGPTMVRSAAKNWAHVAIVTDAADY
PUR9_XANCP       YPFESVTAKADCT------------LADAVENIDIGGPAMLRSAAKNFARVAVATDPAQY
PUR9_MAGMM       YPFEATVAKEGCT------------LEEAIENIDIGGPSMLRSAAKNYRSVTVVTDPADY
PUR9_BRUSI       YPFEEVRFK-GGD------------YDTTVENIDIGGPAMIRASAKNHAYVATVVDPADY
PUR9_AGRFC       YPFEEVRAK-GGD------------YPTTVENIDIGGPAMIRASAKNHAYVTVVTDPSDY
PUR9_BRADU       YPFEATVDK-GAG------------FEDCIENIDIGGPAMIRAAAKNHDDVAVVVEAEDY
PUR9_RHOS4       YPFEAAVAR-GAS------------YDDCIENIDIGGPAMIRAAAKNHRFVNVVTDTADY
PUR9_PARDP       YPFEATVAK-GAA------------YDDCIENIDIGGPAMIRAAAKNHAFVTVVVDVQDY
PUR9_RHORT       YPFEATVAK-GAA------------FEDCVENIDIGGPALIRAAAKNHEAVTVVVDPEDY
PUR9_CAUVC       YPFEATVAK-GGS------------YAECVENIDIGGPAMIRSAAKNHGYVAVCTDPSDL
PUR9_CHLTE       YPFEATIAKADVT------------FEEAIENIDIGGPSMLRSAAKNNESVTVVTDVADY
PUR9_PELPB       YPFEATVARPDVT------------FEDAIENIDIGGPSMLRSAAKNNESVTVVTDSADY
PUR9_CHLAA       YPFAATIARPDVT------------MAEAQEQIDIGGVALLRAAAKNFPAVLVLVDPADY
PUR9_MYCSJ       YPFSETVE-SGAS------------VDECVEQIDIGGPSMVRAAAKNHPSVAVVVEPNGY
PUR9_MYCTU       YPFSQTVE-SGAS------------VDDCVEQIDIGGPAMVRAAAKNHPSAAVVTDPLGY
PUR9_CORGL       YPFAETVA-SGAD------------FDACVEQIDIGGPSMVRAAAKNHPSVAVVVSPNRY
PUR9_STRCO       YPFRETVA-SGAT------------PDECVEQIDIGGPSMVRAAAKNHPSVAVVTSPARY
PUR9_BIFLO       YPFADTVR-SGAN------------EADTIEKIDIGGPSMVRGAAKNHATVAIVTDPADY
PUR9_LEIXX       YPFVETVA-SGAV------------DDDVVEQIDIGGPAMVRASAKNHANVAIVVSPADY
PUR9_RHOBA       YPFAATVSRSGAT------------RAECIEQIDIGGPSLVRAAAKNHGDVAIATSPEQY
PUR9_BACTN       YPFEATVA-SGAS------------EADIIEKIDIGGISLIRAAAKNYNDVIIVASQAQY
PUR9_THEMA       YP---------------------------PPDIDIGGVALLRAAAKNWKKVKPAFDMETL
PUR9_THEYD       YPFESVAKKHLSQILQPSDLNLQAFLEEAIENIDIGGPTLLRASAKNYKDVIVIVDPDDY
PUR9_AQUAE       YPFEEKLKEGLTD-------------KDLMEFIDIGGPTLIRAAAKNFFRVVILVDPEDY
PUR9_CLOBH       YPFFNKVEENLSF-------------DEKVEFIDIGGPTMIRAAAKNFKDVVVLTDTKDY
PUR9_CLOAB       YPFFDKVKENISF-------------EEKVEFIDIGGPTMIRAAAKNFQDVVVLTDVNDY
PUR9_FUSNN       YPFFEKVKEDLSF-------------EEKIEFIDIGGPTMLRSAAKSFKNVVVISDVKDY
PUR9_DICDI       YPFVETVSKESTT------------LEEAIENIDIGGHTLIRASSKNFQNVLIIVDPSDY
PUR9_CAMJE       YPFKKTTIMSDDF-------------DEIIENIDIGGPAMIRSAAKNYKDVMVLCDPLDY
PUR9_MOUSE       YPFVKTVASPDVT------------VEAAVEQIDIGGVTLLRAAAKNHARVTVVCEPEDY
PUR9_HUMAN       YPFVKTVASPGVT------------VEEAVEQIDIGGVTLLRAAAKNHARVTVVCEPEDY
PUR92_YEAST      YPFKETVAKVGVT------------IPEAVEEIDIGGVTLLRAAAKNHARVTILSDPKDY
PUR91_YEAST      YPFKETVAKIGVT------------VQEAVEEIDIGGVTLLRAAAKNHSRVTILSDPNDY
PUR9_SCHPO       YPFRETIAKPNVT------------IPEAVEEIDIGGVTLLRAAAKNHARVTILSDPADY
                 *                               *****  : *.::*.   .         

PUR9_LEPIN       KKIQNLISSSG--------ISEEISASYMRKAFSHTAMYDAAISSWFYK-----------
PUR9_LEPBA       ESFQNEFTTNNG------KISRETAFGYAAKVFSETASYDSAISSYFNK-----------
PUR9_BUCAI       QSTIDSINNNT--------MNMEKRFNLASKAFEYTSYYEQIISQYFIE----QNSLYKK
PUR9_WIGBR       SKLSSEMDKNSG------SVSFKTRFYFSTLAFQYSYSYDKEIFNYFNKIYFKEIELKKN
PUR9_SYNY3       EAYLQALQE-------QGEIPLALRQQFAGEAFALTNAYDQAIANYFSGLSGDS------
PUR9_THEEB       ETYLQELRL-------YGDAQPAFRLACAQQAFALTAHYDQAIAEYLQKVTAAGTEP---
PUR9_PROMA       QPFLQALK--------KGTLSNEMRRELAKEAFEHTANYDNAISRWMKLNAEKK------
PUR9_MOOTA       NEVLTELRE-------KGSLSPETRRRLAAAAFAHTAAYDAAIAAYFQRLMRNE------
PUR9_BACAN       DVVLAELKE-------NGEVAEETKRKLAAKVFRHTAAYDALISNYLTEQ--MG------
PUR9_BACCR       DIVLAELKE-------NGEVAEETKRKLAAKVFRHTAAYDALISNYLTEQ--MG------
PUR9_BACC2       DVVLAELKE-------NGEVMDETKRKLAAKVFRHTAAYDALISNYLTEQ--MG------
PUR9_BACSU       SPVLNQIKE-------EGSVSLQKKRELAAKVFRHTAAYDALIADYLTNV--VG------
PUR9_BACHD       ETVLKELAD-------QGNVATETKRRLAAKVFRHTAAYDAMIAEYLTDA--VG------
PUR9_LISMO       DAVLTELQE-------HGATTFETRQRLAAKVFRHTAAYDALIAEYLTNI--TG------
PUR9_LACPL       EQILADLQT-------D-AVTPALRQRLAAKVFQHTAAYDALIAQYLTT-----------
PUR9_STRP4       AVVLDELSA-------NGETTYETRQRLAAKVFRHTAAYDALIAEYFTAQ--VG------
PUR9_STRR6       TVVLDELSA-------NGETTYETRQRLAAKVFRHTAAYDALIAEYFTAQ--VG------
PUR9_STRPD       ATVLGELAD-------AGQTTFETRQRLAAKVFRHTAAYDALIAEYFTTQ--VG------
PUR9_LACLA       EKVLTELSV-------KGETSLSFRQQLAAKVFRHTASYDALIAQYLTEEFPVE------
PUR9_ENTFA       EQVLSEISS-------TGTSQLATRKRLAAKVFRHTAAYDALIADYLTTQ--VG------
PUR9_STAA8       QEVLTRLRN-------D-SLDESYRQSLMIKVFEHTAEYDEAIVRFFKGD----------
PUR9_DEIRA       ALAL------------QDEVSPAERRRLAAKAYRHTSEYDAAITAYLSGE--SDELP---
PUR9_GEOSL       RPVLDEMKAS------GGAVSRETNFCLAVKVYQHTAAYDGAISNWLGARTGEGI-----
PUR9_GEODF       RKVLDEMKQS------GGAVSSATNFGLAVKVYQHTAAYDGAISNWLGARTGEGV-----
PUR9_VIBPA       DRVIAEMDAN------DKSLTLETRFDLAIAAFEHTAAYDGMIANYFGTMVPSYGENKEG
PUR9_ALIF1       DRVIAEMDAN------EKSLTLETRFDLAIAAFEHTASYDGMIANYFGTMVPSYGENKEG
PUR9_VIBCH       DRVIREMDAN------HNSLTLATRFDLAIAAFEHTAAYDGMIANYFGTLVPSYGDNKEG
PUR9_SHEON       NRVLAEMAVN------NGSTTHATRFDLAIAAFEHTAGYDGMIANYFGTMVPMHRVPAHS
PUR9_COLP3       ERVLTELDNN------NDSLTYKTRFDLAIAAYEHTASYDGMIANYFGKMLPAYGETESK
PUR9_ECOSE       DAIIKEMDDN------EGSLTLATRFDLAIKAFEHTAAYDSMIANYFGSMVPAYHGESKE
PUR9_SHIDS       DAIIKEMDDN------EGSLTLATRFDLAIKAFEHTAAYDSMIANYFGSMVPAYHGESKE
PUR9_ECOLI       DAIIKEMDDN------EGSLTLATRFDLAIKAFEHTAAYDSMIANYFGSMVPAYHGESKE
PUR9_SALTY       DAIIKEMDAN------EGSLTLDTRFDLAIKAFEHTAAYDSMIANYFGSMVPAYHGESKE
PUR9_YERPE       PAIITELDNN------DGSLTYPTRFNLAIKAFEHTAAYDSMIANYFGTLVPPYHGDTEQ
PUR9_HAEIN       NAILAEMDQH------QNSLTFETRFDLAIKAFEHTAQYDSMIANYFGQLVKPYHIAEEE
PUR9_PSEAE       AAVIESLKA--------GGLTYAQRFDLALKAFEHTSAYDGMIANYLGTIDQTRDTLGTA
PUR9_PSEPW       ASVLEGLKA--------GGLTYAQRFDLMLKAFEHTAAYDGMIANYMGTIDQAKDTLSTE
PUR9_BURM9       AVVLDEMKAN------GNTLGYKTNFRLATKVFAHTAQYDGAITNYLTSLGDDLQHGS--
PUR9_BURPS       AVVLDEMKAN------GNTLGYKTNFRLATKVFAHTAQYDGAITNYLTSLGDDLQHGS--
PUR9_BURVG       AVVLDEMKAN------GNAIGYATNFRLATKVFAHTAQYDGAITNYLTSLTDELQHAS--
PUR9_NEIG1       PAIAAELEAN------NGALSDKTRFNLSRKAFSHTAQYDGMISNYLTSL-SDGVLSGEP
PUR9_NEIMB       PAIAAELEAN------NGALSDKTRFNLSRKAFSHTAQYDGMISNYLTSL-SDDVLSGTP
PUR9_LARHH       PALLEEMGAN------AGALSRATRFDLSRKAFTHTAAYDGAISNYLTAVQADQGLAGEP
PUR9_XANCP       ADLLAELEAN------NGQLSAAQRFALSVAAFNRVAQYDAAISNYLSAVADSAESVPT-
PUR9_MAGMM       ARVLESLRAH------DGQCDAGLNAQLARKVYARTAAYDAAISNWLSALDNEGRP----
PUR9_BRUSI       ADVVAELEKH------SGSLPLAFRKKLAAKAFSRTAAYDAAISNWFAEAIDEET-----
PUR9_AGRFC       PALVEALQAD------DGQTSYALRQRFAAKAYARTAAYDAVISNWFAEALAIET-----
PUR9_BRADU       KAVLDELAAN------KGATTLKLRRRLAAKAYARTAAYDAAISNWFNRQLEIDA-----
PUR9_RHOS4       KALLDELRAH------DGATRLSFRQKLALTAYARTAAYDTAVSTWMAGALKAEA-----
PUR9_PARDP       AAVLAELDAN------DDRTGLAFRQRQAQIAYARTAAYDAAVSTWMAGAIGEET-----
PUR9_RHORT       QPVMDAMTAE------GGATTLELRRKLASAAFARCGAYDGAISRWFQGQVGDET-----
PUR9_CAUVC       AEVLEALKA--------GGTTLALRQQLAARAYARTAAYDAAISAWFAEALGQDF-----
PUR9_CHLTE       ATVLDEMRSN------GGATTRATRLTLAAKVYALTSRYDTAIAAYMAKAAG--VKGA--
PUR9_PELPB       ALVLQEMREH------NGATKRTTRLTLALKVFELTSRYDRAIASYLAGAVAGEQQGA--
PUR9_CHLAA       AGVLDGLRA--------GDVPLSERQRLAAKAFAHTAEYDATIAAYLRTEPL--------
PUR9_MYCSJ       DGVLAAVRTG--------GFTLAERKILASLAFRHTAEYDVAVASWMGSTLAPEEP----
PUR9_MYCTU       HGVLAALRAG--------GFTLAERKRLASLAFQHIAEYDIAVASWMQQTLAPEHP----
PUR9_CORGL       EDVQEALKTG--------GFSRAERTKLAAEAFRHTATYDVTVATWMSEQLAAEDS----
PUR9_STRCO       ADVLLAVEGG--------GFDLAARKRLAAEAFQHTAAYDVAVASWFAAEYAPVD-----
PUR9_BIFLO       ALVASRVADG------T-GFSLDERKWLAAKAFAHTAAYDATINEWTAKHWPKPASLDAV
PUR9_LEIXX       AGLAAAVAAG--------GTTWGQRRELAARAFAHTAAYDGAVAAWFAGEAPDLSA----
PUR9_RHOBA       GDVLDQLETL------G-GTTDELRTQLAAEAFDHTAGYDRAIADYMQGDAVGGE-----
PUR9_BACTN       KPLLDMLMEH------GATSSLEERRWMAKEAFAVSSHYDSAIFNYFDAGEGSAFR----
PUR9_THEMA       KLAIEIDDE-------------ETRKYLAGMTFAFTSVYDSIRANQFVEGISLAFK----
PUR9_THEYD       SSIIEDIKK--------GSVSIEKKFELAKKVFSHTARYDALIADYFEKI----------
PUR9_AQUAE       DWVIEKLKK--------GNLTLQDRAYLAWKAFSHTAYYDGVISQAFKKL----------
PUR9_CLOBH       ENVINEIKEN-------NQVNIQTRKKLAGKVFNLMSAYDAAISNFL-------------
PUR9_CLOAB       DDVIDQIEKT-------GEVAYNTKKRLAGKVFNLMSAYDGAISRFL-------------
PUR9_FUSNN       ESIKEEINKS-------DDVSYEARKKLAGKVFNLTSAYDAAISQFL-------------
PUR9_DICDI       KWIGERIQSSTDSTNVLSSITLEERKKLALKAFQHGCSYDAAVSQYLSKVELTNATTIQG
PUR9_CAMJE       EKVIETLKKG--------QNDENFRLNLMIKAYEHTANYDAYIANYMNERFNGG------
PUR9_MOUSE       AGVAAEMHGSDS-----KDTSLETRRHLALKAFTHTAQYDEAISDYFRKQYSKGI-----
PUR9_HUMAN       VVVSTEMQSSES-----KDTSLETRRQLALKAFTHTAQYDEAISDYFRKQYSKGV-----
PUR92_YEAST      SEFLSELSSNG-------EISQDLRNRLALKAFEHTADYDAAISDFFRKQYSEGQ-----
PUR91_YEAST      SIFLQDLSKDG-------EISQDLRNRFALKAFEHTADYDAAISDFFRKQYSEGK-----
PUR9_SCHPO       ATFTDKFLSD--------KLTQDDRNTYALKAFASTASYDAAITDYFRKQYAAGV-----
                                                .:     *:                    

PUR9_LEPIN       ----------QSGEVFPDVLNLSFIKKQKLRYGENPHQAASFYEPLFT------KSDFSP
PUR9_LEPBA       ----------RLGIKYPDKITFAFNKKQKLRYGENPHQDAAFYEPLFL------KSQFEA
PUR9_BUCAI       ----------TNNSLFPNEINFSFIKKQDLRYGENYHQKSSFYIEKNMC-DSGTISTACQ
PUR9_WIGBR       ----------LKNKKFPELFSISFSKKEDVLYGENYHQKAAFYTDPVI--HPGTVPFSIQ
PUR9_SYNY3       ----------------ANQFGLSGTLRQPLRYGENPHQSAGWYQTGREA--T-GWAKAEK
PUR9_THEEB       -------------EILPPVFHLTGRQKQVLRYGENPHQRASWYVCGAHP--R-GWAAAHL
PUR9_PROMA       ----------------SSQWIESIPLKQTLRYGENPHQSASWYSHQDQ-----GWGGAKQ
PUR9_MOOTA       -------------EPFPASFVLSGEKVQDLRYGENPHQGAAFYRLPAPP--PGTLAGARQ
PUR9_BACAN       -------------EESPETLTVTFEKKQDLRYGENPHQKATFYKAPFAA--TSSVAYAEQ
PUR9_BACCR       -------------EESPETLTVTFEKKQDLRYGENPHQKATFYKAPFAA--TSSVAYAEQ
PUR9_BACC2       -------------EESPETLTVTFEKKQDLRYGENPHQKATFYKAPFAA--TSSVAYAEQ
PUR9_BACSU       -------------EKEPEQFTVTFEKKQSLRYGENPHQEATFYQTALPV--KGSIAQAEQ
PUR9_BACHD       -------------EESPESLTVTFEKKQDLRYGENPHQKATFYQKPLGA--KASIAHAKQ
PUR9_LISMO       -------------ETFPEKVTFTYNRKQVLRYGENPHQDAAFYTEPGTI--ENSISAAKQ
PUR9_LACPL       -------------EEFPEKLTLTYDKKQALRYGENSHQKAAFYENALPT--HFSITGAKQ
PUR9_STRP4       -------------ESKPEKLTLTYDLKQAMRYGENPQQDADFYQKALPT--DYSIASAKQ
PUR9_STRR6       -------------ESKPEKLTLTYDLKQAMRYGENPQQDADFYQKALPT--DYSIASAKQ
PUR9_STRPD       -------------EARPEKLTITYDLKQAMRYGENPQQDADFYQKALPT--DYSIASAKQ
PUR9_LACLA       -------------NVKPEKLTLTYDLKQGMRYGENPQQNADFYESGIPT--TYSIAQSKQ
PUR9_ENTFA       -------------ETEPEKQTLTYERKQTLRYGENSHQQATFYQSVVPV--SLSIASARQ
PUR9_STAA8       --------------------------KETLRYGENPQQ-SAYFVRTSNA--KHTIAGAKQ
PUR9_DEIRA       -------------TQLPEHLSLDLTRTAQVRYGENPHQPGAIYRWGNAR--G-PVIDAQV
PUR9_GEOSL       -------------AAYPDTVTLQFRKAQEMRYGENPHQGAAFYVERQV--KEASVATARQ
PUR9_GEODF       -------------AEYPDTLTFQFKKAQGMRYGENPHQSAAFYVERDV--KEASIATALQ
PUR9_VIBPA       DEE----------SKFPRTFNQQFEKKQDMRYGENSHQAAAFYVEANP--QEASVSTARQ
PUR9_ALIF1       DEE----------SKFPRTFNQQFEKKQDMRYGENSHQAAAFYVEANP--EEASVSTARQ
PUR9_VIBCH       DEE----------SKFPRTFNAQFIKKQDMRYGENSHQAAAFYVEANP--QEASVATARQ
PUR9_SHEON       TDECFQDSLSVEGSKFPRTFNTQLVKKQDLRYGENSHQAAAFYVDTKI--DEASVATAVQ
PUR9_COLP3       ASL-------ENKVKFPRTFNSQFIKTQDLRYGENSHQDAAFYKEENP--EEASVSTATQ
PUR9_ECOSE       -----------AAGRFPRTLNLNFIKKQDMRYGENSHQQAAFYIEENV--KEASVATATQ
PUR9_SHIDS       -----------ADGRFPRTLNLNFIKKQDMRYGENSHQQAAFYIEENV--KEASVATATQ
PUR9_ECOLI       -----------AAGRFPRTLNLNFIKKLDMRYGENSHQQAAFYIEENV--KEASVATATQ
PUR9_SALTY       -----------AAGRFPRTLNLNFIKKQDMRYGENSHQQAAFYIEENV--KEASVATAQQ
PUR9_YERPE       -----------PSGHFPRTLNLNYIKKQDMRYGENSHQQAAFYIEEDV--KEASVATAQQ
PUR9_HAEIN       EAN-------AKCGQFPRTLNLNFVRKQAMRYGENSHQNAAFYVDLNV--KEASVATANQ
PUR9_PSEAE       -----------DRGAFPRTFNSQFVKAQEMRYGENPHQSAAFYVEAKK--GEASVSTAIQ
PUR9_PSEPW       -----------ARSEFPRTFNSQFVKAQEMRYGENPHQSAAFYVEAKK--GEASVSTAIQ
PUR9_BURM9       ------------RSAYPATLNLAFDKVQDLRYGENPHQSAAFYRDVAT--PAGALANYRQ
PUR9_BURPS       ------------RSAYPATLNLAFDKVQDLRYGENPHQSAAFYRDVAT--PAGALANYRQ
PUR9_BURVG       ------------RSTYPATLNLAFDKVQDLRYGENPHQSAAFYRDLAA--PAGALANYRQ
PUR9_NEIG1       -----------EIGEFPSRFNQSWIKVQDMRYGENPHQRAAFYRDIDP--AAGSLSAYNQ
PUR9_NEIMB       -----------EIAGFPGRFNQSWIKVQDMRYGENPHQRAAFYRDIDP--AAGSLAAYKQ
PUR9_LARHH       -----------VRTLFPTRLNLQVVKVQDMRYGENPHQSAAFYRDLDP--APGTLAHYRQ
PUR9_XANCP       ------------RSPFPAQINSNFIKVMDLRYGENPHQSGAFYRDLYP--VPGTLATFQQ
PUR9_MAGMM       -------------GAFPETYTVQFKKVQGMRYGENPHQSAAFYAESPPS-EEASLATATQ
PUR9_BRUSI       ----------------PTYRAVAGKLHSVMRYGENPHQTAGFYLTGEK---RPGVATATQ
PUR9_AGRFC       ----------------PHYRAIGGVLKEKMRYGENPHQSAGFYLTGEK---RPGVATATL
PUR9_BRADU       ----------------PDFRAFGGKLIQSLRYGENPHQTAAFYATPDK---RPGVSTARQ
PUR9_RHOS4       ----------------PRRRSFAGTLAQTMRYGENPHQKAAFYTDGSA---RPGVATAKQ
PUR9_PARDP       ----------------PRRRSFSGQLAQSLRYGENPHQSAAFYRDGSD---RPGVATARQ
PUR9_RHORT       ----------------PRHIVFAGRLRQTLRYGENPHQKAAFYGHGIA---RPGVASAEQ
PUR9_CAUVC       ----------------PARKSIAGTLRQTMRYGENPHQKAAFYTFPNP---RPGVATATQ
PUR9_CHLTE       ----------------GDTMTLKLEKELSMRYGENPHQSAGLYKMDDGNGVRSFSAIFEK
PUR9_PELPB       ----------------ASKMTVTLERELDMRYGENPHQSAGLYRLTDENGTRSFGDFFEK
PUR9_CHLAA       ----------------PDVLPLAWRKYQPLRYGENPHQAAALY--------GDFGAFFHQ
PUR9_MYCSJ       ------------AQKLPAWVGGTWRRAAVLRYGENPHQQAALYRDATAW---PGLAQAEQ
PUR9_MYCTU       ------------VAAFPQWFGRSWRRVAMLRYGENPHQQAALYGDPTAW---PGLAQAEQ
PUR9_CORGL       ------------ETEFPGWIGTTNTLSRSLRYGENPHQSAALYVGNTR-----GLAQAKQ
PUR9_STRCO       ------------ESGFPDFLGATYERANTLRYGENPHQPAALYTSPEG----GGLAQAEQ
PUR9_BIFLO       EVDKDDQGTEVDPAKFPAQFTRTWDRAHTLRYGENSHQQAALYIDPLNQ---TGFAHAEQ
PUR9_LEIXX       ---------------VAERFEVRAEWGQPLRYGENAHQAAALYADPAG----CGIAQASQ
PUR9_RHOBA       ---------------FPASMHVSLRRKTQLRYGENPHQRAALYSDSSDR--SANLVSARQ
PUR9_BACTN       ---------------------CSVNNQKQLRYGENPHQKGYFYGNL--------DAMFDQ
PUR9_THEMA       ---------------------RED---LQLRYGENPHEKAFVYGK---------PAFEIL
PUR9_THEYD       ----------SP-SGFKKDWTLPLKMTRTLRYGENPHQKAALYALN-ES---PSLIDADV
PUR9_AQUAE       ----------YSIDTFGKEEALPLKRMQKLRYGENPHQRGFLYENPLED---IGITKAQV
PUR9_CLOBH       -----------LEEEYPEYLTLSYKKNMDLRYGENPHQTAAYYTSTVGK---YPMKNFEK
PUR9_CLOAB       -----------LEDEYPEYLAVPYKKKMDLRYGENPHQTAAFYEAAFGD---GAMKGFEQ
PUR9_FUSNN       -----------LDEDFSEYLNISYKKFMEMRYGENSHQKAAYYTDNMTD---GAMKDFKQ
PUR9_DICDI       VKGTDSA---SVNVEFPQTFLPLYEKKNDLRYGENPHQKAALYQCP-GT---GGIANAQL
PUR9_CAMJE       ---------------FGASKFIVGQKVFDTKYGENPHQKGALYEFDAFF-----SANFKA
PUR9_MOUSE       -------------------------SQMPLRYGMNPHQTPAQLYTLK-------PKLPIT
PUR9_HUMAN       -------------------------SQMPLRYGMNPHQTPAQLYTLQ-------PKLPIT
PUR92_YEAST      -------------------------AQITLRYGANPHQKPAQAYVSQQ------DSLPFK
PUR91_YEAST      -------------------------AQLPLRYGCNPHQRPAQAYITQQ------EELPFK
PUR9_SCHPO       -------------------------DQLTLRYGANPHQSPAQAFMEQ-------GPLPFK
                                                ** * ::                      

PUR9_LEPIN       LQGKELSFNNMLDFDAAFHISSLLPE----------NTVCIIKHLNPCGIAYADN-----
PUR9_LEPBA       LQGKELSFNNMLDFDAAFHVASLLPK----------NAVSIVKHLNPCGIAFGET-----
PUR9_BUCAI       IQGKTLSYNNISDSDIALECVKQFTK----------PACVIVKHGNPCSVAVSHN-----
PUR9_WIGBR       RQGKKLSYNNIVDSDIAINCVMNFSE----------IACVIVKHSTPCGVSSGKN-----
PUR9_SYNY3       LQGKELSYNNLVDLEAARRIINEFDV--------REPAAVILKHTNPCGVALAPT-----
PUR9_THEEB       LQGKELSYNNLLDLEAARGVISEFLGD-------SPPAAVIIKHTNPCGVAEGKT-----
PUR9_PROMA       IQGKELSMNNLLDLEAALSTIREFGYDENLLATTSQKAAVVIKHTNPCGVATANS-----
PUR9_MOOTA       LQGKELSYNNLMDLDAAWNLACDFKE----------PVVAIIKHTNPCGVARAST-----
PUR9_BACAN       LHGKELSYNNINDADAALSIVKEFTE----------PAVVAVKHMNPCGVGVGTD-----
PUR9_BACCR       LHGKELSYNNINDADAALSIVKEFTE----------PAVVAVKHMNPCGVGVGTD-----
PUR9_BACC2       LHGKELSYNNINDADAALSIVKEFTE----------PAVVAVKHMNPCGVGVGTD-----
PUR9_BACSU       LHGKELSYNNIKDADAAVQIVREFTE----------PAAVAVKHMNPCGVGTGKT-----
PUR9_BACHD       LHGKELSYNNINDADAALSIVKEFKE----------PAAVAVKHMNPCGVGTGET-----
PUR9_LISMO       LHGKELSYNNIRDADAALKIASEFTE----------PVAVAVKHMNPCGVGVGEN-----
PUR9_LACPL       IHGKELSYNNIKDADAALRMVSEYQQ----------PAVVAMKHMNPCGVGLGTT-----
PUR9_STRP4       LNGKELSFNNIRDADAAIRIIRDFKDR---------PTVVALKHMNPCGIGQADN-----
PUR9_STRR6       LNGKELSFNNIRDADAAIRIIRDFKDR---------PTVVALKHMNPCGIGQADD-----
PUR9_STRPD       LNGKELSFNNIRDADAAIRIIRDFKDR---------PTVVVLKHMNPCGIGQADD-----
PUR9_LACLA       IHGKELSYNNVRDADAALQIARDFEE----------PTVVALKHMNPCGIGTATD-----
PUR9_ENTFA       LHGKELSYNNIRDADAALRIASEFTE----------PTVVAVKHMNPCGIGTGKT-----
PUR9_STAA8       LHGKQLSYNNIKDADATLALVKKFDT----------PATVAVKHMNPCGVGIGDT-----
PUR9_DEIRA       VAGKPMSFNNYADADAAWSLCQELAAQE------QGAVCVAVKHANPCGVAVAAD-----
PUR9_GEOSL       LQGKELSYNNIADTDAALECVKQFAE---G------PACVIVKHANPCGVAVGGT-----
PUR9_GEODF       LQGKELSYNNIGDTDAALECIKQFNE---G------PACVIVKHANPCGVAIGAN-----
PUR9_VIBPA       IQGKALSYNNIADTDAALECVKEFNE----------PACVIVKHANPCGVALGKD-----
PUR9_ALIF1       IQGKALSYNNIADTDAALECVKEFDE----------PACVIVKHANPCGVALGKD-----
PUR9_VIBCH       IQGKALSYNNIADTDAALECVKEFSE----------PACVIVKHANPCGVALGDD-----
PUR9_SHEON       LQGKALSYNNIADTDAALECVKEFSE----------PACVIVKHANPCGVALGKD-----
PUR9_COLP3       LQGKALSYNNIADTDAALECVKEFDE----------PACVIVKHANPCGVAIGDD-----
PUR9_ECOSE       VQGKALSYNNIADTDAALECVKEFAE----------PACVIVKHANPCGVAIGNS-----
PUR9_SHIDS       VQGKALSYNNIADTDAALECVKEFAE----------PACVIVKHANPCGVAIGNS-----
PUR9_ECOLI       VQGKALSYNNIADTDAALECVKEFAE----------PACVIVKHANPCGVAIGNS-----
PUR9_SALTY       VQGKALSYNNIADTDAALECVKEFNE----------PACVIVKHANPCGVAVSTT-----
PUR9_YERPE       LQGKALSYNNIADTDAALECVKEFSE----------PACVIVKHANPCGVAIGDS-----
PUR9_HAEIN       LQGKALSYNNIADTDAALECVKEFDD----------PACVIVKHANPCGVALGKD-----
PUR9_PSEAE       LQGKELSFNNVADTDAALECVKSFLK----------PACVIVKHANPCGVAVVPEDEG--
PUR9_PSEPW       LQGKELSFNNVADTDAALECVKSFVK----------PACVIVKHANPCGVAVVPEDEG--
PUR9_BURM9       LQGKELSYNNIADSDAAWECVKTFDA----------PACVIIKHANPCGVAVGAD-----
PUR9_BURPS       LQGKELSYNNIADSDAAWECVKTFDA----------PACVIIKHANPCGVAVGAD-----
PUR9_BURVG       LQGKELSYNNIADSDAAWECVKTFDA----------PACVIIKHANPCGVAVGND-----
PUR9_NEIG1       LQGKELSYNNIADADAAWEAVKSFDA----------PACVIVKHANPCGVAVAAD-----
PUR9_NEIMB       LQGKELSYNNIADADAAWEAVKSFDV----------PACVIVKHANPCGVAIASN-----
PUR9_LARHH       LQGKELSYNNIADSDAAWEAVKTFDD----------PACVIVKHANPCGVAVAAD-----
PUR9_XANCP       LQGKELSYNNLADADAAWECVRQFDA----------PACVIVKHANPCGVAVGVA-----
PUR9_MAGMM       LQGKELSFNNIHDANGALELVKEFSK----------PAAVVVKHANPCGVAVHDGD----
PUR9_BRUSI       LQGKQLSYNNINDTDAAFELVAEFDPART-------AAVAIIKHANPCGVAEAST-----
PUR9_AGRFC       LQGKQLSYNNINDTDAAYELVAEFLPENA-------PAVAIVKHANPCGVATGPT-----
PUR9_BRADU       LQGKELSYNNINDTDAAYECIGEFDAKRT-------AACVIVKHANPCGVAEGSD-----
PUR9_RHOS4       WQGKELSYNNINDTDAAFELVAEFDPAEG-------PACVIVKHANPCGVARGAT-----
PUR9_PARDP       WQGKELSYNNINDTDAAFELVAEFDPAEG-------PAVAIIKHANPCGVARGDS-----
PUR9_RHORT       LQGKELSYNNINDTDAAFDLVCEF---AE-------PAVAIIKHANPCGVAQGAS-----
PUR9_CAUVC       LQGKELSYNNINDTDAAFELIAEFDPAAG-------PAVAIIKHANPCGVAVGAT-----
PUR9_CHLTE       LHGKELSYNNMLDIAAATGIIEEFRG--EE------PSVVIVKHTNPCGVAQAPT-----
PUR9_PELPB       LHGKELSYNNMLDIAAAVSLIEEFRG--EE------PTVVIVKHTNPCGVAQAPT-----
PUR9_CHLAA       LHGKELSYNNILDTAAAQELIEEFPAT-EA------AAVAIIKHTNPCGVAIAAD-----
PUR9_MYCSJ       LHGKEMSYNNYTDADAAWRAAFDHE----------EICVAIIKHANPCGIAISSV-----
PUR9_MYCTU       LHGKDMSYNNFTDADAAWRAAFDHE----------QTCVAIIKHANPCGIAISSV-----
PUR9_CORGL       FHGKEMSYNNYTDSDAAWRAAWDHE----------RPCVAIIKHANPCGIAVSDE-----
PUR9_STRCO       LHGKEMSYNNYTDTDAARRAAYDHA----------EPCVAIIKHANPCGIAIGA------
PUR9_BIFLO       LGGKPMSYNNYVDADAAWRTVWDMAP---------AIAVAVVKHNNPCGLAIGA------
PUR9_LEIXX       HGGKEMSYNNYVDADAALRSAYDFA----------EPAVAIVKHANPCGIAVAG------
PUR9_RHOBA       ISGKELSYNNLLDLDAALDIARGFA----------EPAVSVIKHNNPCGAATGD------
PUR9_BACTN       IHGKEISYNNLLDINAAVDLIDEYE----------DLTFAILKHNNACGLASRP------
PUR9_THEMA       HEGKTISFNNILDAENAWFMAKNLP----------RMGAVVVKHQSPCGAAIGE------
PUR9_THEYD       LQGKEMSFNNYLDTHSAVLLATEF----------SEPVCVIVKHNNPCGVAIGEN-----
PUR9_AQUAE       LQGKEMSFNNYLDADSAVRLVAEFP---------NQTVCAIIKHNNPCGVALGSS-----
PUR9_CLOBH       LNGKELSYNNIKDMDIAWKTVCEF----------EEVACCALKHNTPCGVAIGDT-----
PUR9_CLOAB       LNGKELSYNNIKDMDIAWKVVNEF----------DETVCCALKHNSPCGVAIGEN-----
PUR9_FUSNN       LNGKELSYNNIRDMDLAWKVVSEF----------DEICCCAVKHSTPCGVALGDN-----
PUR9_DICDI       LHGPALSYNNILDGDAALKAVREF----------DRCACVVIKHTNPCGLSVGVNDS---
PUR9_CAMJE       LKG-EASFNNLTDINAALNLASSFDKA---------PAIAIVKHGNPCGFAIKEN-----
PUR9_MOUSE       VLNGAPGFINLCDALNAWQLVTELRGAVDI------PAAASFKHVSPAGAAVGVPLSEDE
PUR9_HUMAN       VLNGAPGFINLCDALNAWQLVKELKEALGI------PAAASFKHVSPAGAAVGIPLSEDE
PUR92_YEAST      VLCGSPGYINLLDALNSWPLVKELSASLNL------PAAASFKHVSPAGAAVGIPLSDVE
PUR91_YEAST      VLCGTPGYINLLDALNSWPLVKELSASLNL------PAAASFKHVSPAGAAVGLPLSDVE
PUR9_SCHPO       VLCGSPGYINLMDALNSWPLVKELRENIGI------PAAASFKHVSPAGAAVGLPLSDVE
                       .  *  *   :                        .** .... .         

PUR9_LEPIN       ---------------PLEAFQLARRTDPISAFGGVIGIKGQVNGELATSI--TENFVEGV
PUR9_LEPBA       ---------------VLESFELARKTDPISAFGGIIGIHGRVEKESAEEI--TKNFVEGV
PUR9_BUCAI       ---------------ILESYLSAYNSDPISAFGGIISFNCKLDEKTAQTII-NQQFVEVI
PUR9_WIGBR       ---------------IIDAYRSAYYSDPDSAFGGIISFNRPLTIEAAEFII-NKQFVEII
PUR9_SYNY3       ---------------LVEAYQKAFNADATSAFGGIVALNQPLDGPTAAAM-VK-TFLECI
PUR9_THEEB       ---------------LVEAYERAFAADRVSAFGGIVALNRPLDGATAEAL-TR-TFLECV
PUR9_PROMA       ---------------VSLALKKALDADRTSAFGGIVAVNSSIDLATASEL-KN-LFLECV
PUR9_MOOTA       ---------------PAAAYRLAYAADPVSAFGGIVACNRPVDGEMAGAM-TE-IFLEAV
PUR9_BACAN       ---------------IHEAYTRAYEADPVSIFGGIIAANREIDKATAEKL-HE-IFLEII
PUR9_BACCR       ---------------IHEAYTRAYEADPVSIFGGIIAANREIDKATAEKL-HE-IFLEIV
PUR9_BACC2       ---------------IHEAYTRAYEADPVSIFGGIIAANREIDKATAEKL-HE-IFLEII
PUR9_BACSU       ---------------IAEAFDRAFEADKTSIFGGIIALNREVDKATAEAL-HN-IFLEII
PUR9_BACHD       ---------------IKEAFDKAYEADPVSIFGGIIALNREVDVETAKTL-KE-IFLEII
PUR9_LISMO       ---------------IEEAYLKAYEADETSIFGGIVALNKEVDAKTAEHM-SK-IFLEIV
PUR9_LACPL       ---------------IEAAWDKAYEADSISIFGGIIALNRPVDLATAEKM-HA-LFLEII
PUR9_STRP4       ---------------IETAWDYAYESDPVSIFGGIVVLNREVDAATAEKM-HG-VFLEII
PUR9_STRR6       ---------------IETAWDYAYESDPVSIFGGIAVLNREVDAATAEKM-HG-VFLEII
PUR9_STRPD       ---------------IETAWDYAYEADPVSIFGGIVVLNREVDAATAKKM-HP-IFLEII
PUR9_LACLA       ---------------IEKAWDYAYEADPVSIFGGIIVLNREVTLATAQKM-SK-IFLEII
PUR9_ENTFA       ---------------ILAAYRQAFEADPVSIFGGIVVLNRPVDQATAAEM-HQ-IFLEII
PUR9_STAA8       ---------------IEQAFQHAYEADSQSIFGGIVALNRAVTPELAEQL-HS-IFLEVI
PUR9_DEIRA       ---------------VKTAWERARDADTLSVFGGVVAVSQPVDFGAAQSM-KG-TFLEVL
PUR9_GEOSL       ---------------LLEAYDRAYATDPESAFGGIIAFNRELDADTARAI-CDRQFVEVI
PUR9_GEODF       ---------------LLDAYDRAYKTDPESAFGGIIAFNGELDEAAAKAI-VDRQFVEVI
PUR9_VIBPA       ---------------ILEAYNRAYQTDPTSAFGGIIAFNQELDAETASAI-VERQFVEVI
PUR9_ALIF1       ---------------ILEAYDRAFKTDPTSAFGGIIAFNRELDAATATAI-TERQFVEVI
PUR9_VIBCH       ---------------LLQAYNRAYQTDPTSAFGGIIAFNRELDGETARAI-IERQFVEVI
PUR9_SHEON       ---------------LLDAYNRAYQTDPTSAFGGIIAFNGELDAATASAI-VERQFVEVI
PUR9_COLP3       ---------------ILAAYEGAYKTDPTSAFGGIIAFNRELDADTAEAI-VSRQFVEVI
PUR9_ECOSE       ---------------ILDAYDRAYKTDPTSAFGGIIAFNRELDAETAQAI-ISRQFVEVI
PUR9_SHIDS       ---------------ILDAYDRAYKTDPTSAFGGIIAFNRELDAETAQAI-ISRQFVEVI
PUR9_ECOLI       ---------------ILDAYDRAYKTDPTSAFGGIIAFNRELDAETAQAI-ISRQFVEVI
PUR9_SALTY       ---------------ILDAYDRAYKTDPTSAFGGIIAFNRELDAETAQAI-ISRQFVEVI
PUR9_YERPE       ---------------ILAAYERAYQTDPTSAFGGIIAFNRELDAATASAI-ISRQFVEVI
PUR9_HAEIN       ---------------ILDAYNRAYQTDPTSAFGGIIAFNRELDEKTANEI-VERQFVEVI
PUR9_PSEAE       --------------GIRKAYDLAYATDSESAFGGIIAFNRELDGETAKAI-VERQFVEVI
PUR9_PSEPW       --------------GIRKAYDLAYATDTESAFGGIIAFNRELDGETAKAI-VERQFVEVI
PUR9_BURM9       ---------------AGEAYAKAFQTDPTSAFGGIIAFNREVDEAAAQAV-AK-QFVEVL
PUR9_BURPS       ---------------AGEAYAKAFQTDPTSAFGGIIAFNREVDEAAAQAV-AK-QFVEVL
PUR9_BURVG       ---------------PADAYAKAFQTDPTSAFGGIIAFNREVDEAAAQAV-AK-QFVEVL
PUR9_NEIG1       ---------------TLTAYKLAYATDTTSAFGGIIAFNREVDGETVKQI-TDNQFMEVL
PUR9_NEIMB       ---------------TLDAYKLAYATDTTSAFGGIIAFNREVDGATVKQI-TDNQFMEVL
PUR9_LARHH       ---------------PLSAYRLAFATDTTSAFGGIIAFNREVDAATVEAV-SA-QFLEVL
PUR9_XANCP       ---------------CGDAYELAYATDPTSAFGGILAFNRTLDAATAKAI-LDRQFVEVL
PUR9_MAGMM       ---------------LLAAYRMARDTDPVSAFGGIIALNRCVDVAVAKEI-AQ-LFVEVI
PUR9_BRUSI       ---------------IKEAYLKALACDPVSAFGGIVALNRTLDEEAAEEI-VK-TFTEVI
PUR9_AGRFC       ---------------LAEAYRRALACDSVSAFGGVIALNRTLDAETAEEI-VK-LFTEVI
PUR9_BRADU       ---------------LVSAYRKALACDSTSAFGGIIAMNRALDADTAREI-TK-IFTEVI
PUR9_RHOS4       ---------------LAEAYARAFDCDRVSAFGGIIALNQPLDAATAEKI-TE-IFTEVV
PUR9_PARDP       ---------------AVDAYLRAFDCDRTSAFGGIIALNTTLDGETAQAI-TE-IFTEVV
PUR9_RHORT       ---------------VVEAYKAALACDPVSAFGGIVALNRPIDRDSAVEI-TK-IFTEVV
PUR9_CAUVC       ---------------QREAYERALACDPTSAFGGIVAVNSRLTREAAEAM-VE-IFTEVV
PUR9_CHLTE       ---------------LCEAYRKAFSTDTQAPFGGIIAFNRPLDMETASAV-NE-IFTEIL
PUR9_PELPB       ---------------LAEAYRRAFSTDTQAPFGGIISFNRPLDMEAAKAV-NE-IFTEIL
PUR9_CHLAA       ---------------LHRAWEAAFATDREAPFGGIIAVNRPVDIAFAEAV-DE-IFSEII
PUR9_MYCSJ       --------------SVADAHRKAHECDPLSAFGGVIATNSSVSVEMAETV--ADIFTEVI
PUR9_MYCTU       --------------SVADAHRKAHECDPLSAYGGVIAANTEVSVEMAEYV--STIFTEVI
PUR9_CORGL       --------------SIAAAHREAHACDSVSAFGGVIASNREVSVEMANQV--AEIFTEVI
PUR9_STRCO       --------------DVAEAHRKAHDCDPVSAYGGVIAVNRPVSKEMAERV--AGIFTEVI
PUR9_BIFLO       --------------TAAEAHKKAHACDPMSAYGGVIACNSKVTLEMAESV--RPIFTEVI
PUR9_LEIXX       --------------DIAEAHRKAHECDPVSAYGGVIAANRTVTLAMAETV--RGIFTEVL
PUR9_RHOBA       --------------TLSEAVDKAMAGDPLSAFGSVIGMNRTLDEATAEFLCQPGLFIEAI
PUR9_BACTN       --------------TVLEAWTDALAGDPVSAFGGVLITNGVIDKAAAEEI--NKIFFEVI
PUR9_THEMA       --------------DKVEIVKKAIEADDESSFGGILAVNFEMDEEVAKSL--KK-YLEVI
PUR9_THEYD       ---------------IHTAYKKAFECDPVSAFGGIIAFNRVVDKETASEI--INTFYEVI
PUR9_AQUAE       ---------------VKEAFLRAKEADPVSAFGGIVAFNDKVDGETAKEL--TSMFLEVV
PUR9_CLOBH       ---------------VQEAYTKAYECDPISIFGGIVAFNRKVDKETAENL--AKIFLEIV
PUR9_CLOAB       ---------------PLDAYKKAFECDDTSIFGGIVALNKVIDKPAAEEM--VKIFLEIV
PUR9_FUSNN       ---------------VEGAYKKAYETDPVSIFGGIVAFNREVDEATAKLL--NEIFLEII
PUR9_DICDI       --------------EQAEVYKRAFNGDPKSAYGGILGFNRTLTLETATAL--KSVFYEVI
PUR9_CAMJE       ---------------LVQSYIHALKCDSVSAYGGVVAINGTLDEALANKI--NEIYVEVI
PUR9_MOUSE       ARVCMVYDLYPTLTPLAVAYARARGADRMSSFGDFVALSDICDVPTAKII--SREVSDGI
PUR9_HUMAN       AKVCMVYDLYKTLTPISAAYARARGADRMSSFGDFVALSDVCDVPTAKII--SREVSDGI
PUR92_YEAST      KQVYFVADI-ENLSPLACAYARARGADRMSSFGDWIALSNIVDVPTAKII--SREVSDGV
PUR91_YEAST      RQVYFVNDM-EDLSPLACAYARARGADRMSSFGDFIALSNIVDVATAKII--SKEVSDGV
PUR9_SCHPO       KKVYFVSDI-TEFTPLACAYARARGADRMSSFGDFIALSDTVDVCTARII--SREVSDGV
                                       *   *  : :*.            .  :       : :

PUR9_LEPIN       IAQKFTQEALEVFS-KKP---NIRLIEIQDFKE--ALDELDLRPIHHGLLIQDRDYTTIT
PUR9_LEPBA       IAESFSNEALEIFA-KKP---NIRLIPIAKFDE--ALDELDLRSLHHGLLIQNRDYDLIT
PUR9_BUCAI       IIPEISKKAVKILQ-KKQ---NIRVLVTGKLQN--NTVGLDLKKITNGLLVQEYDSHNID
PUR9_WIGBR       IAPVIEKDALLTLK-SKS---KIIVLECGYLSK--NFL-LNFKKVNCGLLLQDSDNKILK
PUR9_SYNY3       VAPGCDAEAQEILA-KKN---NLRVLILPDL-ATGPSQ--TIKAIAGGFLVQSADDERED
PUR9_THEEB       VAPACEEAALPILK-TKP---KMRVLTLPEL-HRAPTT--AIQTIAGGFLVQEIHPLPID
PUR9_PROMA       IAPNFENDAKLLLS-EKK---NLRLLEMNKY-YIDQSERNNIRSILGGLLIQESDDELID
PUR9_MOOTA       IAPSFTPEAMAILK-SKS---NLRLLAAGER-AGCRTREYQIRPVSGGFLVQEPDYHVLE
PUR9_BACAN       IAPSFSKEALEVLQ-SKK---NLRLLTVNIE--KATSASKKLTSVQGGLLVQEEDTLSLD
PUR9_BACCR       IAPSFSQEALEVLQ-SKK---NLRLLTINIE--KATSASKKLTSVQGGLLVQEEDTLSLD
PUR9_BACC2       IAPSFSKEALEVLQ-SKK---NLRLLTVNIE--KATSASKKLTSVQGGLLVQEEDTLSLD
PUR9_BACSU       IAPSFSQEALDVLT-AKK---NLRLLTLDVS--AAVQKEKQLTSVQGGLLIQDLDMHGFD
PUR9_BACHD       IAPSFSEEALDVLT-SKK---NLRLLTLPLN--EENQAEKRITSIHGGALVQEEDTYGFE
PUR9_LISMO       IAPSFSEEAFAILA-KKK---NIRLLTVPF---AGNMEGFEKTSVNGGLLIQANDSLVED
PUR9_LACPL       IAPSFDDDAFAILA-KKK---NLRLMTVDFE-QTHTADKFETISVGGGLLRQEVDAAFET
PUR9_STRP4       IAPSYTDEALAILINKKK---NLRILALPFNAQEASEVEAEYTGVVGGLLVQNQDVVKES
PUR9_STRR6       IAPSYTDEALAILINKKK---NLRILALPFNAQEASEVEAEYTGVVGGLLVQNQDVVKES
PUR9_STRPD       IAPSYSEEALAIFTNKKK---NLRILELPFDAQAASEVEAEYTGVVGGLLVQNQDVVAEN
PUR9_LACLA       IAPSYSKEALEVLS-KKK---NIRLLTVDFSKKEASEKEALVTGVLGGLLVQNQDVIVEN
PUR9_ENTFA       IAPSFEEEALALLS-QKK---NLRLLTLDFHAQEK--KAVELVSVMGGLLIQEQDTVVEN
PUR9_STAA8       IAPKFTDEALDILK-QKK---NVRLLEIDMT---IDSNEEEFVSVSGGYLVQDKDNYVVP
PUR9_DEIRA       IAPDVTPDAVEWFAAKKP---DLRVLIAGQP---QGVSVLDVRPLTGGFAVQERDARPWD
PUR9_GEOSL       IAPAVSPEATEVVA-AKK---NVRLLECGTWPEK-QQPRLDLKRVNGGILVQDTDLDLYA
PUR9_GEODF       IAPKVSAKASEIVA-AKK---NVRLLQCGQWQAE-SLARLDMKRVNGGLLVQQTDLSLHG
PUR9_VIBPA       IAPSVSAEAIEVVA-AKK---NVRLLECGEWTT--KTTGFDVKRVNGGLLVQDRDQGMVS
PUR9_ALIF1       IAPSVSTEAVEIVA-AKK---NLRLLECGEWTT--KTTGFDVKRVNGGLLVQDRDQGMVS
PUR9_VIBCH       IAPKVSQAAIDIVA-AKQ---NVRLLECGEWQG--QTTGFDLKRVNGGLLVQDRDQGMVA
PUR9_SHEON       IAPVVSQGARDVVA-KKT---NVRLLECGQWNT--KTQTLDYKRVNGGLLVQDRDQGMVG
PUR9_COLP3       IAPSVSDAAAQIVA-AKP---NLRLLECGQWDN--KTTGFDFKRVNGGLLVQDTDQGRVT
PUR9_ECOSE       IAPSASEEALKITA-AKQ---NVRVLTCGQWGE--RVPGLDFKRVNGGLLVQDRDLGMVG
PUR9_SHIDS       IAPSASEEALKITA-AKQ---NVRVLTCGQWGE--RVPGLDFKRVNGGLLVQDRDLGMVG
PUR9_ECOLI       IAPSASEEALKITA-AKQ---NVRVLTCGQWGE--RVPGLDFKRVNGGLLVQDRDLGMVG
PUR9_SALTY       IAPSATEEALKITA-AKQ---NVRVLTCGQWAQ--RVPGLDFKRVNGGLLVQDRDLGMVS
PUR9_YERPE       IAPTVSSDALALLA-AKQ---NVRVLTCGQWQA--RSAGLDFKRVNGGLLVQERDLGMVT
PUR9_HAEIN       IAPKVSAEAQEVMK-RKK---NVRLLECGEWTS--RSERLDFKRVNGGLLVQDADLGMVG
PUR9_PSEAE       IAPKISAAAREVVA-AKA---NVRLLECGEWPAE-RAPGWDFKRVNGGLLVQSRDIGMIK
PUR9_PSEPW       IAPKISQAARDVVA-AKQ---NVRLLECGEWPAE-RAAGWDFKRVNGGLLVQSRDNGMIT
PUR9_BURM9       IAPSFSDAAKQVFA-AKQ---NVRLLEIALGEG---HNAFDLKRVGGGLLVQSLDSKNVQ
PUR9_BURPS       IAPSFSDAAKQVFV-AKQ---NVRLLEIALGEG---HNAFDLKRVGGGLLVQSLDSKNVQ
PUR9_BURVG       IAPSFSAAAQQVFA-AKQ---NVRLLEIALGDG---HNAFDLKRVGGGLLVQSLDSRNVQ
PUR9_NEIG1       MAPKFTAEALEIAA-AKK---NVRVLEVPLKAG---ANRFELKRVGGGLLVQTPDINRIN
PUR9_NEIMB       MAPKFTAEALEIAA-AKK---NVRVLEVPLEAG---ANRFELKRVGGGLLVQTPDIHRIS
PUR9_LARHH       IAPAFTDDAKALIA-AKK---NVRVLEVPVEAG---ANRFELKRVGGGLLVQTPDIKNVT
PUR9_XANCP       IAPDYEPGALDYAT-KKA---NVRVLKIPHGAG---LNNYDTKRIGSGLLMQSADNRGMS
PUR9_MAGMM       IAPEYDEQALELFA-TKK---NLRLLRVPNIGVATAVSTMDLKRVTGGLLLQDRDLKQLP
PUR9_BRUSI       IAPDATEGAQAIVA-AKK---NLRLLVTGGLPDP-RAKGIAAKTVAGGLLVQSRDNGVVD
PUR9_AGRFC       IAPDVTEEAKSIIA-RKP---NLRLLAAGGLPDP-RAAGLTAKTVSGGLLVQSRDNGMVE
PUR9_BRADU       IAPDASEEAIAIIG-ARK---NLRLLLAGSLPDP-RAPGLTAKTVAGGLLVQSRDNAVVD
PUR9_RHOS4       IAPGADEEARAIFA-AKK---NLRLLTTEALPDP-LAPGLAFKQVAGGFLVQDRDAGHVD
PUR9_PARDP       IAPDATDEAKEIFA-AKK---NLRLLTTGGLPDP-AAPGLAFRQVAGGFLVQGRDNGRIL
PUR9_RHORT       IAPDADAEARAIFA-AKK---NLRLLLTGVVADT-TAPGLTVRSVAGGMLVQDRDAADLL
PUR9_CAUVC       IAPEADEDAIAVFA-AKK---NLRLLVTGGLPDA-LSTGDTFKSVAGGFLVQSRDDARIK
PUR9_CHLTE       IAPAFEDGVLEMLM-KKK---DRRLVLQKQPLP--KAG-WEFKSTPFGMLVQERDSKTVA
PUR9_PELPB       IAPAFEDGVLEMLM-KKK---DRRLVLQTNALP--KGG-WEFKSTPFGMLVQERDSKIVA
PUR9_CHLAA       IAPDFAPDALALLR-RKK---NRRLLQSVRPIT--GADRWQLRSVPGGVLVQEPDHAPLV
PUR9_MYCSJ       VAPAYEPGAVEILSRKK----NIRILLAAQP--PTTG--TELRPISGGLLLQQRDALDAD
PUR9_MYCTU       VAPGYAPGALDVLARKK----NIRVLVAAEP--LAGG--SELRPISGGLLIQQSDQLDAH
PUR9_CORGL       IAPSYEEGAVEILSQKK----NIRILQAEAP--VRKG--FESREISGGLLVQERDLIHAE
PUR9_STRCO       VAPDYEDGALEALTKKK----NIRVLRAPAA--PAAP--VEVKPIDGGALLQVTDRLQAE
PUR9_BIFLO       VAPDYEPAALELLQTKKK---NLRILEVAEP--PKGH--EAIRQIDGGLLVQDTDLINAV
PUR9_LEIXX       IAPGYEPGALELLKTKK----NLRILELPVG--YARSL-TEFRQISGGVLVQDTDRFDEF
PUR9_RHOBA       VAPDFEAGAVGLLTTKPRWKDNVRLMQVGRL--DEPARKVSRRFISGGMLVQDADRMVSS
PUR9_BACTN       IAPDYDVDALEILGQKK-----NRIILVRKE--AKLPKKQFRALLNGVLVQDKDMNIETV
PUR9_THEMA       VAPSFTQEAIEVLSKKK-----VRLLKPGDY--ASWAGK----MAFGSLVLSE--RKYPE
PUR9_THEYD       VAPDFDKDALEVFE-TKK---NLRLLRFPSLSDKIQPSGFDLKRILGGFIVQE-----WD
PUR9_AQUAE       IAPDYDEEALRELS-RKK---NLRVIRFFGFQH-----AFDVKKVSGGYLLQD-----ED
PUR9_CLOBH       VAPDFDEDALEVLK-NKK---NLRVIKCEEKSTE----GKDMAKVDGGILVQK-----SD
PUR9_CLOAB       IAPDFTADALEVLK-SKK---NLRVIKANEKPSD----NFELAKVDGAMLVQS-----AD
PUR9_FUSNN       IAPSFSKAALEILT-KKK---NIRLIECKNKPSD----KKELIKVDGGILIQD-----TN
PUR9_DICDI       IAPDYTEDALALLS-KKE---KLRILRIPEAANQIQFTQPDIRTITGGALLQSPNPIIRG
PUR9_CAMJE       IAANVDEKALAVFEGKKR----IKIFTQESPFLIRSFDKYDFKHIDGGFVYQNSDEVGED
PUR9_MOUSE       VAPGYEEEALKILSKKKN-----GNYCVLQMDQSYKPDENEVRTLFGLRLSQKRNNGVVD
PUR9_HUMAN       IAPGYEEEALTILSKKKN-----GNYCVLQMDQSYKPDENEVRTLFGLHLSQKRNNGVVD
PUR92_YEAST      IAPGYEPEALAILSKKKG-----GKYCILQIDPNYVPEAVERRQVYGVTLEQKRNDAIIN
PUR91_YEAST      IAPGYEPEALNILSKKKN-----GKYCILQIDPNYVPGQMESREVFGVTLQQKRNDAIIN
PUR9_SCHPO       IAPGYEPEALELLKKKKG-----GKYCVLQMDPKYVPAEIETRQVYGISLQQHRNHAKID
                 :       .                                          .        

PUR9_LEPIN       E-----KDLKVVTKKQPSPDDIRGLMFAWSCVRFIKSNAIVYTEENATLGIGAGQMSRVD
PUR9_LEPBA       K-----DKLKIVSKKQPTEDDLEGLMFAWNCVKFIKSNAIVYTDQNSTLGIGAGQMSRVD
PUR9_BUCAI       Y-----NSWSFVTKRSPTKKELKDSIFCWQVAKFVKSNAIVYGSDEITIGIGAGQMSRIY
PUR9_WIGBR       E-----KDIKIVSKRQPSKLEIESSIFIWKIIKFIKSNAIIYGKNKRTLGIGSGQTSRIF
PUR9_SYNY3       P-----STWQVVTEKQPSGEELAELAFAWKVCKHVKSNAITITKNKTTLGVGAGQMNRVG
PUR9_THEEB       P-----EAWQVVTATEPSPELMAELIFAWKVVKHVKSNAIVVSRDRQTQGIGAGQMNRVG
PUR9_PROMA       E-----KSWEVVTKKQPSSIEKKDLTFAWKVVKHIRSNAIAIASSGQTIGIGAGQMNRIG
PUR9_MOOTA       P-----ESLKVVTARKPEAKEMADLLFAWQVVKHVKSNAIVVARDGVTLGIGAGQMNRVG
PUR9_BACAN       E-----STISIPTKREPSEQEWKDLKLAWKVVKHVKSNAIVLAKDDMTIGVGAGQMNRVG
PUR9_BACCR       E-----STISIPTKREPSEQEWKDLKLAWKVVKHVKSNAIVLAKDDMTIGVGAGQMNRVG
PUR9_BACC2       E-----STISIPTKREPSEQEWKDLKLAWKVVKHVKSNAIVLAKDDMTIGVGAGQMNRVG
PUR9_BACSU       D-----AEISIPTKREPNEQEWEDLKLAWKVVKHVKSNAIVLAKDNMTVGVGAGQMNRVG
PUR9_BACHD       E-----AEIKIPTKREPTEAEWEALKLAWRVVKHVKSNAIVLADGQMTVGVGAGQMNRVG
PUR9_LISMO       T-----TSYEVVTEKQPTDSEMKALLAQWKIVKHVKSNAIVVGSDKQTLGIGAGQMNRIG
PUR9_LACPL       P-----ADFTVVTVTQPTPAQLKALAFGQQVVKHVKSNAVVVTTADRTLGIGSGQMNRID
PUR9_STRP4       P-----ADWQVVTKRQPTETEATALEFAWKAIKYVKSNGIIVTNDHMTLGVGPGQTNRVA
PUR9_STRR6       P-----ADWQVVTKRQPTETEATALEFAWKAIKYVKSNGIIVTNDHMTLGVGPGQTNRVA
PUR9_STRPD       P-----SDWQVVTDRQPTEQEATALEFAWKAIKYVKSNGIIITNDHMTLGLGAGQTNRVG
PUR9_LACLA       P-----KEWTVATKVQPTDRQMEAMKFAWKAVKFVKSNGIIVTNDHQTLGVGPGQTNRVG
PUR9_ENTFA       D-----QAWQVVTERQPTPAERDALNFAWKAVKHVKSNAIVLANESQTVGIGAGQMNRIG
PUR9_STAA8       K-----EEMKVVTEVAPTDEQWEAMLLGWKVVPSVKSNAIILSNNKQTVGIGAGQMNRVG
PUR9_DEIRA       D-----LCPEVVTERQPSEQEWADLRFAWAVVKGARSNAVALCKGGVTVGLGAGAVSRIW
PUR9_GEOSL       -------ELKVVTKRQPTEQEMKDLLFAWRVAKFVKSNAIVYGKGNMTIGVGAGQMSRVN
PUR9_GEODF       -------ELKVVTKRQPTEKEMIDLLFTWRVAKFVKSNAIVYGKDGMTIGVGAGQMSRVN
PUR9_VIBPA       L-----DDLKVVSKRQPTEEELKDALFCWKVAKYVKSNAIVYAKGDMTIGVGAGQMSRVY
PUR9_ALIF1       E-----DDLQVVSKRQPTAEELKDALFCWKVAKYVKSNAIVYSKGDMTIGVGAGQMSRVY
PUR9_VIBCH       Q-----DDLQVVSTRQPSDAELKDALFCWKVAKYVKSNAIVYAKGDMTIGIGAGQMSRVY
PUR9_SHEON       L-----DDIKVVTKRQPTESELKDLMFCWKVAKFVKSNAIVYAKDGMTIGVGAGQMSRVY
PUR9_COLP3       S-----DDLTVVTKRQPTDEEMRDLQFCWKVAKFVKSNAIVYVKNSSTIGVGAGQMSRVY
PUR9_ECOSE       A-----EELRVVTQRQPTEQELRDALFCWKVAKFVKSNAIVYAKNNMTIGIGAGQMSRVY
PUR9_SHIDS       A-----EELRVVTQRQPTEQELRDALFCWKVAKFVKSNAIVYAKNNMTIGIGAGQMSRVY
PUR9_ECOLI       A-----EELRVVTKRQPSEQELRDALFCWKVAKFVKSNAIVYAKNNMTIGIGAGQMSRVY
PUR9_SALTY       E-----AELRVVSKRQPTEQELRDALFCWKVAKFVKSNAIVYAKENMTIGIGAGQMSRVY
PUR9_YERPE       A-----ADLRVVSKRQPTEQELRDALFCWKVAKFVKSNAIVYARDNMTIGIGAGQMSRVY
PUR9_HAEIN       V-----DDLKVVSKRQPTEQELKDLLFCWKVAKFVKSNAIVYAKDNQTIGIGAGQMSRVY
PUR9_PSEAE       A-----EDLKIVTRRAPTEQEIHDLIFAWKVAKFVKSNAIVYARNRQTVGVGAGQMSRVN
PUR9_PSEPW       A-----EDLKIVTKRAPTEQEIHDLVFAWKVAKFVKSNAIVYAKQRQTIGVGAGQMSRVN
PUR9_BURM9       P-----RELRVVTKRHPTPKEMDDLLFAWRVAKYVKSNAIVFCGNGMTLGVGAGQMSRVD
PUR9_BURPS       P-----RELRVVTKRHPTPKEMDDLLFAWRVAKYVKSNAIVFCGNGMTLGVGAGQMSRVD
PUR9_BURVG       P-----SELRVVTKRQPSAKEMDDLLFAWRVAKYVKSNAIVFCGNGMTLGVGAGQMSRVD
PUR9_NEIG1       R-----ADLKVVSKRQPTEQEWNDLLFVWNVAKYVKSNAIVFGKGGQTYGIGAGQMSRVD
PUR9_NEIMB       R-----ADLKVVSKRQPTEQEWNDLLFVWNVAKYVKSNAIVFGKGGQTYGIGAGQMSRVD
PUR9_LARHH       L-----DELKVVTKAQPTRQQLADLLFAWRVAKFVKSNAIVFAAGGQTAGIGAGQMSRVD
PUR9_XANCP       L-----GELSVVTKRAPSDAELADLLFAWRVAKYVKSNAIVYAKDSRTIGVGAGQMSRVV
PUR9_MAGMM       E-----GSLKVVTERAPSEAEMRDLLFAWKVVKHVKSNAIVYAKEQRTLGVGAGQMSRVD
PUR9_BRUSI       D-----LDLKVVTKRAPTEAELNDLKFAFRVGKHVKSNAIVYVKDGATVGIGAGQMSRVD
PUR9_AGRFC       D-----LELKVVTKRAPTAQELEDMKFAFKIAKHVKSNAVIYAKDGQTAGIGAGQMSRVD
PUR9_BRADU       D-----MTFKVVTKRAPTDAEMRDLKFAFRVAKHVKSNTIIYAKDLATVGIGAGQMSRVD
PUR9_RHOS4       A-----LDLKVVTKRAPSDAELADLLFAWTVAKHVKSNAIVYVKDGATVGVGAGQMSRVD
PUR9_PARDP       R-----ADLKVVTKRQPTDQELADLLFAWTVAKHVKSNAIVYARDLATVGIGAGQMSRVD
PUR9_RHORT       S-----ADLKVVSKRTPTERELADMLIAFKVCKHVKSNAIVYVKDGATVGIGAGQMSRVD
PUR9_CAUVC       A-----SDLKIVTQRQPTEEEVRDMLFAFTVGKHVKSNAIVYARAGQTLGVGAGQMNRKD
PUR9_CHLTE       P-----EELKVVTKRQPTAEELADLMFAWKIVRHIKSNTILYVKNRQTFGVGAGQMSRVD
PUR9_PELPB       K-----EDLTVVTKRQPTEEEIADLMFAWKICKHIKSNTILYVKNRQTYGVGAGQMSRVD
PUR9_CHLAA       A-----EEWRVVTKRAPTDAEAAALRFAWRVVKHVKSNAIVYAAHDRTLGIGAGQMSRVD
PUR9_MYCSJ       GD--DPVNWTLATGEPADPATLANLKFAWRSCRAVKSNAIVVVADGATVGVGMGQVNRVD
PUR9_MYCTU       GD--NPANWTLATGSPADPATLTDLVFAWRACRAVKSNAIVIAADGATVGVGMGQVNRVD
PUR9_CORGL       GD--NSANWTLAAGSAVSPEVLKDLEFAWTAVRSVKSNAILLAKNGATVGVGMGQVNRVD
PUR9_STRCO       GD--DPATWTLATGEALSEAELAELAFAWRACRAVKSNAILLAKDGASVGVGMGQVNRVD
PUR9_BIFLO       GD--DPDAWKLVAGEAADADTLKDLVFAWRAIRCVKSNAILLAHDQATVGIGMGQVNRVD
PUR9_LEIXX       ----DSSGWTLVAGAEADAVTRADLEFTWKACRAVKSNAILLAKDGASVGVGMGQVNRVD
PUR9_RHOBA       -----PLQWNTVTETPVDDDLWDDISFGWEMVRHVKSNAIVLAKDTSLIGVGAGQMSRVD
PUR9_BACTN       ------ADLRTVTDKAPTPEEVEDLLFANKIVKNSKSNAIVLAKGKQLLASGVGQTSRVD
PUR9_THEMA       ------GNFELVVGEPLSEKELEDLEFAYRVVEGAKSNAVLIAKDGVTVGIGSGQPSRK-
PUR9_THEYD       KVDNEFSQAKVVTKRQPTDEEWKALKFAWKVCKHIKSNAVVYAKEDRTVGLGIGQTSRVF
PUR9_AQUAE       TV--LYEKLQVVTKREPTAEEMEDLLFAWKVVKHTKSNAVVIAKNGQTLGIGSGNVSRVD
PUR9_CLOBH       NK--LLEDTKVVTEKSPTEQEMKDLIFGMKVVKYVKSNAIVVVKDGMAKGIGGGQVNRIW
PUR9_CLOAB       NK--LTEKMEVVTDKKPTDEEMRDMIFGMKVVKYVKSNAIVVVKNGAAVGIGGGQVNRIW
PUR9_FUSNN       NK--LYEDLEVVTKAKPTSQEEKDLIFALKVVKFVKSNAIVVAKNLQTLGIGGGEVSRIW
PUR9_DICDI       DLAEATKNWKVVTENKPTEQQMKDLLFAWRVSKHVKSNAIVLSKDETIVAIGAGQPNRSQ
PUR9_CAMJE       E----LKNAKLMSQREASKEELKDLEIAMKIAAFTKSNNVVYVKNGAMVAIGMGMTSRID
PUR9_MOUSE       KS---LFSNIVTKNKDLPESALRDLIVATVAVKYTQSNSVCYAKDGQVIGIGAGQQSRIH
PUR9_HUMAN       KS---LFSNVVTKNKDLPESALRDLIVATIAVKYTQSNSVCYAKNGQVIGIGAGQQSRIH
PUR92_YEAST      QS---TFKEIVSQNKNLTEQAIIDLTVATIAIKYTQSNSVCYARNGMVVGLGAGQQSRIH
PUR91_YEAST      QS---TFKEIVSKNKALTEQAVIDLTVATLVLKYTQSNSVCYAKNGMVVGLGAGQQSRIH
PUR9_SCHPO       FS---LFEKVVSKNKDLPKSALIDLVIATTALKYTQSNSVCYAKNGMVVGLGAGQQSRIH
                                                    :** :         . * *  .*  

PUR9_LEPIN       SVQLGANKALNVG-----------------------------------------------
PUR9_LEPBA       SVELGAMKAQKVG-----------------------------------------------
PUR9_BUCAI       STKLANIKVKDQG-----------------------------------------------
PUR9_WIGBR       STRIAAYKAIDQG-----------------------------------------------
PUR9_SYNY3       SVEIALKQAGTEA-----------------------------------------------
PUR9_THEEB       AVEIALSAAGEAA-----------------------------------------------
PUR9_PROMA       AAKIALETAGDKA-----------------------------------------------
PUR9_MOOTA       AARIALEQAGARA-----------------------------------------------
PUR9_BACAN       SAKIAITQAGEKA-----------------------------------------------
PUR9_BACCR       SAKIAITQAGEKA-----------------------------------------------
PUR9_BACC2       SAKIAITQAGEKA-----------------------------------------------
PUR9_BACSU       SAKIAIEQAGEKA-----------------------------------------------
PUR9_BACHD       AAKIAIEQAGEKA-----------------------------------------------
PUR9_LISMO       SALIALEQAGEKA-----------------------------------------------
PUR9_LACPL       STKIAIGKAMKQAG----------------------------------------------
PUR9_STRP4       SVRLAIDQAKDR------------------------------------------------
PUR9_STRR6       SVRLAIDQAKDR------------------------------------------------
PUR9_STRPD       SVKIAIEQAKDH------------------------------------------------
PUR9_LACLA       SVKIALEATADKSV----------------------------------------------
PUR9_ENTFA       SVKIAVDQAQAAGK----------------------------------------------
PUR9_STAA8       AAKIALERAIEIN-----------------------------------------------
PUR9_DEIRA       AAERAIANAGEAA-----------------------------------------------
PUR9_GEOSL       SARIAAIKAEH-------------------------------------------------
PUR9_GEODF       SARIAAIKAEH-------------------------------------------------
PUR9_VIBPA       SAKIAGIKAAD-------------------------------------------------
PUR9_ALIF1       SAKIAGIKAAD-------------------------------------------------
PUR9_VIBCH       SAKIAGIKAAD-------------------------------------------------
PUR9_SHEON       SAKIAGIKAAD-------------------------------------------------
PUR9_COLP3       SAKVAGIKAAD-------------------------------------------------
PUR9_ECOSE       SAKIAGIKAAD-------------------------------------------------
PUR9_SHIDS       SAKIAGIKAAD-------------------------------------------------
PUR9_ECOLI       SAKIAGIKAAD-------------------------------------------------
PUR9_SALTY       SAKIAGIKAAD-------------------------------------------------
PUR9_YERPE       SAKIAGIKAAD-------------------------------------------------
PUR9_HAEIN       SAKIAGIKAQD-------------------------------------------------
PUR9_PSEAE       SARIAAIKAEH-------------------------------------------------
PUR9_PSEPW       SARIAAIKAEH-------------------------------------------------
PUR9_BURM9       SARIASIKAQN-------------------------------------------------
PUR9_BURPS       SARIASIKAQN-------------------------------------------------
PUR9_BURVG       SARIASIKAQN-------------------------------------------------
PUR9_NEIG1       STRIAARKAQD-------------------------------------------------
PUR9_NEIMB       STRIAARKAQD-------------------------------------------------
PUR9_LARHH       STRIAARKAQD-------------------------------------------------
PUR9_XANCP       SAKIAALKAEE-------------------------------------------------
PUR9_MAGMM       ASRIAVWKAQDTAHT---------------------------------------------
PUR9_BRUSI       SARIAARKAEDAAEA---------------------------------------------
PUR9_AGRFC       SARIAAQKAEDAAKA---------------------------------------------
PUR9_BRADU       SARIAARKAQDAAVE---------------------------------------------
PUR9_RHOS4       STRIAARKSQDMAQA---------------------------------------------
PUR9_PARDP       STRIGKRKSEDMAEA---------------------------------------------
PUR9_RHORT       SARIASWKADEAAEA---------------------------------------------
PUR9_CAUVC       SARIAALRAADFGLD---------------------------------------------
PUR9_CHLTE       SSKIARWKASE-------------------------------------------------
PUR9_PELPB       SSKIARWKASE-------------------------------------------------
PUR9_CHLAA       SSRLAVWKAQQ-------------------------------------------------
PUR9_MYCSJ       AARLAVQRAG--------------------------------------------------
PUR9_MYCTU       AARLAVERGG--------------------------------------------------
PUR9_CORGL       SARLAVDRAGA-------------------------------------------------
PUR9_STRCO       SAKLAVERAGA-------------------------------------------------
PUR9_BIFLO       SCHLAVERANTLAD----------------------------------------------
PUR9_LEIXX       SCTLAVSRAA--------------------------------------------------
PUR9_RHOBA       SVEISIKKAA--------------------------------------------------
PUR9_BACTN       ALKQAIEKAKSFG-----------------------------------------------
PUR9_THEMA       --RAAWIATVMAG-----------------------------------------------
PUR9_THEYD       SAKIGAMHALS-------------------------------------------------
PUR9_AQUAE       SLKCAINKAKEFG-----------------------------------------------
PUR9_CLOBH       AAKEALDRAGD-------------------------------------------------
PUR9_CLOAB       PAKDAMERGKG-------------------------------------------------
PUR9_FUSNN       AAEKALERAKER------------------------------------------------
PUR9_DICDI       SVDICMKVGGDK------------------------------------------------
PUR9_CAMJE       AAKAAIAKAKEMG-----------------------------------------------
PUR9_MOUSE       CTRLAGDKANSWWLRHHPRVLSMKFKAGVKRAEISNAIDQYVTGTIGEGE-DLVKWEALF
PUR9_HUMAN       CTRLAGDKANYWWLRHHPQVLSMKFKTGVKRAEISNAIDQYVTGTIGEDE-DLIKWKALF
PUR92_YEAST      CTRLAGDKADNWWFRQHPRVLEIKWAKGVKRPEKSNAIDLFVTGQIPTEEPELSEYQSKF
PUR91_YEAST      CTRLAGDKTDNWWLRQHPKVLNMKWAKGIKRADKSNAIDLFVTGQ-RIEGPEKVDYESKF
PUR9_SCHPO       CNRLAGDKADNWWLRHHPKVLGMQFKKSAKRPEKSNAIDLYVLDAVPAEGSEREQWESAF
                                                                             

PUR9_LEPIN       ----------------LSVVGSYVASDAFFPFRDGIDALAKAGAKAIIQPGGSVRDEEVI
PUR9_LEPBA       ----------------LSVVGSYVGSDAFFPFRDGIDAIAKVGAKAIIQPGGSIRDEEVI
PUR9_BUCAI       ----------------KNIIGATMASDAFFPFRDGIDEAASVGISSIIQPGGSIRDEEII
PUR9_WIGBR       ----------------FSLKGSVMASDAFFPFRDSIDFASKFGVSCIIQPGGSINDDKII
PUR9_SYNY3       -------------------QGACLASDAFFPFDDSVRTAAAAGITTIIQPGGSMRDQDSI
PUR9_THEEB       -------------------RGGVLASDGFFPFADSVEAAALAGIAAIIQPGGSLRDSESI
PUR9_PROMA       -------------------KKAVLASDGFFPFDDTVRMAASHGITAIIQPGGSIKDNLSI
PUR9_MOOTA       -------------------KGAVLASDAFFPFGDTVELAAGAGITAIIQPGGSIRDEESI
PUR9_BACAN       -------------------QGSALASDAFFPMPDTVEEAAKAGITAIIQPGGSIRDEDSI
PUR9_BACCR       -------------------QGSALASDAFFPMPDTLEEAAKAGITAIIQPGGSIRDEDSI
PUR9_BACC2       -------------------QGSALASDAFFPMPDTLEEAAKAGITAIIQPGGSIRDEDSI
PUR9_BACSU       -------------------KGSALGSDAYFPMPDTVEEAAKAGVTAIIQPGGSIRDEDSI
PUR9_BACHD       -------------------AGSVMGSDAFFPMGDTVELAAKAGITAIIQPGGSIRDEESI
PUR9_LISMO       -------------------KGAVLASDAFFPMDDTVEAAAKSGITAIIQPGGSIKDKESI
PUR9_LACPL       ------------------YENAILASDAFFPMDDCVEYAAQHGIRAIVQPGGSIRDKDSI
PUR9_STRP4       ------------------LNGAVLASDAFFPFADNVEEIAKAGIKAIIQPGGSVRDQESI
PUR9_STRR6       ------------------LDGAVLASDAFFPFADNVEEIAKAGIKAIIQPGGSVRDQESI
PUR9_STRPD       ------------------LDGTVLASDAFFPFADNIEEIAAAGIKAIIQPGGSVRDQDSI
PUR9_LACLA       ----------------ELQENAVLGSDAFFPFADNIDEIAKAGIKAIVQPGGSVRDQEVI
PUR9_ENTFA       ------------------LQGAVLASDAFFPMADSVEYAAQHGIQAIIQPGGSIKDQASI
PUR9_STAA8       -------------------DHVALVSDGFFPMGDTVELAAQHGIKAIIQPGGSIKDQDSI
PUR9_DEIRA       -------------------QGAVLASEAFFPFDDVVRLAASAGVTAVLQPGGAKRDPEVI
PUR9_GEOSL       -----------AGLEVK---GAVMASDAFFPFRDGIDNAAAVGITAVIQPGGSMRDAEVI
PUR9_GEODF       -----------AGLQVA---GAVMASDAFFPFRDGIDNAAQVGITAVIQPGGSMRDEEVI
PUR9_VIBPA       -----------EGLEVA---GSVMASDAFFPFRDGIDAAAEAGIKCVIQPGGSMRDDEVI
PUR9_ALIF1       -----------EGLQVE---GCVMASDAFFPFRDGIDAAAEAGIKCVIQPGGSMRDNEVI
PUR9_VIBCH       -----------EGLEVA---GSVMASDAFFPFRDGIDAAAEAGITCVIQPGGSMRDQEVI
PUR9_SHEON       -----------EGLEVV---NSVMASDAFFPFRDGIDAAAAAGISCIIQPGGSMRDAEII
PUR9_COLP3       -----------ENLEVK---GSVMASDAFFPFRDGLDAAAEAGITAVIQPGGSMRDDEVI
PUR9_ECOSE       -----------EGLEVK---GSSMASDAFFPFRDGIDAAAAAGVTCVIQPGGSIRDDEVI
PUR9_SHIDS       -----------EGLEVK---GSSMASDAFFPFRDGIDAAAAAGVTCVIQPGGSIRDDEVI
PUR9_ECOLI       -----------EGLEVK---GSSMASDAFFPFRDGIDAAAAAGVTCVIQPGGSIRDDEVI
PUR9_SALTY       -----------EGLEVK---GSAMASDAFFPFRDGIDAAAAVGVSCVIQPGGSIRDDEVI
PUR9_YERPE       -----------EGLEVA---GSAMASDAFFPFRDGIDAAAAVGITCVIQPGGSIRDDEVI
PUR9_HAEIN       -----------EGLEVA---GCVMASDAFFPFRDGIDAAAKVGIQCVIHPGGSMRDQEVI
PUR9_PSEAE       -----------AGLEVK---GAVMASDAFFPFRDGIDNAAKAGITAVIQPGGSMRDNEVI
PUR9_PSEPW       -----------AGLQVQ---GAVMASDAFFPFRDGIDNAAKVGISAVIQPGGSMRDAEVI
PUR9_BURM9       -----------AGLTLA---GSAVASDAFFPFRDGLDVVVAAGATCVIQPGGSVRDDEVI
PUR9_BURPS       -----------AGLTLA---GSAVASDAFFPFRDGLDVVVAAGATCVIQPGGSVRDDEVI
PUR9_BURVG       -----------AGLTLA---GSAVASDAFFPFRDGLDVVVAAGATCVIQPGGSMRDDEVI
PUR9_NEIG1       -----------AGLDLN---GACAASDAFFPFRDGVDVIAEQGIKAIIHPAGSMRDQEVF
PUR9_NEIMB       -----------AGLDLN---GACAASDAFFPFRDGVDVIAEQGIKAIIHPAGSMRDQEVF
PUR9_LARHH       -----------AGLSLK---NAVAASDAFFPFRDGVDVIAEQGISAIIQPGGSMRDEEVI
PUR9_XANCP       -----------AKLTVA---GSVMASDAFFPFRDGIDAAAAAGIQAVIQPGGSMRDGEVI
PUR9_MAGMM       -----------AGLRENPLLGAAMASDAFFPFRDGVDAAAKAGAKAVIQPGGSVRDEEVI
PUR9_BRUSI       -----------AGLAAPLTKGCVVASDAFFPFADGLLSAVEAGATAVIQPGGSMRDDEVI
PUR9_AGRFC       -----------LGLAEPLTRGSAVASEAFYPFADGLLAAIAAGATAVIQPGGSMRDQDVI
PUR9_BRADU       -----------LKLAEPLTKGSVVASDAFFPFADGMLACIEAGATAVVQPGGSMRDDEVI
PUR9_RHOS4       -----------LGLAQPLTQGSVVASDAFFPFADGLLAAAEAGATAIIQPGGSMRDDEVI
PUR9_PARDP       -----------LGLAQALTIGSSVASDAFFPFADGVEALAAAGARAVIQPGGSMRDAEVI
PUR9_RHORT       -----------AGLAQSPTQGSVVASDAFFPFADGLLAAAKAGATAVIQPGGSMRDDEVI
PUR9_CAUVC       -----------L-------KGCACASEAFFPFADGLIQAAEAGATAIIQPGGSMRDPEVI
PUR9_CHLTE       -----------VALDLR---GSVVASDAFFPFADGLLAAAEAGVTAVIQPGGSIRDNEVI
PUR9_PELPB       -----------VSLDLH---GSVVASDAFFPFADGLLAAAEAGVTAVIQPGGSIRDNEVI
PUR9_CHLAA       -----------AGIDLR---GSVVASDALFPFADGVEAAIAAGATAIIQPGGSVRDEEVI
PUR9_MYCSJ       ----------------DRVRGAIAASDAFFPFPDGLETLTEAGVKAIVHPGGSMRDDVVT
PUR9_MYCTU       ----------------ERVRGAVAASDAFFPFPDGLETLAAAGVTAVVHPGGSVRDEEVT
PUR9_CORGL       ----------------ERATGSVAASDAFFPFADGFEVLAEAGITAVVQPGGSIRDNEVI
PUR9_STRCO       ----------------ERAQGAYAASDAFFPFPDGLEILTGAGVKAVVQPGGSVRDELVV
PUR9_BIFLO       --------------GADRATGAVAASDAFFPFADGAQVLIDAGVKAIVQPGGSIRDEEVI
PUR9_LEIXX       ----------------ERAVGAVAASDAFFPFADGPEILIAAGVAAIVQPGGSIRDEEVI
PUR9_RHOBA       ----------------ERSEGSILASDAFFPFPDSIEAAAKAGVLAIIQPGGSRRDDEVI
PUR9_BACTN       ----------------FDLNGAVMASDAFFPFPDCVEIADKEGITAVIQPGGSVKDDLTF
PUR9_THEMA       ----------------EKAKGAVAASDAFFPFPDSLEILAQAGVKAVVAPLGSIRDEEVI
PUR9_THEYD       -----------------SLKGTVVASDGFFPFRDNIDVLAQNGVTSIIQPGGSVRDQEVI
PUR9_AQUAE       ----------------FDLKGAVVASEAFFPFRDSIDIMAKEGITAVIQPGGSIRDQEVI
PUR9_CLOBH       --------------------GVVLASDAFFPFGDVAEEAAKWGIKAIIQPGGSIRDEESI
PUR9_CLOAB       --------------------AAVLASDAFFPFGDIVEEAHKNGIKAIIQPGGSIRDQESI
PUR9_FUSNN       ----------------FNATDVVLSSDAFFPFKDVIELAAKNGVKAIIQPSGSVNDKDSI
PUR9_DICDI       ------------------VKGSVLASDAFFPFADSIDLAHQGNIACIVQPGGSIRDQEVI
PUR9_CAMJE       ----------------LDLQGCVLASEAFFPFRDSIDEASKVGVKAIVEPGGSIRDDEVV
PUR9_MOUSE       EEVPELLTEAEKKEWVDKLSGVSVSSDAFFPFRDNVDRAKRSGVAYIVAPSGSTADKVVI
PUR9_HUMAN       EEVPELLTEAEKKEWVEKLTEVSISSDAFFPFRDNVDRAKRSGVAYIAAPSGSAADKVVI
PUR92_YEAST      EEIPKPFTPEERKEWLSKLTNVSLSSDAFFPFPDNVYRAVKSGVKYIAAPSGSVMDKVVF
PUR91_YEAST      EEVPEPFTKEERLEWLSKLNNVSLSSDAFFPFPDNVYRAVQSGVKFITAPSGSVMDKVVF
PUR9_SCHPO       ETIPEPLTKKEREEFLATCKDVVCASDAFFPFPDNIYRLAQSGVKYVAAPGGSVMDQAVR
                                          *:. :*: *        .   :  * *:  *    

PUR9_LEPIN       QAADEHGLIMVFTGMRHFRH
PUR9_LEPBA       QAADEHGLIMVFTGMRHFRH
PUR9_BUCAI       RAADEHNITMIFTKKRHFKH
PUR9_WIGBR       SAVDENNMSMIFTNTRQFSH
PUR9_SYNY3       QAANELGLVMIFTGVRHFLH
PUR9_THEEB       QAANAAGIAMVFTNQRHFRH
PUR9_PROMA       EACNELNISMIFTGRRHFLH
PUR9_MOOTA       RAADAAGIAMVFTGIRHFRH
PUR9_BACAN       KVADTYGIAMVFTGVRHFKH
PUR9_BACCR       KVADTYGIAMVFTGVRHFKH
PUR9_BACC2       KVADTYGIAMVFTGVRHFKH
PUR9_BACSU       KKADEYGIAMVFTGIRHFKH
PUR9_BACHD       ENADKHGIAMVFTGVRHFKH
PUR9_LISMO       AMADKYGISMVLTHVRHFKH
PUR9_LACPL       AMADRYGIAMVTTGVRHFRH
PUR9_STRP4       EAADKYGLTMVFTGVRHFRH
PUR9_STRR6       EAADKYGLTMVFTGVRHFRH
PUR9_STRPD       DAANKHGLTMIFTGVRHFRH
PUR9_LACLA       DACDKYGIAMVFTGLRHFRH
PUR9_ENTFA       DLANHYGIAMIFTGTRHFKH
PUR9_STAA8       DMANKHGIAMVVTGTRHFKH
PUR9_DEIRA       AACNELGISMVFTGSRHFRH
PUR9_GEOSL       AAADEHGMAMVFTGMRHFRH
PUR9_GEODF       AAADEHGMAMVFTSMRHFRH
PUR9_VIBPA       AAADEHGMAMIFTGMRHFRH
PUR9_ALIF1       EAADEHGMAMIFTGMRHFRH
PUR9_VIBCH       DAANEHGMAMIFTGMRHFRH
PUR9_SHEON       AAADEHGMAMVMTGMRHFRH
PUR9_COLP3       AAADEHNIAMVFTGMRHFRH
PUR9_ECOSE       AAADEHGIAMLFTDMRHFRH
PUR9_SHIDS       AAADEHGIAMLFTDMRHFRH
PUR9_ECOLI       AAADEHGIAMLFTDMRHFRH
PUR9_SALTY       AAADEHGIAMIFTDMRHFRH
PUR9_YERPE       AAADEHSIAMIFTDMRHFRH
PUR9_HAEIN       DAADEHNMVMVLTGMRHFRH
PUR9_PSEAE       AAADEADIAMVFTGMRHFRH
PUR9_PSEPW       AAADEAGIAMVFTGMRHFRH
PUR9_BURM9       AAADEHNIAMVVTGVRHFRH
PUR9_BURPS       AAADEHNIAMVVTGVRHFRH
PUR9_BURVG       AAADEHGIAMVLTGVRHFRH
PUR9_NEIG1       DAADEHGIAMAVTGIRHFRH
PUR9_NEIMB       DAADEHGIAMVVTGIRHFRH
PUR9_LARHH       KAADEHGIAMVFTGNRHFRH
PUR9_XANCP       AAADEHGLAMVFTGVRHFRH
PUR9_MAGMM       AAANEHGMAMVFTGMRHFKH
PUR9_BRUSI       AAADEHGIAMVMTGMRHFRH
PUR9_AGRFC       DAANEHNVAMVFTGMRHFRH
PUR9_BRADU       KAADEHGIAMVFTGTRHFRH
PUR9_RHOS4       AAADEAGLAMVFTGQRHFRH
PUR9_PARDP       EAADRLGLAMVFTGQRHFRH
PUR9_RHORT       KAADEAGLAMVFTGLRHFRH
PUR9_CAUVC       EAADKLGLTMAFTGVRVFRH
PUR9_CHLTE       EAADANNLAMVFTGMRHFKH
PUR9_PELPB       EAADANNLAMVFTGMRHFKH
PUR9_CHLAA       AAADAAGAAMVFTGRRHFRH
PUR9_MYCSJ       EAAAKAGISLYLTGARHFAH
PUR9_MYCTU       EAAAKAGVTLYLTGARHFAH
PUR9_CORGL       EAANKAGVTMYLTGARHFAH
PUR9_STRCO       EAAKKAGVTMYFTGTRHFFH
PUR9_BIFLO       EAAKKAGVTMYLTGTRHFFH
PUR9_LEIXX       ASATAAGVTMYFTGERHFFH
PUR9_RHOBA       AACDEHEIAMVFTGRRHFKH
PUR9_BACTN       AYCNEHGMAMVTTGIRHFKH
PUR9_THEMA       EKARELGITFYKAPSRVFRH
PUR9_THEYD       DAANQYNIAMVFTGIRHFRH
PUR9_AQUAE       DACNEHGIAMIFTGLRHFKH
PUR9_CLOBH       KVCNEKGISMVFTGIRHFKH
PUR9_CLOAB       DGCNKYGISMVMTGIRHFKH
PUR9_FUSNN       EECDRNNISMIFSKLRHFKH
PUR9_DICDI       DAANKYGIPMVFTGNRNFLH
PUR9_CAMJE       KAADEYGMALYFTGVRHFLH
PUR9_MOUSE       EACDELGIVLAHTDLRLFHH
PUR9_HUMAN       EACDELGIILAHTNLRLFHH
PUR92_YEAST      SAADSFDLVYVENPIRLFHH
PUR91_YEAST      QAADSFDIVYVENPIRLFHH
PUR9_SCHPO       DTANEFNMVFSEIPLRLFHH
                                * * *