CLUSTAL format seed alignment for MF_00146

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

DCD_RICBR       ------MSIMSDKWIREAVINHKMIEPFAEKQVRVKDSE-KIISYGLSSYGYDARVSNEF
DCD_RICPR       ------MAIMSDKWIKDAVMNQNMIRPFAAKQVRVHNKE-KIISYGLSSYGYDARVSNEF
DCD_ANAPZ       ------MSVMPDHWIKERALKDGMISPFVDHKEGT-----GVLSYGLSSYGYDARLDNKF
DCD_ANAMF       ------MSAMPDHWIKEKALKEGMISPFVDHKEEA-----GVLSYGLSSYGYDARVDSKF
DCD_WOLTR       ------MAVMPDKWIREKAESFGMIEPFVDHKSSK-----GVMSFGLSSYGYDARVDNKF
DCD_NEOSM       ------MPVMPDQWIKSKALESRMIEPFVSSKIST-----GVISYGLSSYGYDARVSNKF
DCD_NOVAD       ------MAILSDKWIRDKALNEGMIEPFVENQRRD-----GCISYGLSSYGYDARVAPEF
DCD_HELHP       ------MGLKSDTWIKKMS-KKGMIEPFCEKQVGK-----NIVSYGLSSYGYDIRVGNEF
DCD_NITSB       ------MGLKADCWIRQKAVEDGMIEPFCEDQIGK-----GVVSYGLSSYGYDIRVSDEF
DCD_KORVE       ------MAIKSDRWIRRMAQEHDMINPFYEKQMRQ-----GVISYGLSSYGYDLRVADEF
DCD_PSYWF       ------MSIKSDRWIRKMAEEHGMIEPYEPGQVRFNEAGDKLVSYGTSSYGYDVRCAREF
DCD_CELJU       ------MSIKSDKWMRRMVEQYGMIEPYEPGQVRYDAAGHKIVSYGTSSYGYDVRCADEF
DCD_BORA1       ------MSIKSDRWIRRAAEG-GMIEPFEAGQVRTVNGG-RIVSYGTSSYGYDVRCADEF
DCD_BURVG       ------MSIKSDKWIRRMAEEHKMIEPFVPDQVRASEDGRRIVSYGTSSYGYDIRCADEF
DCD_FRATT       ------MTIKSDKWIKKMSQEHNMIEPFEAGQVKVINNQ-KIVSYGTSSYGYDVRCADEF
DCDB_DICTD      ------MILSDKDIKKYLEERKLVIHPI------------DDPQKQIQPSSVDLRLGNSF
DCDB_METS3      -----MAILSDKTIKEYLEEGKIVIDPL------------KDEQ-QIQPSSVDMRLGDEF
DCDB_STRAW      ------MLLSDKDIRAEIDAGRVRIDPY------------DESM--VQPSSIDVRLDRYF
DCDB_STRGG      ------MLLSDKDIRAEIDAGRVRIDPY------------DPSM--VQPSSIDVRLDRYF
DCDB_ACIC1      ------MLLSDRDIRAELASGRVTIDPF------------DPAM--IQPSSIDVRLDKYF
DCDB_KOCRD      ------MLISDRDIRRHLDSGRVRLEPS------------DPAM--VQPASVDVRLDRWF
DCDB_MYCS2      ------MLLSDRDIRAEIAAKRLALEPF------------DDAL--VQPSSIDVRLDRMF
DCDB_MYCTU      ------MLLSDRDLRAEISSGRLGIDPF------------DDTL--VQPSSIDVRLDCLF
DCD_SODGM       ------MRLCDRDIEIWLDEGRLDIAPR------------PPIE-RINGATVDVRLGNQF
DCD_ECOLI       ------MRLCDRDIEAWLDEGRLSINPR------------PPVE-RINGATVDVRLGNKF
DCD_YERPE       ------MRLCDRDIEAWLDSGKLGIEPR------------PPVE-RINGATVDVRLGNQF
DCD_SHEAM       ------MRLTDFEIEQALDAGTILIEPR------------PSND-AISGVSVDVRLGNQF
DCD_HAEIN       ------MRLCDTDIERYLDDGIISLTPR------------PNND-KINGATIDVRLGNSF
DCD_COLP3       ------MRLCDKDIEQYLDDEKIIIEPK------------PDSS-MISGVSVDIRLGNEF
DCD_PSEA6       ------MRLCDKDILTHLQEGKISITPE------------PDYA-EISGVTVDIRLGNKF
DCDB_SULSY      ------MILNDKTIRKYISEGLLEINPL------------DDIQ--IQPSSVDLRLGNEF
DCDB_BACHD      ------MILSGKTISEKLTEKELEITPL------------TEEQ--IQPASVDLRLGPHF
DCDB_CLOAB      ------MILSGKQIKDSLGKD-IVIEPF------------NEKQ--INPNSYNLKLHNEL
DCDB_CYTH3      ------MILSGLEIKDKLGSD-IVIEPY------------DDSR--LNPNSYNLRLHNEL
DCDB_CLOB8      ------MILSGKEILKNIGSN-IIIEPF------------DEKK--INPNSYNLSLHNEL
DCDB_LEPBP      ------MILTGKEILKRLGSD-IKIEPY------------DEKL--LNPNSYNLRLHEDL
DCDB_LEPIN      ------MILTGKEIQKRIGND-IVITPY------------SEKQ--LNPNSYNLRLHEEL
DCD_RHOBA       MKETPIMILSGQDIQSRLGKD-IVIDPF------------DPSR--LSPNSYNLTLHDEL
DCD_SULTO       ------MILGDRDLKYYLEKGWIKIDPL------------REDT--VRENGVDLRVGGEI
DCD_SACS2       ------MILSDRDLKYYLEKSWIKIQPL------------REDT--IRENGVDLRVGNEI
DCD_METS5       ------MILGDRDLKYYLEKKWILVDPL------------TEDS--VRENGIDMRVGGEI
DCD_AERPE       ------MILSDRDIRALLAIGDLVVEPL------------SGDT--VRENGLDLRLGRGF
DCD_IGNH4       ------MILSDGGIKSYLRRGLMKIEPF------------DENQ--VRENGVDLTIGHQY
DCD_PYRFU       ------MLLPDWKIRKEI-----LIEPF------------SEES--LQPAGYDLRVGREA
DCD_THEGJ       ------MMLPDWKIEKEI-----LIEPF------------SKES--LQPAGYDLRVGKEA
DCD_THESM       ------MILPDHKIRKEI-----LIEPF------------NEKS--LQPAGYDLRVGKEA
DCD_THEAC       ------MILNDSTIMRMVSDGLLISENF------------DRGC--LTPNGYDLRVDAID
DCDB_METJA      ------MILSDKDIIDYVTSKRIIIKPF--------------NKDFVGPCSYDVTLGDEF
                                                                    :       

DCD_RICBR       KIFTNINSTMVDPKNFD----------KYNLVDREVD---------VCIIPPNSFALGRT
DCD_RICPR       KIFTNINSTTVDPKNFS----------EYNLVDREVD---------ACIIPPNSFALGRT
DCD_ANAPZ       KIFANTHSVVVDPKNFS----------QDSFVDREGD---------FCIIPPNSFMLAKT
DCD_ANAMF       KIFANTHSSIVDPKNFP----------QDSFIDKETD---------VCIMPPNSFMLAKT
DCD_WOLTR       KIFTNVNSAVVDPKDFS----------KNSFIDKETD---------VCIIPPNSFALAST
DCD_NEOSM       KIFTNLAVSQVDPKNFD----------ESMLIERTGD---------FCIIPPNSFALGCT
DCD_NOVAD       KIFTNVDSAVVDPKDFA----------SNSFVDRETD---------VCVIPPNSFALART
DCD_HELHP       MIFTNIGANLVDPKSFD----------ERNVVEITTEENG------YCLVPPNSFALART
DCD_NITSB       KIFTNVNAEVVDPKHFD----------ERNVVDFKGD---------VCIVPPNSFALART
DCD_KORVE       KIFTNVNNAIVDPKHFD----------EKSFVTITSD---------VCIVPPNSFALARS
DCD_PSYWF       KVFTNVHSAIVDPKNFD----------ENSFIDIVGD---------ECIIPPNSFALART
DCD_CELJU       KIFTNVHSTVVDPKNFD----------EKSFVDIKSD---------VCIIPPNSFALART
DCD_BORA1       KIFTNINSTIVDPKNFD----------EGSFVDFKGD---------VCIIPPNSFALART
DCD_BURVG       KIFTNINSTIVDPKNFD----------EGSFVDFKGD---------VCIIPPNSFALART
DCD_FRATT       KIFTNINSSIVDPKNFN----------DKNFVDFKGD---------VCIIPPNSFALART
DCDB_DICTD      LHFKVEGRAYIDPTKD-------NPQDLMEIIEIEEGK--------PFFLRPGEFVLGTT
DCDB_METS3      KVFKVIRKPYIDPKDEE------DIAEYMESSTVPEGE--------AFIIHPNEFALATT
DCDB_STRAW      RVFENHRYPHIDPSVE--------QADLTRLVEPEGDE--------PFILHPGEFVLAST
DCDB_STRGG      RVFENHRYPHIDPAVE--------QPDLTRTVEPEGDE--------AFILHPGEFVLAST
DCDB_ACIC1      RVFENHRYPHIDPAVE--------QPDLTRLVETEGDE--------PFILHPGEFVLAST
DCDB_KOCRD      RLFDNHKYAHIDPEQE--------QPELTRLVEVAPDE--------PFVLHPGEFVLGAT
DCDB_MYCS2      RVFNNTRYTHIDPAMQ--------QDELTTLVEPAEGE--------PFVLHPGEFVLGST
DCDB_MYCTU      RVFNNTRYTHIDPAKQ--------QDELTSLVQPVDGE--------PFVLHPGEFVLGST
DCD_SODGM       RVFRGHTAAYIDLSGPKDEVTAALDRVMSDEIQLVEGE--------AFFLHPGELALAVT
DCD_ECOLI       RTFRGHTAAFIDLSGPKDEVSAALDRVMSDEIVLDEGE--------AFYLHPGELALAVT
DCD_YERPE       RVFRGHTAAFIDLSGPKDEVSAALERVMSDEINLPEGE--------AFFLHPGELALAVT
DCD_SHEAM       RVFQDHTAPFIDLSGPSAEVQAALDRVMSDKIDIKDGN--------AFFLHPGELALAVT
DCD_HAEIN       RVFREHSAPFIDLSGPKEEVSAQLESVMSDEIIIPEGE--------AFFLHPGTLALATT
DCD_COLP3       RVFQDHTAPYIDLSAPKGEVQEAMNSIMSDEIFIADGD--------AFFLHPGELALAVT
DCD_PSEA6       RVFTEHQAPYIDLSGPKAQVQEALNTVMSDEISVGQDK--------SFYLHPGELALAVT
DCDB_SULSY      LIYPEDIEIIDVRDPY---------FSNRLIKEIATEE--------GFIIKPKQFVLATT
DCDB_BACHD      VTIDDSKE--AVISFE---------RPIRYREWTTSDE--------TIVLPPHTFLLATT
DCDB_CLOAB      LVYDEEVLDMKKPNKT--------------KKLIIPEE--------GIVLEPRKLYLGRT
DCDB_CYTH3      LVYDNNELDMKKPNTA--------------SPLIIPEE--------GLLLETGKLYLGRT
DCDB_CLOB8      LVYENDILDMKTPNPT--------------KVIKIPED--------GLLLEPGKLYLGRT
DCDB_LEPBP      LVYSEFPLDMKKPNPV--------------RTLKIPEE--------GLLLEPGNLYLGRT
DCDB_LEPIN      LVYTELPLDMKKPNPA--------------EKLVIPES--------GLLLKPGILYLGRT
DCD_RHOBA       LVYEEVVLDAASPNRY--------------RRLPIPEE--------GLTLQPGTLYLGRT
DCD_SULTO       ARFIKTDKVFDPD-NPDP---------AFFKIEKIEE----------FIIQPYEHVLLTT
DCD_SACS2       ARFKKTDKIFDPD-NPDP---------SFFQTEKGEE----------FIIQPYEHVLLTT
DCD_METS5       ARFKNVDRPFEEGMNPD----------DFFVRERGNE----------FVIWPNEHVLMVT
DCD_AERPE       CRFKRSDRVLDPRAPGSPG--------EFYECGEGDE----------IIVGPGEHMLLHT
DCD_IGNH4       ARFKNTEDVLDVTKEEDLS--------KYYELGFMDDE--------GIVIKPYEHVLLHT
DCD_PYRFU       FVKGK-------------------------LIDVEKEG--------KVVIPPREYALILT
DCD_THEGJ       YVEGK-------------------------LIDVEEAG--------NVIIPPKKHALILT
DCD_THESM       MVNGK-------------------------FINVEEEG--------KLVIPPKGHALILT
DCD_THEAC       VEGRQ-------------------------YSEFE--------------IGKNVHFLVST
DCDB_METJA      IIYDDEVYDLSKELNYKRIKIKNSILVCPLNYNLTEEKINYFKEKYNVDYVVEGGVLGTT
                                                                        *  :

DCD_RICBR       VEYFKIPRDVLVICVGKSTYARCGIIVN--VTPLEPEWEGHVTLEFSNTTPLPAKIYANE
DCD_RICPR       IEYFKIPRDVLVICVGKSTYARCGIIVN--VTPLEPEWEGHVTLEFSNTTPLPAKIYANE
DCD_ANAPZ       VEYFNIPRDVMVVCVGKSTYARCGIVVN--VTPLEPGWSGYVTLEFSNTSPLPVKVYAFE
DCD_ANAMF       VEYFRIPKDVIVICVGKSTYARCGIVVS--VTPLEPGWEGYVTLEFSNTAPLPVKVYAFE
DCD_WOLTR       VEYFHIPRDVLAICVGKSTYARCGIIVN--VTPLEPGWKGHVTLEFSNTTPLPAKIYANE
DCD_NEOSM       IEYFRVPRGVIVICLGKSTYARCGIIVN--VTPLEPEWEGHVTLEFSNTTPLPAKIYSNE
DCD_NOVAD       VEYFRVPRDVLVICLGKSTYARCGIIVN--VTPLEPGWEGHVTLEFSNTTPLPAKIYANE
DCD_HELHP       IEYFRIPRNVLAICLGKSTYARCGIIVN--VTPFEPEFEGHITIEISNTTPLPAKIYANE
DCD_NITSB       VEYFRIPRNVLAICVGKSTYARCGIIVN--VTPFEPEFEGHITIEISNTTPLPAKIYANE
DCD_KORVE       VEYFKIPRDVLTICVGKSTYARCGIIVN--VTPFEPEWEGYVTLEISNTTPLPAKIYANE
DCD_PSYWF       VEYFRIPRDVLTICLGKSTYARCGIIVN--VTPLEPEWEGHVTLEFSNTTTLPARIYAGE
DCD_CELJU       VEYFRIPRSILTVCLGKSTYARCGIIVN--VTPLEPEWEGHVTLEFSNTTPLPAKIYANE
DCD_BORA1       VEYFRIPRSVLTICLGKSTYARCGIIVN--VTPLEPEWEGHVTLEFSNTTPLPAKIYAGE
DCD_BURVG       VEYFRIPRTVLTVCLGKSTYARCGIIVN--VTPFEPEWEGYVTLEFSNTTPLPAKIYANE
DCD_FRATT       VEKFKIPRDTLVVCLGKSTYARCGIIVN--VTPLEPEWEGYVTLEFSNTTPLPAKIYANE
DCDB_DICTD      IETVKLPDDLVARVDGRSSLGRLGIIVHATAGYVDPGFCGQITLELSNINRVPVALYPGM
DCDB_METS3      QEYVKVPDDLVARVEGRSSMGRLGVTMHVTAGYVDPGFEGRITLEISNIGAMPVALYPGQ
DCDB_STRAW      YEVISLPDDLASRLEGKSSLGRLGLVTHSTAGFIDPGFSGHVTLELSNLATLPIKLWPGM
DCDB_STRGG      YEVISLPDDLASRLEGKSSLGRLGLVTHSTAGFIDPGFSGHVTLELSNLATLPIKLWPGM
DCDB_ACIC1      YEVIALPDDLAGRLEGKSSLGRLGLLTHSTAGWIDPGFTGHVTLELSNVATLPIKLWPGM
DCDB_KOCRD      YEKVTLPDDIAARLEGKSSLGRLGLLTHSTAGFIDPGFSGHVTLELSNMATLPIKLWPGS
DCDB_MYCS2      LELCTLPDDLAGRLEGKSSLGRLGLLTHSTAGFIDPGFSGHITLELSNVANLPITLWPGM
DCDB_MYCTU      LELFTLPDNLAGRLEGKSSLGRLGLLTHSTAGFIDPGFSGHITLELSNVANLPITLWPGM
DCD_SODGM       LESVTLPDDLVGWLDGRSSLARLGLMVHVTAHRIDPGWQGRIVLEFYNSGKLPLALRPGM
DCD_ECOLI       LESVTLPADLVGWLDGRSSLARLGLMVHVTAHRIDPGWSGCIVLEFYNSGKLPLALRPGM
DCD_YERPE       LESVTIPDDLVGWLDGRSSLARLGLMVHVTAHRIDPGWQGRIVLEFYNSGKLPLALRPGM
DCD_SHEAM       LESVTLPADIVGWLDGRSSLARLGLMVHVTAHRIDPGWQGKIVLEFYNSGKLPLALRPGM
DCD_HAEIN       LESVKLPANIIGWLDGRSSLARLGLMVHVTAHRIDPGWEGKIVLEFYNSGKLPLALRPNM
DCD_COLP3       YESVTLPDNIVGWLDGRSSLARLGLMVHVTAHRIDPGWSGQIVLEFYNSGKLPLALRPKM
DCD_PSEA6       LESVTLPGNIVGWLDGRSSLARLGLMVHVTAHRIDPGWSGNIVLEFFNSGKLPLALKPGM
DCDB_SULSY      IEYIKLPDFLTAFVEGRSSLGRLGLFIE-NAGWVDAGFEGNITLEFYNANSIPIKIYPGM
DCDB_BACHD      METVKLPNHLTAFVEGRSSVGRLGLFIQ-NAGWVDPGFNGQITLELFNANRLPIELPIGR
DCDB_CLOAB      LEYTE-TDKYVPMLEGRSSIGRLGVFIHVTAGFGDVGFKGYWTLEIFCVE--PIRIYSGV
DCDB_CYTH3      IEYTE-SHNYVPMLEGRSSIGRLGLFVHVTAGFGDVGFCGFWTLEIFCVH--PIRVYPGV
DCDB_CLOB8      NEFTS-TSKYVPMLEGRSSTGRLGLFIHVTAGFGDIGFSGYWTLEIFCVQ--PIKVYPNV
DCDB_LEPBP      IEFTE-THNLVPMLEGRSSIGRLGMFVHITAGFGDVGFKGFWTLEIQVTH--PLRVYSGV
DCDB_LEPIN      LESTE-THNLVPMLEGRSSIGRLGMLVHVTAGFGDVGFKGFWTLEISVIQ--PLIVYPGV
DCD_RHOBA       TEHTE-THGLVPIIQGRSSLGRLGLFLNPGGSLGHAGYRGTWTLELHCVQ--PVRIYPHI
DCD_SULTO       EEYIELPNDVMAFVNLRSSFARLGLFIP--PTIVDAGFKGQITIEVV-GSSFPVLLRRGT
DCD_SACS2       EEYIELNNDVMAFVNLRSTFARLGLFIP--PTIVDAGFKGQVTIEVV-GSSFPVKLKRST
DCD_METS5       EEYLRLPQDIMAFVNMRSSFARLGLLVP--PTIVDAGFEGQLTIEVM-GSGFPVKIRRGT
DCD_AERPE       QEYIRLPGYVAGLVNLRSTWARTGIYIP--ATVVDAGFEGQLTIEVV-GSGFPVKLYPGD
DCD_IGNH4       REYIEMPADLVGLVNLKSSFARLGLYIP--PTVVDAGFKGEIVIEII-GSSFPVRVRPGV
DCD_PYRFU       LERIKLPDDVMGDMKIRSSLAREGVIGS--FAWVDPGWDGNLTLMLYNASNEPVELRYGE
DCD_THEGJ       LERVKLPDDVMGDMKIRSSLAREGILGS--FAWVDPGWDGNLTLMLFNASNEPVVLEYGE
DCD_THESM       LERVKLPDDVMGDMRLRSTFAREGLLGS--FAWVDPGWDGNLTLAFFNSSEEEVILHYEE
DCD_THEAC       IEILKIPDDVVGMIWTRSSFARKGIFGS--FGAIDAGYHGNLTLSFFNAGS-AVNLRRGE
DCDB_METJA      NEYIELPNDISAQYQGRSSLGRVFLTSHQTAGWIDAGFKGKITLEIVAFDK-PVILYKNQ
                 *              :*: .*  :         .  : *  .: .         :    

DCD_RICBR       GACQFLFLKGD--QICDLSYADRQGKYM-----KQLGVTLPLT-----------------
DCD_RICPR       GACQFLFLKSD--QICDTSYAERQGKYM-----KQVGVTLPLT-----------------
DCD_ANAPZ       GACQFLFFSGK--ERCSKSYDEAGGKYM-----GQSDVTLPIIS----------------
DCD_ANAMF       GACQFIFLAGN--ERCSISYDQVNGKYM-----RQGGVTLPIVS----------------
DCD_WOLTR       GACQFVFLSGE--SECEKSYDDIKGKYM-----NQHGITLPLVK----------------
DCD_NEOSM       GVCQMIFLKGS--TNCDVSYKDAKGKYM-----GQAGITLPIVK----------------
DCD_NOVAD       GACQFLFLQGN--EPCEVSYADRAGKYM-----GQRGVTLPRL-----------------
DCD_HELHP       GIAQVLFLEGD--ETCEVSYKDKKGKYQ-----GQKGITLPKVIK---------------
DCD_NITSB       GIAQVLFFEGD--EDCEVSYKDKRGKYQ-----HQRGITLPKIL----------------
DCD_KORVE       GLCQILFFQSD--EVCEISYKDKKGKYQ-----SQKGIVLPKL-----------------
DCD_PSYWF       GVAQMLFFQSDADDICETSYKDRGGKYQ-----GQRGVTLPRT-----------------
DCD_CELJU       GVAQMLFFESD--EICETSYRDRGGKYQ-----GQRGVTLPRT-----------------
DCD_BORA1       GCAQMLFLESD--EVCETSYRDRGGKYQ-----GQRGVTLPRT-----------------
DCD_BURVG       GVAQVLFFESD--EVCDVSYADRGGKYQ-----GQRGVTLPKT-----------------
DCD_FRATT       GVAQMLFFQSD--EECETSYADKGGKYQ-----GQVGVTLPKC-----------------
DCDB_DICTD      RICQISFYKLT--SPAETPY----YKKAGSKYHNQKGPTASKLNIDFCVKEDK-------
DCDB_METS3      RVCQLVFETMT--TPAELPYG---HPKRNSKYMKQLKPESSRVKLDYELKK---------
DCDB_STRAW      KIGQLCMFRLS--SPAEFPYG---SDRYGSRYQGQRGPTASRSFLNFHRTQV--------
DCDB_STRGG      KIGQLCLFKLT--SSAEFPYG---SERYESRYQGQRGPTASRSFQNFHRTQV--------
DCDB_ACIC1      KIGQLCLFRTS--SPAEHPYG---SPVYGSRYQGQRGPTPSRSWQNFHRTKI--------
DCDB_KOCRD      KVGQLCFFQLS--SPTEHPYG---SGAYGNRYQGQRGPTASRSHLNFHRTVIE-------
DCDB_MYCS2      KIGQLCLLRLT--SPAENPYG---SAAVGSKYQGQRGPTPSRSHLNFIKS----------
DCDB_MYCTU      KIGQLCMLRLT--SPSEHPYG---SSRAGSKYQGQRGPTPSRSYQNFIRST---------
DCD_SODGM       LIGALSFEPLS--GPAARPYN---RRED-AKYRNQQGAVASRIDKD--------------
DCD_ECOLI       LIGALSFEPLS--GPAVRPYN---RRED-AKYRNQQGAVASRIDKD--------------
DCD_YERPE       LIGALSFEPLS--GPAARPYN---SRQD-AKYRGQQGAVASRIDKD--------------
DCD_SHEAM       TIGALNFERLS--GPVSRPYN---KRKN-AKYKDQQEAVASRISQDS-------------
DCD_HAEIN       VIGALSFEVLS--GEXKRPYS---SRKD-AKYKNQQSAVASRIDEDKE------------
DCD_COLP3       KIAALNFETMS--SSAARPYN---KRED-AKYRDQKGAVASRISQDEKVNK---------
DCD_PSEA6       KIGALSFEVMS--DFAEKPYN---ARVD-AKYKNQEGAIASRISGDDKTSTQ--------
DCDB_SULSY      RICQLVFAKME--DRSEKPYR---GKYQ-----GQRGTTASRIFLDRD------------
DCDB_BACHD      RICQLVFAEVT--GEVA-PYQ---GKYL-----FQKGATMSEIYKDAF------------
DCDB_CLOAB      EICQIYYHDVG--GDYEKYSS---GKYQ-----NNKGIQPSLLYKDFIN-----------
DCDB_CYTH3      EICQIFYHTIE--GKYENYKS---GKYQ-----HNKGIQPSLLYKDFEK-----------
DCDB_CLOB8      EICQIYYHDIH--GEYDLYSS---GKYQ-----NNKGIQPSLMYKDFEK-----------
DCDB_LEPBP      QICQIFYHTVE--GEISEYKS---GKYQ-----ANQGIQPSLLYKDFEKK----------
DCDB_LEPIN      EVCQIFYHTLE--GQITEYTS---GKYQ-----ANRGIQTSMLYKDFEK-----------
DCD_RHOBA       QICQITYWEVS--GDSPEEAS---EKYQ-----NSNDIQPSLMHRELGYDDRDTQLELGF
DCD_SULTO       RFIHLIFARTL--SPVEHPY---QGKYQ-----GQKGVTLPKFRTEASKFLSLHQK----
DCD_SACS2       RFIHLIFARTL--TPVEYPY---QGKYQ-----GQKGVTLPKFNSQISSFYYQHQSI---
DCD_METS5       RFLHLIFAKTL--TPVENPY---KGKYQ-----GQRGVTIPKFTK---------------
DCD_AERPE       RFLHLVLVKLQ--SPAMNPY---RGRYQ-----GQRGVRLPKLFAKNTG-----------
DCD_IGNH4       PFIHLVFLRTD--SPVLRDYSV-RGHYQ-----GQRGIRLPKLPIKL-------------
DCD_PYRFU       RFVQIAFIRLE--GPARNPYR---GNYQ-----GSTRLAFSKRKKL--------------
DCD_THEGJ       RFVQIAFIRLE--EPAKRPYR---GNYQ-----GSRRIALSKRRVRK-------------
DCD_THESM       RFVQIAFHRLE--EPSKNPYR---GIYQ-----GSQHLKLSKRKIR--------------
DCD_THEAC       RIAQIVFVKMI--GSAEKPYHIRSGNYQ-----NSRGIVKDPVAGSQIASEAKKN-----
DCDB_METJA      RIGQLIFSKLL--SPADVGYS----ERKTSKYAYQKSVMPSLIHLDNHKKD---------
                    .                             .                         

DCD_RICBR       --------
DCD_RICPR       --------
DCD_ANAPZ       --------
DCD_ANAMF       --------
DCD_WOLTR       --------
DCD_NEOSM       --------
DCD_NOVAD       --------
DCD_HELHP       --------
DCD_NITSB       --------
DCD_KORVE       --------
DCD_PSYWF       --------
DCD_CELJU       --------
DCD_BORA1       --------
DCD_BURVG       --------
DCD_FRATT       --------
DCDB_DICTD      --------
DCDB_METS3      --------
DCDB_STRAW      --------
DCDB_STRGG      --------
DCDB_ACIC1      --------
DCDB_KOCRD      --------
DCDB_MYCS2      --------
DCDB_MYCTU      --------
DCD_SODGM       --------
DCD_ECOLI       --------
DCD_YERPE       --------
DCD_SHEAM       --------
DCD_HAEIN       --------
DCD_COLP3       --------
DCD_PSEA6       --------
DCDB_SULSY      --------
DCDB_BACHD      --------
DCDB_CLOAB      --------
DCDB_CYTH3      --------
DCDB_CLOB8      --------
DCDB_LEPBP      --------
DCDB_LEPIN      --------
DCD_RHOBA       DEAIRSTP
DCD_SULTO       --------
DCD_SACS2       --------
DCD_METS5       --------
DCD_AERPE       --------
DCD_IGNH4       --------
DCD_PYRFU       --------
DCD_THEGJ       --------
DCD_THESM       --------
DCD_THEAC       --------
DCDB_METJA      --------