CLUSTAL format seed alignment for MF_00147_B

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

TPIS_HELPY        -----------------------------------------MTKIAMANFKSAMPIFKS-
TPIS_HELAH        -----------------------------------------MTKIAMANFKSAMPIFKS-
TPIS_WOLSU        -------------------------------------------MILAANFKTNHTRKST-
TPIS_HELHP        ------------------------------------------MTIIAGNFKANLTRIQV-
TPIS_CAMJE        -------------------------------------------MIFAANLKCNHTRASF-
TPIS_CAMJD        -------------------------------------------MIFAANLKCNHTRASF-
TPIS_CAMC5        -------------------------------------------MKFLANLKCNHTRASF-
TPIS_WOLTR        -----------------------------------------MSFLIVANWKMNGTRSLF-
TPIS_WOLPM        -----------------------------------------MSFLIVANWKMNGMRSSF-
TPIS_EHRCR        -----------------------------------------MSLLIVANWKMYGDFLTF-
TPIS_MYCH2        -----------------------------------------MKKIIIGNWKMNKTVSET-
TPIS_MYCH7        -----------------------------------------MKKIIIGNWKMNKTVSET-
TPIS_MYCPU        ----------------------------------------MKKLLIIGNWKMNKTYDEA-
TPIS_MYCAP        ----------------------------------------MKQFIVIGNWKMYKTFTET-
TPIS_SALTY        ----------------------------------------MRHPLVMGNWKLNGSRHMV-
TPIS_SALTI        ----------------------------------------MRHPLVMGNWKLNGSRHMV-
TPIS_SALPA        ----------------------------------------MRHPLVMGNWKLNGSRHMV-
TPIS_ECOLI        ----------------------------------------MRHPLVMGNWKLNGSRHMV-
TPIS_PHOLL        ----------------------------------------MRHPLVMGNWKLNGSTHMV-
TPIS_YERPE        ----------------------------------------MRHPLVMGNWKLNGSTHMV-
TPIS_HAEIN        ---------------------------------------MARRPLVMGNWKLNGSKAFT-
TPIS_HAEDU        ---------------------------------------MARRPLVMGNWKLNGSKAFT-
TPIS_VIBCH        ----------------------------------------MRRPVVMGNWKLNGSKAMV-
TPIS_VIBVY        ----------------------------------------MRRPVVMGNWKLNGSKTMV-
TPIS_ALIF1        ----------------------------------------MRHPVVMGNWKLNGSKEMV-
TPIS_MORMI        ----------------------------------------MRHPVVMGNWKLNGSKEMV-
TPIS_BUCCC        ----------------------------------------MIKPIIVGNWKLNGSKKLI-
TPIS_WIGBR        ---------------------------------------MKLKPLILSNWKLNGNCLLV-
TPIS_BUCAI        ----------------------------------------MKKFFITANWKLNGNIKMI-
TPIS_BUCBP        ----------------------------------------MKKKIIIANWKLNGNIQLL-
TPIS_BLOPB        ----------------------------------------MRRLLIIGNWKLNGNKNTI-
TPIS_ACIAC        ---------------------------------------MTKKKLIAGNWKMNGTLGAN-
TPIS_BORPE        -----------------------------------MTTAENRARLVLGNWKMHGNLAEN-
TPIS_RALSO        --------------------------------------MSARPKLVVGNWKLHGSLNGN-
TPIS_NITEU        ---------------------------------------MGRAGFVAGNWKMHGSLVRN-
TPIS_PSEPK        ----------------------------------------MRRPMVAGNWKMHGTRASV-
TPIS_PSEAE        ----------------------------------------MRRPLVAGNWKMHGTHSSV-
TPIS_PSESM        ----------------------------------------MRRPMVAGNWKMHGTRASV-
TPIS_XANCP        ----------------------------------------MRRKIVAGNWKLHGTRAFA-
TPIS_SHESM        --------------------------------------MALRRPMVAGNWKMNGSAALA-
TPIS_SHEON        --------------------------------------MALRRPMVAGNWKMNGSAALA-
TPIS_SHEPC        --------------------------------------MALRRPMVAGNWKMNGSAALA-
TPIS_POLNS        ----------------------------------------MRPLIVIGNWKMNGSLANN-
TPIS_LEGPC        ----------------------------------------MRQKIVAGNWKMNGQIQQV-
TPIS_FRATH        -----------------------------------------MQKLIMGNWKMNGNSTSI-
TPIS_ARATH        -------------------------------------MA--RKFFVGGNWKCNGTAEEV-
TPIS_HUMAN        -------------------------------------MAPSRKFFVGGNWKMNGRKQSL-
N4TND9_FUSC1      -------------------------------------MA--RKFFVGGNFKMNGSKSSI-
C9SPK3_VERA1      -------------------------------------MA--RKFFVGGNFKMNGTTSSI-
TPIS_CANAL        -------------------------------------MA--RQFFVGGNFKANGTKQQI-
TPIS_DICDI        -------------------------------------MTGTRTFFVGGNHKMNGSKSML-
TPIS_CLOPE        ----------------------------------------MRTPIIAGNWKMHYTIDEA-
TPIS_CLOBB        ----------------------------------------MRKAIIAGNWKMNKTVDEA-
TPIS_CLOAB        ----------------------------------------MRTPIIAGNWKMNNTISES-
TPIS_CLOTE        ----------------------------------MKGVYGLRKAIIAGNWKMHNTIDES-
TPIS_BACHD        ----------------------------------------MRKPIIAGNWKMNKTVGEA-
TPIS_BACAN        ----------------------------------------MRKPIIAGNWKMNKTLSEA-
TPIS_BACSU        ----------------------------------------MRKPIIAGNWKMNKTLGEA-
TPIS_BACLD        ----------------------------------------MRKPIIAGNWKMNKVLSEA-
TPIS1_LISIN       ----------------------------------------MRKPIIAGNWKMNKTAAKA-
TPIS1_LISMO       ----------------------------------------MRKPIIAGNWKMNKTAAKA-
TPIS_STAAC        ----------------------------------------MRTPIIAGNWKMNKTVQEA-
TPIS_STAEQ        ----------------------------------------MRTPIIAGNWKMNKTVQEA-
TPIS_STRT2        ---------------------------------------MSRKPFIAGNWKMNKNPEEA-
TPIS_STRR6        ---------------------------------------MSRKPFIAGNWKMNKNPEEA-
TPIS_STRA5        ---------------------------------------MSRKPFIAGNWKMNKNPEEA-
TPIS_STRPF        ---------------------------------------MLRKPIIAGNWKMNKNPQEA-
TPIS_STRP6        ---------------------------------------MSRKPIIAGNWKMNKNPQEA-
TPIS_STRP8        ---------------------------------------MSRKPIIAGNWKMNKNPQEA-
TPIS_STRSY        ---------------------------------------MSRKPIIAGNWKMNKNPQEA-
TPIS_STRMU        ---------------------------------------MSRKPIIAGNWKMNKTAAEA-
TPIS_LACGA        ----------------------------------------MRTPIIAGNWKLHMNPEQT-
TPIS_OCEIH        ----------------------------------------MRKKVIAGNWKMNKVLSEA-
TPIS_SYNY3        ----------------------------------------MRKIIIAGNWKMHKTQAEA-
TPIS_GLOC7        ----------------------------------------MRKIIIAGNWKMYKTQAEA-
TPIS_THEEB        ------------------MIRDNPCGTLDQVKFRRGKSRGVRPKVLAGNWKMHKTQQEA-
TPIS_PROMA        ----------------------------------------MRKTVIAGNWKMHMTCSSA-
TPIS_PROMM        ----------------------------------------MRKPVIAGNWKMHMTCAQA-
TPIS_SYNPX        ----------------------------------------MRRPVIAGNWKMHMTCAQA-
TPIS_PROMP        ----------------------------------------MRKSVIAGNWKMHMTCADT-
TPIS_AQUAE        ----------------------------------------MRR-LIAANWKMNKTVKET-
TPIS_TREDE        ----------------------------------------MKKFYIAANWKMNMNRAEA-
TPIS_TREPA        ----------------------------------------MRGYFIAGNWKMHKTCAEA-
TPIS_BORBU        ----------------------------------------MRKTFLAGNWKMHYTSAEA-
TPIS_LEPIN        ----------------------------------------MRKTIIAGNWKMNLSLKEA-
TPIS_FUSNN        ----------------------------------------MRRLVIAGNWKMYKNNKEA-
TPIS_COREF        ------------------------------------MSPMARKPLIAGNWKMNLDHQQA-
TPIS_CORGL        ---------------------------------------MARKPLIAGNWKMNLDHQQA-
TPIS_MYCTU        ---------------------------------------MSRKPLIAGNWKMNLNHYEA-
TPIS_MYCLE        ---------------------------------------MSRKSLIAGNWKMNLNHFEA-
TPIS_STRCO        --------------------------------------MTTRTPLMAGNWKMNLNHLEA-
TPIS_CUTAK        ---------------------------------------MSRTPIMAGNWKMNLDHVAA-
TPIS_BIFLO        -------------------------------------MASKRIPLVAGNWKMNFDHLEA-
TPIS_BIFAA        -------------------------------------MGPKRIPLVAGNWKMNFDHLEA-
TPIS_AGRFC        -------------------------------------MTPNVRPLVAGNWKMN-GTRAS-
TPIS1_RHIEC       -------------------------------------MTPDVRPLVAGNWKMN-GTRAS-
TPIS_BRUSU        -------------------------------------MTPGIRPLVAGNWKMN-GKGES-
TPIS_BARHE        -------------------------------------MSPNIRPFIAGNWKMN-GTGES-
TPIS_RUEPO        ----------------------------------------MRRKLAAGNWKMN-GTGAA-
TPIS_CAUVC        ----------------------------------MTLSSTTPRPLIAGNWKMN-GLSVA-
TPIS_HYPNA        ----------------------------------------MPRTLIAGNWKMN-GLMAN-
TPIS_DEIRA        -----------------------------------------MQTLLALNWKMN-KTPTE-
TPIS_RHOBA        ---------------------------------------MSRRILIAGNWKMNMRAESG-
TPIS_CHLTE        ---------------------------------------------MVGNWKMNNTIAES-
TPIS_PROA2        ----------------------------------------MRKKIVVGNWKMNKTIAEA-
TPIS_CHLPM        ----------------------------------------MRRKIVVGNWKMNKTVAES-
TPIS_BACTN        ----------------------------------------MRKNIVAGNWKMNKTLQEG-
TPIS_PORGI        ----------------------------------------MRKNIVAGNWKMNKTLQEG-
TPIS_CHLPN        ---------------------------------------MTRQSYVLGNWKMHKTIQEA-
TPIS_CHLCV        ---------------------------------------MERKSYVFGNWKMHKTAKEA-
TPIS_CHLTR        ------------------MFTDKETHRKPFPTWAHLLHSEPSKQFVFGNWKMNKTLTEA-
TPIS_PARUW        ------------------------------------MSPSHRPVVITGNWKMYKTVKEA-
TPIS_MYCGE        ----------------------------------------MRTRYLIGNWKTNKNLKDA-
TPIS_MYCPN        ----------------------------------------MRTKYLIGNWKTNKDLHQA-
TPIS_MYCGA        --------------------------------------MNSMKRYIFGNWKTYKTTQEV-
TPIS_ACIB5        ------------------------------------MSGSTITPWVVGNWKMNPMRANA-
TPIS_ACIBS        ------------------------------------MSGSTITPWVVGNWKMNPMRANA-
TPIS_ACIAD        ------------------------------------MSGSTIIPWVVGNWKMNPKQSDA-
TPIS_NEIMA        ---------------------------------------MWDQKWVIGNWKMNGRLQNN-
TPIS_NEIMB        ---------------------------------------MWDQKWVIGNWKMNGRLQNN-
TPIS_PSYCK        -----------------------------------------MQAWVIGNWKQNPATSHDV
TPIS_PSYA2        -----------------------------------------MQAWVIGNWKQNPATSHDV
TPIS_ORITB        -----------------------------------------MESIVVSNWKMHFSFSEA-
TPIS_UREPA        ------------------------------------------MKYIIANFKMNATQELI-
TPIS_TROW8        ------------------------MLPKRAYPVQDSNVHSQEKKIIAGNWKMNINHSQA-
                                                                  * *         

TPIS_HELPY        ----HAYLKELEKTLKPQHFDR-----------VFVFPDFFGL--L-------PNSFLH-
TPIS_HELAH        ----HAYLKELEKTLKPQHCDR-----------VFVFPDFLGL--L-------PNAFLH-
TPIS_WOLSU        ----RHYLERLSNFLFETSCEHD----------IFLFPPPLALD-F-------FDDIGG-
TPIS_HELHP        ----ATFAKELDSILTDMQTSSHL--------QVDIFPSHTAL--L-------TNNFKH-
TPIS_CAMJE        ----KIYAKILNKTMGVKCDDII------------VFPPSIAF----------LENENN-
TPIS_CAMJD        ----KIYAEILNKTMGAKCDDII------------VFPPSVAF----------LENENN-
TPIS_CAMC5        ----AEYAKILDANLSAD-DDVS------------VFVPFTAF----------DAKEHK-
TPIS_WOLTR        ----VNFIGKLNDK--SNEITSK----------LVICPPFTSLPGN-------IELNSN-
TPIS_WOLPM        ----VDFIGKLNNK--SNEITSK----------LVICPPFTSFPSS-------IELNNN-
TPIS_EHRCR        ----SSFTKELSANLVNVKADVE----------VVLCPPFIACSKI-------VDCAPN-
TPIS_MYCH2        ----RDFIQKFDIFYQE------NVGKIKEDLDFAIAPSFISLSLI------SKSLTKK-
TPIS_MYCH7        ----RDFIQKFDIFYQE------NVGKIKEDLDFAIAPSFISLSLI------SKSLTKK-
TPIS_MYCPU        ----RDFINAFSNAYAL------NGAKISENIEYGIAPSFTNMSLF------NKELLEKT
TPIS_MYCAP        ----LNFFDEFAIEYKKFRKANPQLIPYIDNNVFGVAPSQCNLTAY------FTNRVPE-
TPIS_SALTY        ----NELVANLRKELTGVAG-----------CDVAIAPPEMYIDLA-------KRAAAG-
TPIS_SALTI        ----NELVANLRKELTGVAG-----------CDVAIAPPEMYIDLA-------KRAAAG-
TPIS_SALPA        ----NELVANLRKELAGVAG-----------CDVAIAPPEMYIDLA-------KRAAAG-
TPIS_ECOLI        ----HELVSNLRKELAGVAG-----------CAVAIAPPEMYIDMA-------KREAEG-
TPIS_PHOLL        ----NELITGLRQELSSVTG-----------CDVAIAPPALYLSQA-------KQALAG-
TPIS_YERPE        ----NELIAGLRKELSTVDG-----------CGVAIAPPAIYLNQA-------KHELAG-
TPIS_HAEIN        ----KELIEGLKAELHDVTG-----------CDVAIAPPVMYLGTA-------EAALSGC
TPIS_HAEDU        ----QQLIAELKTELAEITG-----------CDVAIAPPVMYLSEA-------EIALAG-
TPIS_VIBCH        ----TDLLNGLNAELEGVEG-----------VDVVVAPPAMYLDLA-------ERLIKE-
TPIS_VIBVY        ----AELLTGLNAELEGVEG-----------VDVAVAPPALYIDLA-------ERLIAE-
TPIS_ALIF1        ----VELLNGLNAELEGVTG-----------VDVAVAPPALFVDLA-------ERTLTE-
TPIS_MORMI        ----VDLLNGLNAELEGVTG-----------VDVAVAPPALFVDLA-------ERTLTE-
TPIS_BUCCC        ----ESFLKQLNQFLIKYYKI----------CTVVIAPPVLYSHLI-------QNMFSS-
TPIS_WIGBR        ----KKILLKLNEKLKNKNN-----------LKVVIAPPVIYLSEF-------KKYVL--
TPIS_BUCAI        ----SSFFKYLKLYSSSYLEK----------NTVIIAPPTIYLERV-------CKNIS--
TPIS_BUCBP        ----QTLLKPLVNFYIRHKNKS--------SIKLVIMPPYVYLYPM-------KSIIS--
TPIS_BLOPB        ----TNLIITLVNTFYNISK-----------CNVAIAPPVMYLDIT-------KRYLL--
TPIS_ACIAC        ----AALLQALRGGLEAGAYQ---------NVDVAVAVPAAYLAQV-------QGLVEGS
TPIS_BORPE        ----AALLAELRA---ADAAA---------HCEMGVCVPFPYLAQT-------AAALQGS
TPIS_RALSO        ----AELLEKIKAA--GQT-----------RAALAVCAPFPYLAQC-------QSVLAGS
TPIS_NITEU        ----QELLDAVVSG--TRSLQ---------NVSCVVCVPYPYIAQT-------QSVLEGS
TPIS_PSEPK        ----AELTKGLSNL---ALPS---------GVEVAVFPPALFINQV-------IDGLAGK
TPIS_PSEAE        ----AELIKGLRQL---ALPS---------GVDVAVMPPCLFISQV-------IQGLAGK
TPIS_PSESM        ----AELIEGLVKQ---ALPG---------SVDIAVMPASLFTSRV-------IEGLQGT
TPIS_XANCP        ----TELVAQVAAH---MPLA---------GVDVVILPPLPYLGDL-------IEDFEAH
TPIS_SHESM        ----QELFKKFASK---LQND---------SAEVVLCPPSIYLESVRQLLEANKEALDGS
TPIS_SHEON        ----QELFKKFASK---LQND---------SAEVVLCPPSIYLESVRQLLEANKEALDGS
TPIS_SHEPC        ----QELFKKFASK---LQND---------SAEVVLCPPSIYLESVRQLLEANKEALDGS
TPIS_POLNS        ----QDWVKTVARGMESGMPS---------GRKYAVCPPFPYLQQC-------ADLIKGH
TPIS_LEGPC        ----TELVSQIEELI--GFDC---------AAQVAVMPPSIYIPKV-------RDCLRTG
TPIS_FRATH        ----KELCSGISQVQYDTSR-----------VAIAVFPSSVYVKEV-------ISQLPE-
TPIS_ARATH        ----KKIVNTLNEAQVPSQDV----------VEVVVSPPYVFLPL-------VKSTLRS-
TPIS_HUMAN        ----GELIGTLNAAKVPAD------------TEVVCAPPTAYIDF-------ARQKLDP-
N4TND9_FUSC1      ----KEIVDNLNNADLDKN------------AEVVVSPPAIYLPL-------VRETLRK-
C9SPK3_VERA1      ----KEIVKNLNEAKLDAN------------TEVVIAPPALYLPL-------VRSELRE-
TPIS_CANAL        ----TSIIDNLNKADLPKD------------VEVVICPPALYLGLA------VEQNKQP-
TPIS_DICDI        ----ESLSKGMNESVENKEN-----------VDIFIAPSYPYLEFL------SNKLDNK-
TPIS_CLOPE        ----VKLVEELKPLVKDAK------------CEVVVCPTFVCLDAV-------KKAVE--
TPIS_CLOBB        ----VKVVEELKPLVKDAT------------CDVVVCPTFVCLDAV-------KKATA--
TPIS_CLOAB        ----LKLIEELKPLVKDAK------------AEVVVAPTAVSLETV-------VNATK--
TPIS_CLOTE        ----VKLVEELIPKVKEAE------------CEVVVCPPFICLPKI-------REITE--
TPIS_BACHD        ----KAFVEEVKGAIPSSDK-----------VDSVVCSPALFLEGL-------VQKAE--
TPIS_BACAN        ----VSFVEEVKGQIPAASA-----------VDAVVCSPALFLERL-------VAATE--
TPIS_BACSU        ----VSFVEEVKSSIPAADK-----------AEAVVCAPALFLEKL-------ASAVK--
TPIS_BACLD        ----VSFVEEVKSSIPAADK-----------AEAVVCAPALFLEKL-------TSAVK--
TPIS1_LISIN       ----GQFAEDVKNNVPSSDA-----------VESVVAAPALFLQEL-------VRLTE--
TPIS1_LISMO       ----GQFAEDVKNNVPSSDA-----------VESVVAAPALFLQEL-------VRLTE--
TPIS_STAAC        ----KDFVNALP-TLPDSKE-----------VESVICAPAIQLDAL-------TTAVKEG
TPIS_STAEQ        ----KDFVNELP-TLPDPKE-----------VESVICAPTIQLDAL-------VTAVKDG
TPIS_STRT2        ----KAFVEAVASKLPSADL-----------VEAGIAVPAVDLTTV-------IAAAK--
TPIS_STRR6        ----KAFVEAVASKLPSSDL-----------VEAGIAAPALDLTTV-------LAVAK--
TPIS_STRA5        ----KAFIEAVASKLPSSEL-----------VEAGIAAPALTLSTV-------LEAAK--
TPIS_STRPF        ----KAFVEAVASKLPSTDL-----------VDVAVAAPAVDLVTT-------IEAAK--
TPIS_STRP6        ----RAFVEAVASKLPSTDL-----------VDVAVAAPAVDLVTT-------IEAAK--
TPIS_STRP8        ----KAFVEAVASKLPSTDL-----------VDVAVAAPAVDLVTT-------IEAAK--
TPIS_STRSY        ----QAFVEAIAGKLPAGDK-----------IEAAIAAPAVDLNAL-------LWFAK--
TPIS_STRMU        ----REFIDAVKNNIPSNNL-----------VDTVIGSPALFLEGM-------KKGVK--
TPIS_LACGA        ----VEFVNAVKGKLPDPSK-----------VESVIAAPAVDLYVL-------KKAAE--
TPIS_OCEIH        ----GEFMNSVVPKAPKGND-----------VEAIVCAPFPFLSKL-------VEQAK--
TPIS_SYNY3        ----QAFLQGFKPLIEDAAES----------REVVLCVPFTDLSGM-------SQQLH--
TPIS_GLOC7        ----LEFVQVFKSKIEDTDES----------REIVLCAPFTDLGAM-------SKNLH--
TPIS_THEEB        ----VAFLQEFLGELVDTPSD----------REVVLCVPYTCLSVL-------SKSLH--
TPIS_PROMA        ----KEYIDKFIPFSKEFPSD----------RHVVIAPPFTAISTL-------ASLLQ--
TPIS_PROMM        ----REYTAMFLPLIEATPND----------RHVVIAPPFTAISSM-------AESVG--
TPIS_SYNPX        ----RDYMAAFLPQIERAPQD----------REIVLAPPFTALSTM-------AAAAE--
TPIS_PROMP        ----KKYLEEFLPLIEEIPND----------RKIVIAPPFTAISTF-------SNYTN--
TPIS_AQUAE        ----EEYINTFLKFVEHPES-----------REILICPPFTSLYVA-------GKMLQ--
TPIS_TREDE        ----KQLATEMKAGLKDGKNK------------YMIAPSFTLLQDV-------ASVLK--
TPIS_TREPA        ----VALAQELVRELRGGPHT------------YMIAPSFTALDAV-------GKVLR--
TPIS_BORBU        ----SIVAKKIATEVKTLKDD----------VVIMITPPFTALSKV-------SECIK--
TPIS_LEPIN        ----VFLAHSIREKIPSISKD----------KVSMVFPSTLHLENV-------SKILE--
TPIS_FUSNN        ----VETLTQLKDLTRDVKNV----------D-IVIGAPFTCLSDA-------VKIVE--
TPIS_COREF        ----IGTVQKLAFALHKDYYE---------KVDVAVIVPFTDLRSV-------QTLVEGD
TPIS_CORGL        ----IGTVQKLAFALPKEYFE---------KVDVAVTVPFTDIRSV-------QTLVEGD
TPIS_MYCTU        ----IALVQKIAFSLPDKYYD---------RVDVAVIPPFTDLRSV-------QTLVDGD
TPIS_MYCLE        ----IALVQKIAFSLPDKYYD---------KVDVTVLPPFTDLRSV-------QTLVDGD
TPIS_STRCO        ----IAHVQKLAFALADKDYD---------AVEVAVLAPFTDLRSV-------QTLVDGD
TPIS_CUTAK        ----TSLVQDLGEALKAAGYDS-------SKSEAVVIPPFTDIRPV-------AIIIDGD
TPIS_BIFLO        ----TYFVQKLVWLLRDAHFDF-------KRCEVALFPSFTSLRSV-------QVLVEAD
TPIS_BIFAA        ----TYFVQQLAWNLRAIHFDY-------KRCEIALMPSFTSLRSV-------QVAVESD
TPIS_AGRFC        ----LDQIKAMAEGVKGALSE---------KVDALICPPSTLLYVA-------TALCDD-
TPIS1_RHIEC       ----LDQIKAIAEGVRPPLAD---------KVEALICPPTTLLYVA-------TALCTD-
TPIS_BRUSU        ----LTELRAIAAGLSSDLGR---------KLDAVICVPATLLSRA-------AETLEG-
TPIS_BARHE        ----LGELRAIAAGISSDLGR---------LFEALICVPATLLSRA-------FDILGG-
TPIS_RUEPO        ----LDALEAIAGAHSAA------------AVDLLICPPATLLYRA-------AQVAEG-
TPIS_CAUVC        ----LDEARAVAAALEAK-PP---------AARVAIFPPATLLHRL-------SQAVEG-
TPIS_HYPNA        ----LAEVERVAAEVPAS-SE---------GAETLLCLPATLIHAG-------SAKSEG-
TPIS_DEIRA        ----ARSWAEELTTKYAP-AE---------GVDLAVLAPALDLSAL-------AANLP--
TPIS_RHOBA        ----ASLAKGIVDAVGKSP-----------AVEVVLCPPSVYLSGV-------ADAVVG-
TPIS_CHLTE        ----VDLATAIAEKVGADGVQ----------CEVGIAPTFPALYEV-------CKVIEW-
TPIS_PROA2        ----VELSSAIIDQLGEVSAS----------CEVGIAPAFPALSGV-------HGVISG-
TPIS_CHLPM        ----TELASAVVAALGSDCSA----------CEAGIAPTYPALDSV-------GRTIKG-
TPIS_BACTN        ----IALAKELNEALANEKPN----------CDVIICTPFIHLASV-------TPLVDA-
TPIS_PORGI        ----LALAKELDAALKGRTIN----------CDVIIGTPFIHLASI-------AAAIDT-
TPIS_CHLPN        ----KEYVQTLASLLQGEPLS----------CTIGIASPFTSLRAI-------HEMINTT
TPIS_CHLCV        ----KDFLSIFCPFVKEISPA----------SLVGIAPAFTTLSAC-------CESIKEM
TPIS_CHLTR        ----QTFLKSFISSDILSNPQ----------IITGIIPPFTLLSAC-------QQAVS--
TPIS_PARUW        ----CTFAKALLPVVEVSP------------IQVWIAVPFTAIYPV-------KQEIR--
TPIS_MYCGE        ----VSFVEQFQQNKLNYN------------AKIGIAPVYVHLTEI-------KKIISD-
TPIS_MYCPN        ----LAFVEQFKQHPAKTK------------AVLGIAPVHVHLTEV-------NKVLPN-
TPIS_MYCGA        ----KEFFSVLNQTKLTKNPD----------VVFGVAPVFVHLGLA-------NQLERN-
TPIS_ACIB5        ----NQLIEEFKQLLQQNQIAD-------ENCHVGVAPVSIALTTV-------QAQLQDA
TPIS_ACIBS        ----NQLIEEFKQLLQQNQIAD-------ENCHVGVAPVSIALTTV-------QAQLQDA
TPIS_ACIAD        ----IQLVQQFKDLLKQQPISE-------QYCHVGVAPIAIALTTI-------QSELATA
TPIS_NEIMA        ----NSLMHRFRILP-----TA-------ERVLIGLAAPTVYLLQL-------HNAMQIV
TPIS_NEIMB        ----NALMHRFRIHP-----TA-------ERVLIGLAAPTVYLLQL-------HNAMQIV
TPIS_PSYCK        NALLDDLCAAISTTKQMSHDNS-------ARCQIMVAPSFIHLAAV-------NGRLKDT
TPIS_PSYA2        DALLNELCTAISTTKQLSHNNS-------TRCQIMVAPSFLHLAAV-------SSRLKDT
TPIS_ORITB        ----CNYLNLITSLHGNLNIA-----------KVIFAVPNLYLSGL-------KLKFND-
TPIS_UREPA        ----NHFLNNLTLFDEQK-------------IIIGLAPGDLYLKTF-------VNLAEI-
TPIS_TROW8        ----VSYLQELNWRLIDNGHDFD-------ACEIAVFPPFTDLRSV-------QTLVASD
                                                                              

TPIS_HELPY        ---------FTLGVQNAYPR--DCGAFTGEITSKHLEELKIHTLLIGHSERRT-------
TPIS_HELAH        ---------FTLGVQNAYPK--DCGAFTGEITSKHLEELKINTLLIGHSERRV-------
TPIS_WOLSU        ---------VCIGTQNAYPA--PSGAFTGEVGSEQLEELAIQTILIGHSERRG-------
TPIS_HELHP        ---------FHIGAQNAYFA--QNGGFTGEIGLSQLQEFNINRLIIGHSERRT-------
TPIS_CAMJE        ---------FIQGAQNFYPC--VNGAFTGELGKEHLDEFGIKCVLIGHSERR--------
TPIS_CAMJD        ---------FMQGAQNFYPC--VNGAFTGELGKEHLDEFGIKCVLIGHSERR--------
TPIS_CAMC5        ---------FKLGAQNFYPC--VSGAFTGEIGKAQLDEFGISSVLIGHSERRE-------
TPIS_WOLTR        ---------ISIGAQNCHYK--KSGSYTGEISAEMLKELGCTYVILGHSERTH-------
TPIS_WOLPM        ---------IDIGAQNCHHK--KFGSYTGEISAEMLKELGCTYVMLGHSERAN-------
TPIS_EHRCR        ---------IKLGAQNCFYE--SEGKYTGEVSAKMLYSCGCSYVIVGHYERRS-------
TPIS_MYCH2        ---------LEIAAQNLSQF--DSGAFTGEISGKMLQDLGTKYVIIGHSERR--------
TPIS_MYCH7        ---------LEIAAQNLSQF--DSGAFTGEISGKMLQDLGTKYVIIGHSERR--------
TPIS_MYCPU        --------NINLVAQNINEN--RSGAFTGEISAQMLKSINAKYVIVGHSERR--------
TPIS_MYCAP        ---------LKLCSQNMSKN--EEGAFTGEVSARMLQDINVSYALCGHSERRRY------
TPIS_SALTY        -------SHIMLGAQNVDLN--LSGAFTGETSAEMLKDIGAQYIIIGHSERR--------
TPIS_SALTI        -------SHIMLGAQNVDLN--LSGAFTGETSAEMLKDIGAQYIIIGHSERR--------
TPIS_SALPA        -------SHIMLGAQNVDLN--LSGAFTGETSAEMLKDIGAQYIIIGHSERR--------
TPIS_ECOLI        -------SHIMLGAQNVDLN--LSGAFTGETSAAMLKDIGAQYIIIGHSERR--------
TPIS_PHOLL        -------SRIALGAQDVDVN--LSGAFTGETSATMLKDIGAEYIIIGHSERR--------
TPIS_YERPE        -------SRIALGAQNVDVN--LSGAFTGETSAEMLKDIGAQYIIIGHSERR--------
TPIS_HAEIN        GCSCGGKSVIQLGAQNVDIN--VKGAFTGDISTEMLKDFGAKYIIIGHSERR--------
TPIS_HAEDU        ------QSTIRLGAQNVDIN--TQGAFTGDISTAMLQEFCAKYIIIGHSERR--------
TPIS_VIBCH        -----GGNKLILGAQNTDTH--NSGAYTGDMSPAMLKDFGASHIIIGHSERR--------
TPIS_VIBVY        -----GGNKIILGAQNTDIN--NSGAFTGDMSPAMLKDFGATHIIIGHSERR--------
TPIS_ALIF1        -----AGSAIILGAQNTDLN--NSGAFTGDMSPAMLKEFGATHIIIGHSERR--------
TPIS_MORMI        -----AGSAIILGAQNTDLN--NSGAFTGDMSPAMLKEFGATHIIIGHSERR--------
TPIS_BUCCC        -----DKKNFFLGAQNIDIH--FSGPFTGEISPIMLKDIGIKYVIIGHSERR--------
TPIS_WIGBR        ------KKNIFLAAQNVDVN--LTGSFTGEISPIMLYEFGVKYVIIGHSERR--------
TPIS_BUCAI        ------NMNIFLGSQNVDIN--LNGAFTGETSILMLRDIGVKYVIIGHSERR--------
TPIS_BUCBP        ------HSSILLGSQNVDIN--LIGAFTGEVSINMLKDVGVSYVLVGHSERR--------
TPIS_BLOPB        ------NSRIQLCAQNVDIH--LSGSFTGDISAEMLQDLNVRYALIGHSERR--------
TPIS_ACIAC        AIA--------LAAQDVSRH--EAGAYTGEVSAAMLQEFGVRYVLVGHSERR--------
TPIS_BORPE        AIG--------WGAQDVSAH--AKGAYTGEVAAPMLAEFGCRWVLVGHSERR--------
TPIS_RALSO        SVA--------WGAQDVSAE--TRGAFTGEVAASMLSEFGCGYAIVGHSERR--------
TPIS_NITEU        HVL--------WGGQNVSQY--HHGAYTGEVSADMLADLGCRYVIVGHSERR--------
TPIS_PSEPK        EIT--------VGAQNSAVQP-EQGALTGEVAPEQLVEAGCKLVLIGHSERR--------
TPIS_PSEAE        AID--------VGAQNSAVEP-MQGALTGETAPSQLADVGCSMVLVGHSERR--------
TPIS_PSESM        SII--------VGAQDAAIQA-EQGALTGEIASSQLADAGCKLVLVGHSERR--------
TPIS_XANCP        HLA--------FGAQDVSSN--EKGAYTGEVSASMLVDVGAEYGLVGHSERR--------
TPIS_SHESM        LVR--------MGAQNLSQH--DFGAYTGEVSGQMLKDCGCRYVIIGHSERR--------
TPIS_SHEON        LVR--------MGAQNLSQH--DFGAYTGEVSGQMLKDCGCRYVIIGHSERR--------
TPIS_SHEPC        LVR--------MGAQNLSQH--DFGAYTGEVSGQMLKDSGCRYVIIGHSERR--------
TPIS_POLNS        SLAF-----LSLGAQDASAY--GSGVYTGEVAAAMLKEFGCTCVIVGHSERR--------
TPIS_LEGPC        RIV--------VGAQNVYPK--DYGAYTGELSAPMLKDFDCRYVLVGHSERR--------
TPIS_FRATH        --------KVGVGLQNITFY--DDGAYTGEISARMLEDIGCDYLLIGHSERR--------
TPIS_ARATH        --------DFFVAAQNCWVK--KGGAFTGEVSAEMLVNLDIPWVILGHSERR--------
TPIS_HUMAN        --------KIAVAAQNCYKV--TNGAFTGEISPGMIKDCGATWVVLGHSERR--------
N4TND9_FUSC1      --------DIEVAAQNVFNK--PNGAFTGEISVSQLKDSDINWVILGHS-----------
C9SPK3_VERA1      --------GLEVAAQNVFDK--PNGAFTGEISVAQLKDIDIKWTILGHSERR--------
TPIS_CANAL        --------TVAIGAQNVFDK--SCGAFTGETCASQILDVGASWTLTGHSERR--------
TPIS_DICDI        --------KFKVCSQNCYSV--AKGAFTGEISANMLVDLGIPYVIIGHSERR--------
TPIS_CLOPE        ------GTNIKVGAQNMHFE--EKGAFTGEIAPRMLEAMNIDYVIIGHSERR--------
TPIS_CLOBB        ------GSNIKVAAQNMHFE--ESGAFTGEVAPGMLEAMGIEYVVLGHSERR--------
TPIS_CLOAB        ------GSNIKVAAQNAHFE--ESGAFTGEISLKALEELGVSYVILGHSERR--------
TPIS_CLOTE        ------GTNIKVGAQNMYFE--EKGAFTGEVSPLMLEKLNIDYVIIGHSERR--------
TPIS_BACHD        ------GTELRIGAQNMHFE--ESGAFTGEISPVALSDMKVDYVILGHSERR--------
TPIS_BACAN        ------GTDLQVGAQNMHFE--KNGAFTGEISPVALSDLKVGYVVLGHSERR--------
TPIS_BACSU        ------GTDLKVGAQNMHFE--ESGAFTGEISPVALKDLGVDYCVIGHSERR--------
TPIS_BACLD        ------GTDLKVGAQNMHFE--ESGAFTGEISPAALKDLGVEYCVIGHSERR--------
TPIS1_LISIN       ------GTNLRVAAQNCYFE--DEGAFTGEISPFALADLGVSYVIIGHSERR--------
TPIS1_LISMO       ------GTDLRVSAQNCYFE--DEGAFTGEISPFALADLGVSYVIIGHSERR--------
TPIS_STAAC        K-----AQGLEIGAQNTYFE--DNGAFTGETSPVALADLGVKYVVIGHSERR--------
TPIS_STAEQ        K-----AKGLKIGAQNAYFE--ESGAYTGETSPVALSELGVKYVVIGHSERR--------
TPIS_STRT2        ------GSNLKVAAQNTYFE--NSGAFTGETSPQVLKEIGTDYVVIGHSERR--------
TPIS_STRR6        ------GSNLKVAAQNCYFE--NAGAFTGETSPQVLKEIGTDYVVIGHSERR--------
TPIS_STRA5        ------GSELKIAAQNSYFE--NSGAFTGENSPKVLAEMGTDYVVIGHSERR--------
TPIS_STRPF        ------DSVLKVAAQNCYFE--NTGAFTGETSPKVLAEMGADYVVIGHSERR--------
TPIS_STRP6        ------DSVLKVAAQNCYFE--NTGAFTGETSPKVLAEMGADYVVIGHSERR--------
TPIS_STRP8        ------DSVLKVAAQNCYFE--NTGAFTGETSPKVLAEMGADYVVIGHSERR--------
TPIS_STRSY        ------DSELKVAAQNCYFE--DAGAFTGETSPKVLAEMGVNYVVIGHSERR--------
TPIS_STRMU        ------GTELQVAAQNCYWE--DFGAFTGETSPAALAALGVDYVIIGHSERR--------
TPIS_LACGA        ------GSDLHTGAENAYFE--VEGAFTGETSPKVLNEMGIDYCIIGHSERR--------
TPIS_OCEIH        ------GSEVKVAAQNMHFE--DSGAFTGEVSPVMLKDLGVTHVVLGHSERR--------
TPIS_SYNY3        ------GGRVRLGAQNVHWE--ASGAYTGEISAAMLTEIGIHYVVIGHSERR--------
TPIS_GLOC7        ------GSRIKLGAQNVHWE--EAGAYTGEISGAMLTEIGVSYVIVGHSERR--------
TPIS_THEEB        ------GTRVKLGAQNVHWA--DQGAFTGEISPPMLVELGVRYVIIGHSERR--------
TPIS_PROMA        ------GTNIQLSSQNVHWE--DTGAFTAEISPSMLLEHDVRYAIVGHSEPR--------
TPIS_PROMM        ------GTRLELSSQNVHWE--DDGAYTAEVSPTMLLEHQVRYAIVGHSEPR--------
TPIS_SYNPX        ------HSVVGLASQNVHWQ--DHGAFTAEISAEMLLEHGVAYTIVGHSEPR--------
TPIS_PROMP        ------FDYLNIASQNIHWE--DKGAFTAEISPNMLIEHKVKYAIVGHSEPR--------
TPIS_AQUAE        ------GTGVKLGAQNCHYE--KRGAFTGEISIPMLQEVGCEYVIVGHSERR--------
TPIS_TREDE        ------GSNILLGAQNMGLE--EKGAHTGEVSVLQLLDVGVQAVILGHSERR--------
TPIS_TREPA        ------GSNVLLGAQDVSSE--EWGAHTGEVSVLQLEDLGVQVVIVGHSERR--------
TPIS_BORBU        ------GSNILLGAQNMSYM--ESGARTSEISPSMLLEFGVEYVILGHSECR--------
TPIS_LEPIN        ------GSSVIVGAQNCYHS--GLAAFTGETSPDQLKEIGVKVVMVGHSERR--------
TPIS_FUSNN        ------GSNVKIAAENVYPK--IEGAYTGEVSPKMLKDIGVTYVILGHSERR--------
TPIS_COREF        ------KLQITYGAQDVSQH--ESGAYTGEVSASMLAKLNCSWVVVGHSERR--------
TPIS_CORGL        ------KLEVTFGAQDVSQH--ESGAYTGEVSASMLAKLNCSWVVVGHSERR--------
TPIS_MYCTU        ------KLRLTYGAQDLSPH--DSGAYTGDVSGAFLAKLGCSYVVVGHSERR--------
TPIS_MYCLE        ------KLRLTYGAQDLSQH--DLGAYTGDISGAFLAKLGCSFVLVGHSERR--------
TPIS_STRCO        ------KLKIKYGAQDISAH--DGGAYTGEISGPMLAKLKCTYVAVGHSERR--------
TPIS_CUTAK        ------KLPIAYGAQDISAH--DDGAYTGEVSGAMLSKLGCRYVVVGHSERR--------
TPIS_BIFLO        ------KLHVAYGAQSVSVT--TQGAFTGDVSADMIAHLGCSYVIVGHSERR--------
TPIS_BIFAA        ------NLKIRYGAQAVSVT--SQGAFTGDVSADMIAHLGCSYVIVGHSERR--------
TPIS_AGRFC        -------SPLLIGAQDCHQN--DTGAHTGDISAEMIADCFGTHVIVGHSERR--------
TPIS1_RHIEC       -------SPLAIGAQDCHQK--PSGAHTGDISAEMIADSFGTYVIVGHSERR--------
TPIS_BRUSU        -------ETVGLGGQDAHFK--TSGAHTGDISPEMLKEAGATHVILGHSERR--------
TPIS_BARHE        -------ENILLGGQNCHFD--DYGPYTGDISAFMLKEAGASHVIIGHSERR--------
TPIS_RUEPO        -------SRVRIGGQDCHAV--TAGAHTGDISAMMLADAGASAVILGHSERR--------
TPIS_CAUVC        -------AHLLTGGQDCHGK--SSGAHTGDVSAEMVADAGGSLVICGHSERR--------
TPIS_HYPNA        -------SGLKIGGETCHAN--EKGAHTGDLAAEMLKDAGASYVIVGHSERR--------
TPIS_DEIRA        -------AGIAFGGQDVSAH--ESGAYTGEISAAMLKDAGASCVVVGHSERR--------
TPIS_RHOBA        -------TPVELGAQNLYAA--EDGAFTGEVNASMLTDVGCRFVILGHSERR--------
TPIS_CHLTE        -------SGIRLCAQNCHYE--SDGPFTGEVSTRMLAAAGCSYVILGHSERR--------
TPIS_PROA2        -------TGIHLAAQNCHYE--DDGAFTGEVSVRMLDEAGCSYVIVGHSERR--------
TPIS_CHLPM        -------SEVLLVAQNCHYE--DDGAFTGEVSTGMLNALGCSYVIIGHSERR--------
TPIS_BACTN        -------AKIGVGAENCADK--ASGAYTGEVSAEMVASTGAKYVILGHSERR--------
TPIS_PORGI        -------TRIGVAAENCADK--ESGAYTGEVSAAMVASTGARYVIIGHSERR--------
TPIS_CHLPN        ------GAFLWLGAQNVHPE--LSGAFTGEISLPMLKEVGVEFVLVGHSERR--------
TPIS_CHLCV        ------DSSIWLGAQNVHQD--SSGAFTGEVSLPMLQEFHVNFVLLGHSECR--------
TPIS_CHLTR        ------DSPIFLGAQTTHEA--DSGAFTGEISAPMLKDIGVDFVLIGHSERR--------
TPIS_PARUW        ------NSRLVIGAQNMNDA--SEGAFTGEIAGKMVKEAGASFVLLGHSERR--------
TPIS_MYCGE        --------SLLLFAQDANFI--ESGSYTGTVSFTQLQDIGVNNSIIGHSERR--------
TPIS_MYCPN        --------NLLLLAQDANFI--ASGSYTGTVSYTQLQDIKVNSVIIGHSERR--------
TPIS_MYCGA        --------ECLVLAQDANYV--MNKANTGTVSYEQLKDIGVNYVIIGHSERR--------
TPIS_ACIB5        -----ARTVHTVAQDVSRVAG-T-GAYTGEVSAELLKDSQINFVLVGHSERR--------
TPIS_ACIBS        -----ARTVYTVAQDVSRVAG-T-GAYTGEVSAELLKDSQINFVLVGHSERR--------
TPIS_ACIAD        -----NRQVATVAQDVSRFAG-T-GAYTGEISAELLTDSQIRYVLIGHSERR--------
TPIS_NEIMA        L----NNRILTCAQDVSRFPD-N-GAYTGEVSAEMLADTGTDIVLIGHSERS--------
TPIS_NEIMB        L----NNRILTCAQDVSRFPN-N-GAYTGEVSAEMLADTGTDIVLIGHSERS--------
TPIS_PSYCK        -------SILCAAQDVSGHSA-SVGAYTGDCSAQQIVDAGATWTILGHSERR--------
TPIS_PSYA2        -------SVLCAAQDVSAYSA-SVGAYTGDCSAQQIADVGATWTILGHSERR--------
TPIS_ORITB        --------TYHFSAQDVSMITESSGPYTGEISASMLKNLNVNYAIVGHSERR--------
TPIS_UREPA        -------KKVNLYAQNPSLHN--KGPYTGQISCLQLLDINIKNALVGHSEIR--------
TPIS_TROW8        ------DIQISYGAQDVSAF--SDGAHTGQISAQFLKDLDCKYVLIGHSEQRCLPCYPGN
                                :            *.      :          **            

TPIS_HELPY        ------LLKESPSFLKEKFDFFKSKNFK-IVYCIGEELTT----------REKGFKAVKE
TPIS_HELAH        ------LLKESPNFLKEKFDFFKDKKFK-IVYCIGEDLKT----------REKGLGAVKE
TPIS_WOLSU        ------ILGESQAFCAEKFRYYASLGYT-IFYCIGESLEV----------RRAGIEATIR
TPIS_HELHP        ------LFGENQDFINKKFRFYAEAGFE-IYYCIGEPLSM----------RQKGKNALKD
TPIS_CAMJE        ------ALGDEE-FIKAKFDFAKEHGYK-IVFCIGENLDT----------KNSG--KTLE
TPIS_CAMJD        ------ALGDEE-LIKVKFNFAKEHGYK-IIFCIGENLDT----------KNSG--KTLE
TPIS_CAMC5        ------ILGESERLLRAKFDFAAKNGWQ-IIYCVGENLSV----------NEAG--GTKE
TPIS_WOLTR        ---------ETNGEIKLKSETAIESGLH-PIICVGENLED----------RESS--KTKE
TPIS_WOLPM        ---------EKDSEIKLKSEIAIESGLH-PIICVGENSED----------YKNE--KTKE
TPIS_EHRCR        ------IFYESDYCVQLKAKSAIDAGLI-PIICIGETLLD----------RENG--MLKN
TPIS_MYCH2        -----EIFKEKDEELKNKILQAQKYDLI-PVFCVGESLLE----------FEAGLTKKVI
TPIS_MYCH7        -----EIFKEKDEELKNKILQAQKYDLI-PVFCVGESLLE----------FEAGLTKKVI
TPIS_MYCPU        -----QNYRETNKIVNQKAKAAIENGLI-PIICVGESLEE----------YEAGKTKAVI
TPIS_MYCAP        -----HTNHENDESTHLKIKQSVKYDIT-PIICIGESKED----------RDAGRTEAAI
TPIS_SALTY        -----TYHKESDELIAKKFAVLKEQGLT-PVLCIGETEAE----------NEAGKTEEVC
TPIS_SALTI        -----TYHKESDELIAKKFAVLKEQGLT-PVLCIGETEAE----------NEAGKTEEVC
TPIS_SALPA        -----TYHKESDELIAKKFAVLKEQGLT-PVLCIGETEAE----------NEAGKTEEVC
TPIS_ECOLI        -----TYHKESDELIAKKFAVLKEQGLT-PVLCIGETEAE----------NEAGKTEEVC
TPIS_PHOLL        -----TYHQESDEFIAKKFAILKQQGLI-PVLCIGETEQE----------NEAGQTESVC
TPIS_YERPE        -----TYHQESDELIAKKFGVLKEIGLI-PVLCIGESEAE----------NEAGQTEAVC
TPIS_HAEIN        -----TYHKESDEFVAKKFGALKEAGLV-PVLCIGESEAE----------NEAGKTEEVC
TPIS_HAEDU        -----TYHAESDQFIAKKFAALKTAGLT-PVLCIGETEAE----------NEAGQTQQVC
TPIS_VIBCH        -----DYHKESDEFVAKKFAFLKENGLT-PVFCIGETEAQ----------NEAGETEAVC
TPIS_VIBVY        -----EYHNESDEFVAKKFAFLKENGLK-PVFCIGETEAQ----------NEAGETEAVC
TPIS_ALIF1        -----EYHNESDEFVAKKFAFLKENGLT-PVLCIGESEAQ----------NEAGETVAVC
TPIS_MORMI        -----EYHAESDEFVAKKFAFLKENGLT-PVLCIGESDAQ----------NEAGETMAVC
TPIS_BUCCC        -----LNHKETNEIIAKKFCMLKEENLV-PILCIGETKKE----------KIDKKTKDIC
TPIS_WIGBR        -----LYHNESIEDVTKKFLILKKFNLI-PVLCIGETKKN----------KDDKCIENEI
TPIS_BUCAI        -----FLHHETDDIIAKKFHLIKKSNLT-PILCVGETEIE----------KKHNQTEQVI
TPIS_BUCBP        -----QYHRENDVIIAKKFKIVKDSHLI-PVLCIGETEHE----------YLSCKTEKIC
TPIS_BLOPB        -----IHHKENDAYIAKKFFILKKVGLI-PILCVGENKRE----------YDSGYTQSVC
TPIS_ACIAC        -----QYHGETDEQVAEKAQRALAAGIT-PVVCVGETLAE----------REAGQTEAVV
TPIS_BORPE        -----TLHAESDQLVADKARAALEAGLT-PVVCVGESLQE----------REGGNTLGVI
TPIS_RALSO        -----TYHGETDAQVAIKALRALEHGIT-PIVCVGETLAQ----------REAGETELVV
TPIS_NITEU        -----TLFGEGNQVVAEKFRAAQERSIT-PILCVGETLAQ----------RESDETEQVI
TPIS_PSEPK        -----QIIGETDEVLNRKFAAAQAKGLK-PVLCIGETLEE----------REAGKTLEVV
TPIS_PSEAE        -----LILGESDEVVSRKFAAAQSCGLV-PVLCVGETRAE----------REAGKTLEVV
TPIS_PSESM        -----QLIGEQDEVLNKKFAAIQASGLT-PVLCIGETLEE----------RKAGQTLEVV
TPIS_XANCP        -----QYHQESSELVARKFAAAMHAGLI-PVLCVGESLEQ----------REAGQTEAIL
TPIS_SHESM        -----RMYGETSNIVAEKFAAAQKHGLT-PILCVGESGPA----------REARRTFEVI
TPIS_SHEON        -----RMYGETSNIVAEKFAAAQKHGLT-PILCVGESGPA----------REARRTFEVI
TPIS_SHEPC        -----RMYGETSNIVAEKFAAAQKHGLT-PILCVGESGPA----------REARRTFEVI
TPIS_POLNS        -----QMHQEVDEVIASKALQVLDNSMT-PVICVGETADE----------RNSGRAQEIV
TPIS_LEGPC        -----QFFHEDENFVAQKFHHVKDHGMI-PILCVGETLSE----------RENGKTEQII
TPIS_FRATH        -----SLFAESDEDVFKKLNKIIDTTIT-PVVCIGESLDD----------RKSGKLKQVL
TPIS_ARATH        -----AILNESSEFVGDKVAYALAQGLK-VIACVGETLEE----------REAGSTMDVV
TPIS_HUMAN        -----HVFGESDELIGQKVAHALAEGLG-VIACIGEKLDE----------REAGITEKVV
N4TND9_FUSC1      -----------------------------VIWCCGETLET----------REAGKTIDFV
C9SPK3_VERA1      -----TIIRESDEVVASKTKYATEEGVS-VIWCCGESLEE----------REAGTTVDVV
TPIS_CANAL        -----TIIKESDEFIAEKTKFALDTGVK-VILCIGETLEE----------RKGGVTLDVC
TPIS_DICDI        -----NVFSESSELITKKTKYAISLGLT-VILCLGELLAD----------RKSNNTEHIL
TPIS_CLOPE        -----EYFNETDETCNKKVKAAFAHNLT-PILCCGETLEQ----------RENGTTNDVI
TPIS_CLOBB        -----EYFNETDEAINKKVKAAFAHNIT-PIVCCGETLEQ----------RESGVTNNFI
TPIS_CLOAB        -----QYFNETDCALNKKVKAAFAHNIT-PILCCGETLEE----------REANVTNEVT
TPIS_CLOTE        -----QYFKETDQTVNKKLKAAFEHNLI-PILCVGETLDE----------KENGVTEEVV
TPIS_BACHD        -----DMFAETDELVNKKTHAAFAHGLT-PIVCVGETLEE----------REANQTYDVV
TPIS_BACAN        -----EMFAETDESVNKKTIAAFEHGLT-PIVCCGETLEE----------RESGKTFDLV
TPIS_BACSU        -----EMFAETDETVNKKAHAAFKHGIV-PIICVGETLEE----------REAGKTNDLV
TPIS_BACLD        -----EMFAETDETVNKKAHAAFKYGIV-PIICVGETLEE----------REANKTNELV
TPIS1_LISIN       -----EYFHETDEDINKKAHAIFKHGMT-PIICCGETLDQ----------REAGQTDTWV
TPIS1_LISMO       -----EYFHETDEDINKKAHAIFKHGMT-PIICCGETLDQ----------REAGQTDTWV
TPIS_STAAC        -----ELFHETDEEINKKAHAIFKHGMT-PIICVGETDEE----------RESGKANDVV
TPIS_STAEQ        -----DYFHETDEEVNKKAHAIFNHGMT-PIICVGESDEE----------REAGKANKIV
TPIS_STRT2        -----DYFHETDEDINKKAKAIFANGMI-PIICCGESLET----------YEAGKAAEFV
TPIS_STRR6        -----DYFHETDEDINKKAKAIFANGML-PIICCGESLET----------YEAGKAAEFV
TPIS_STRA5        -----DYFHETDQDINKKAKAIFANGLT-PIICCGESLET----------YEAGKAVEFV
TPIS_STRPF        -----DYFHETDEDINKKAKAIFANGLT-PIVCCGESLET----------YEAGKAVEFV
TPIS_STRP6        -----DYFHETDEDINKKAKAIFANGLT-PIVCCGESLET----------YEAGKAVEFV
TPIS_STRP8        -----DYFHETDEDINKKAKAIFANGLT-PIICCGESLET----------YEAGKAAEFV
TPIS_STRSY        -----DYFHETDEDINKKAHAIFRNGLT-PIICCGESLET----------YEAGKAVEFV
TPIS_STRMU        -----DYFHETDQEINKKAHAIFKHKMT-PILCCGESLET----------YEAGKTAEWI
TPIS_LACGA        -----GYFHETDEDINKKAKALFANGVT-PIICCGESLET----------REANKQEDWV
TPIS_OCEIH        -----ELFAETNELVNKKTKAAFAHDLT-PIVCVGETLDQ----------REANETMNIV
TPIS_SYNY3        -----QYFGETDETANLRVLAAQKAGLI-PILCVGESKAQ----------RDAGETEQVI
TPIS_GLOC7        -----QYFGDTDETVNLRVLAAQKYGLI-PILCVGESKSQ----------RDAGETEKII
TPIS_THEEB        -----QYFGETDATVNQRLRAAQSHGLT-PILCVGETKAQ----------RAAGETENHI
TPIS_PROMA        -----KYFSESDEQINLRARSAQSNGLI-PIVCVGESIEQ----------RERGEAERVI
TPIS_PROMM        -----KYFSESDEQINRRARSAQAHGLI-PIVCVGESDEQ----------RERGEAERVI
TPIS_SYNPX        -----KYFSESDEQINHRARCSQAKGLI-PIVCVGESDEQ----------RERGEAERVI
TPIS_PROMP        -----KYFSESDEQINKRAVFAQSSGLT-PIVCVGETLEQ----------RERGEADRVI
TPIS_AQUAE        -----HIFGESDELIHKKIVACLEMGIR-PILCVGEKKEE----------REAGMTFKVI
TPIS_TREDE        -----HIYKETDDLINKKVKLALKHGLE-VILCVGELLEE----------REAGHAEAVC
TPIS_TREPA        -----HGRGENDKLINQKVRRVLESGLR-VILCVGERLQE----------YEAGCTNEVV
TPIS_BORBU        -----LYLAETDEIINKKILAGLKHPFKYLILCVGETLDE----------RDSGKTLEVV
TPIS_LEPIN        -----QFLGESNFFCNDKIRFLLKNEFT-VLYCVGETLSE----------RESGKTLEVL
TPIS_FUSNN        -----EYFKESDEFINQKVKAVLEIGMK-PILCIGEKLED----------REGGKTLEVL
TPIS_COREF        -----EYHNETDELVAAKAKAALSKGIS-PIVCVGEPLEI----------REAGTHVDYV
TPIS_CORGL        -----EYHNESDELVAAKAKAALSNGIS-PIVCVGEPLEI----------REAGTHVEYV
TPIS_MYCTU        -----TYHNEDDALVAAKAATALKHGLT-PIVCIGEHLDV----------REAGNHVAHN
TPIS_MYCLE        -----TYHDEGDALVAAKTAAALKNSLT-PIVCIGEYLEI----------REVGEHVSHC
TPIS_STRCO        -----QYHAETDEIVNAKVKAAYKHGLT-PILCVGEELDV----------REAGNHVEHT
TPIS_CUTAK        -----EYHNESDELVNAKAKKVIENGMT-PIICCGEALEV----------RKAGKHVEHT
TPIS_BIFLO        -----KYHPEDDANIVDQVRAVLAAGMQ-PILCVGESFEE----------RRQGIELDFA
TPIS_BIFAA        -----KYHPEDDANIVDQVRAVLAAGMQ-PILCVGESYEE----------RRKGIELDFA
TPIS_AGRFC        -----TDHAETDHLVRAKASAAHQVDLI-AIVCIGETADE----------RKAGQTLDIL
TPIS1_RHIEC       -----TDHAETDHLVRAKAEAAFAAELT-AIICIGETADE----------RRAGQELDVI
TPIS_BRUSU        -----TDHHESNKLICAKTEAAWAAGLV-AIVCVGETASE----------RKAERALDVI
TPIS_BARHE        -----TVYQESDAIVRAKVQAAWRAGLV-ALICVGETLEE----------RKSNKVLDVL
TPIS_RUEPO        -----ADHGETDAQVCDKARAALEAGLI-AIICIGETLAQ----------REAGQTLDVV
TPIS_CAUVC        -----TDHGETSAQVAGKAEAAAAAGLE-PIVCVGETLET----------REAGQAVSFV
TPIS_HYPNA        -----ADHGETDAVVAAQASAALRAGIT-PIICVGETLDQ----------RDAGEVLTVI
TPIS_DEIRA        -----EYHDESDAXVAAKARQAQANGLL-PIVCVGENLDV----------RERGEHVPQT
TPIS_RHOBA        -----QLMGETDACVAKKLHAALAGNLV-PIVCVGETLEQ----------READDTESVI
TPIS_CHLTE        -----QLFGETNATVNLKVKKALAEGLS-VILCVGETLDE----------RERGVTGQIV
TPIS_PROA2        -----QYFGDTNPVVNLKVKKALSAGLN-VILCVGETLDE----------REKGITTEVV
TPIS_CHLPM        -----QYFGETDATVNLRIKKVLAAGMK-AILCVGETLEE----------RESGAFEAVV
TPIS_BACTN        -----AYYGETVAILEEKVKLALANGLT-PIFCIGEVLEE----------REANKQNEVV
TPIS_PORGI        -----AYYHETSPILMEKVKLALSNGLT-PIFCVGEVLEE----------REAGKHFEVV
TPIS_CHLPN        -----HIFGESDAFIASKVKSVAQAGLV-PVLCVGESLEV----------REEGKAHQVI
TPIS_CHLCV        -----HIFHEEDATIALKVGAAARSGVV-PVLCIGETLEA----------RENGTTKEVL
TPIS_CHLTR        -----HIFHEQNPVLAEKAAAAIHSGMI-PVLCIGETLEE----------QESGATQDIL
TPIS_PARUW        -----HLYKEDNAFINRKVKKALEIGLT-PVLCVGETFEE----------RKSGETQQII
TPIS_MYCGE        -----KYYNETSAVINQKLFACLKASMQ-VVLCIGEAL---------------GQEISFL
TPIS_MYCPN        -----KYFNETAQVINQKLKACLQAGML-VVLCIGETE---------------GQPISFL
TPIS_MYCGA        -----KLFHESDELINQKVKTLLENKMR-PILCIGETLEE----------YEANKTKAVL
TPIS_ACIB5        -----DIFGDNVEILKAKLQNALNAGMT-VIYCVGESLEQ----------REQGQAEQVV
TPIS_ACIBS        -----DIFGDNVEILKAKLQNALNAGMT-VIYCVGESLEQ----------REQGQAEQVV
TPIS_ACIAD        -----DLLGDHVEILKAKLSHALNAGMT-VIYCVGESLEQ----------REQGLAEQIV
TPIS_NEIMA        -----LYFGEKNEIQRRKMENVLNVGLI-PLLCVGESLEE----------REAGKEHEVI
TPIS_NEIMB        -----LYFGEKNEIQRRKMENVLNVGLI-PLLCVGESLEE----------REAGKEHEVI
TPIS_PSYCK        -----QYHQESNDTLLQKMIHALSQDLG-VVFCIGESQAQ----------YDTKQTLEVI
TPIS_PSYA2        -----QYHQESNDTLLQKMTHALTQELG-VVFCIGETQAQ----------YDAKQTLPVI
TPIS_ORITB        -----LLFYEDANTIASKVRNCINNAIV-PIVCIGEPIEA----------RKNKTYLQYI
TPIS_UREPA        -------IDFSQSIIDQKIKISMDLLEQ-VIICVGETFDA----------YKQNKSLNFV
TPIS_TROW8        NSAINELNNKHDGLIANKLLRSFAAGIC-PILCIGDISPGDHFDATLSRFRSVLSHLKAI
                                                  * *:                        

TPIS_HELPY        FLSEQLENIDLNYP---------NLVVAYEPIWAIGTKKSASLEDIYLTHGFLKQILNQK
TPIS_HELAH        FLNEQLENIDLDYQ---------NLIVAYEPIWAIGTGKSASLEDIYLTHGFLKQHLNQK
TPIS_WOLSU        HNLSQLEGIDLSYP---------KLIIAYEPIWAIGTGVSASLEQIQETHAALKAHLS--
TPIS_HELHP        FLGAQLDGIDITYP---------KLIIAYEPIWAIGTGESATLEQIESTHSMLATFTS--
TPIS_CAMJE        FLKKQLEIIDLNYE---------KLIIAYEPIYSIGTGVSAQSTDIAKVLEFLASLTK--
TPIS_CAMJD        FLKKQLEIIDLNYE---------KLIIAYEPIYSIGTGVSAQTADIAKVLEFLASLTK--
TPIS_CAMC5        FLRTQLGNIDTGYA---------NLIVAYEPIWAIGTGKSASAEQIAEILGFLRTLTL--
TPIS_WOLTR        VVEYQCKSRLPIHG---------EYTVAYEPIWAIGTGHVPSNNAIAEVIEVIQSYTS-K
TPIS_WOLPM        VIEYQCKNRLPTHG---------EYTVAYEPIWAIGTGHVPNNDAIAKVIEVIKLCTS-K
TPIS_EHRCR        ALLDQCYNSFPKHG---------EFVIAYEPVWAIGSNTIPSIDMITESLDIIRSYDS-K
TPIS_MYCH2        ISQINAIKSVLNFQ---------KAIIAYEPIWAIGTGKTATAAIAEKVCGLIKENFGKN
TPIS_MYCH7        ISQINAIKSVLNFQ---------KAIIAYEPIWAIGTGKTATAAIAEKVCGMIKENFGKD
TPIS_MYCPU        KKQIKQSLEALDLS---------KIVVAYEPIWAIGTGKVATAEVAQQICKFIRSITSKD
TPIS_MYCAP        HKQLQILLDEVNIH---------KVIIAYEPVWSIGTGITPTPEEVENVSALIHKLTSPE
TPIS_SALTY        ARQIDAVLKTQGAA------AFEGAVIAYEPVWAIGTGKSATPAQAQAVHKFIRDHIA-K
TPIS_SALTI        ARQIDTVLKTQGAA------AFEGAVIAYEPVWAIGTGKSATPAQAQAVHKFIRDHIA-K
TPIS_SALPA        ARQIDAVLKTQGAA------AFEGAVIAYEPVWAIGTGKSATPAQAQAVHKFIRDHIA-K
TPIS_ECOLI        ARQIDAVLKTQGAA------AFEGAVIAYEPVWAIGTGKSATPAQAQAVHKFIRDHIA-K
TPIS_PHOLL        ARQIDAVLNTLGVA------AFQGAVIAYEPVWAIGTGKSATPAQAQAVHKFIRDHIA-Q
TPIS_YERPE        AKQLDAVLNTLGVK------AFEGAVIAYEPIWAIGTGKSATPAQAQAVHKFIRDHIA-K
TPIS_HAEIN        ARQIDAVINALGVE------AFNGAVIAYEPIWAIGTGKSATPAQAQAVHAFIRGHIA-A
TPIS_HAEDU        ARQIDAIINSLGVE------AFNQAVIAYEPIWAIGTGKSATPAQAQAVHAFIRQHIA-E
TPIS_VIBCH        ARQINAVIDAYGVE------ALNGAIIAYEPIWAIGTGKAATADDAQRIHASIRALIA-A
TPIS_VIBVY        ARQINAVIDAYGVE------ALNGAIIAYEPIWAIGTGKAATAEDAQRIHASIRAMIA-A
TPIS_ALIF1        ARQIDAVINTQGVD------ALNGAIIAYEPIWAIGTGKAATAEDAQRIHAQIRAHIA-E
TPIS_MORMI        ARQLDAVINTQGVE------ALEGAIIAYEPIWAIGTGKAATAEDAQRIHAQIRAHIA-E
TPIS_BUCCC        KKQIDIIFNMYGSN------AFDNSIIAYEPIWSIGSGNSAAPKEVQCIAHFIRNYVK-S
TPIS_WIGBR        VKQIDFILKKIGIE------GFINTVIAYEPTWAIGKKDSASPKYIQKIHKFIRNYLS-K
TPIS_BUCAI        QRQLNLILKNLGTS------AFKNIIIAYEPIWAIGTGVSADPEHVQLIHVFIKNYIL-K
TPIS_BUCBP        KFQIDAIFDLLGPS------GFNNSVIAYEPKWAIGTNTIPSINFIQKILMFIQNYIF-N
TPIS_BLOPB        INQINTIITLLGIE------AFKNSVIAYEPIWAIGSGASASPENAQLVHKSIRDYIA-S
TPIS_ACIAC        KRQLAAVIH-LNGH------CISETVVAYEPVWAIGTGRTATPEQAQQVHAVLRAQLA-A
TPIS_BORPE        ERQLEPVLA-LGRD------ALVRMVLAYEPVWAIGTGRTASPEQAQEVHSAIRVALD-G
TPIS_RALSO        ARQLEAVLESLSVE------QLGHIVVAYEPVWAIGTGKTATSEQAQAVHAFLRGRVA-A
TPIS_NITEU        AMQLDAVIDLAGIE------ALGQSVIAYEPVWAIGTGKTATPQQAQDVHKFIRSRIA-V
TPIS_PSEPK        GRQLSSIIEAFGVK------AFADAVIAYEPVWAIGTGLTATPQQAQDVHAAIRGQLA-A
TPIS_PSEAE        ARQLGSVIDELGVG------AFARAVVAYEPVWAIGTGLTASPAQAQEVHAAIRAQLA-A
TPIS_PSESM        GRQLDSVIAEFGIG------ALVNAVIAYEPVWAIGTGLTASPQEAQEVHAAIRAQLA-K
TPIS_XANCP        RAQLEPVLSLVGSA------GFARAVVAYEPIWAIGTGRTATPDQAQAVHAFIRGEVA-K
TPIS_SHESM        AEELDIVIQKNGTM------AFDNAIIAYEPLWAVGTGKSATPEQAQEVHAFIRKRLS-E
TPIS_SHEON        AEELDIVIQKNGTM------AFDNAIIAYEPLWAVGTGKSATPEQAQEVHAFIRKRLS-E
TPIS_SHEPC        AEELDIVIQKNGTM------AFDNAIIAYEPLWAVGTGKSATPEQAQEVHAFIRKRLS-E
TPIS_POLNS        CSQVAKQVG-VLQD------RLVDCLIAYEPVWAIGTGKVASAQVAQDMHRAIRLQLA-E
TPIS_LEGPC        AQQVLAVSA-KGKD------CFRDCVVAYEPVWAIGTGKTATPEQAQKIHQFIRDLVG-E
TPIS_FRATH        ATQLSLILENLSVE------QLAKVVIAYEPVWAIGTGVVASLEQIQETHQFIRSLLA-K
TPIS_ARATH        AAQTKAIAD--RVT------NWSNVVIAYEPVWAIGTGKVASPAQAQEVHDELRKWLAKN
TPIS_HUMAN        FEQTKVIAD--NVK------DWSKVVLAYEPVWAIGTGKTATPQQAQEVHEKLRGWLKSN
N4TND9_FUSC1      SKQLESLKS--QIS------DWSNIVIAYEPIWAIGTGKVATTEQAQEVHKAIRDLLR-G
C9SPK3_VERA1      SKQLAALKA--KIS------DWSKVVIALRAHLGHWHRQVATTEQAQEVHAAIRAWLKKE
TPIS_CANAL        ARQLDAVSK--IVS------DWSNIVVAYEPVWAIGTGLAATPEDAEETHKGIRAHLAKS
TPIS_DICDI        SEQLKDFASF-TPE------EWSKIVIAYEPVWAIGTGAVATPQEAQDTHVFIRKWISEK
TPIS_CLOPE        KAQITADLEGLTKE------QAEKVVIAYEPIWAIGTGKTATSDQANETIAAIRAMVAEM
TPIS_CLOBB        ACQIKVDIAGLTKE------QAEKVVIAYEPIWAIGTGKTATKEQANETILAIRNVVVEM
TPIS_CLOAB        GKQIKLDLAGLSAE------QAAKVVIAYEPIWAIGTGKTATDEQANETIGAIRKTVEVM
TPIS_CLOTE        SKQVKLGLFELKEE------QVEKLVIAYEPIWAIGTGKTATSEEANEVIALIRSTVKSL
TPIS_BACHD        KTQVEKGLEGLTDE------QVKVTVIAYEPVWAIGTGKSSSAEDANDVCSYIRKVVTEK
TPIS_BACAN        AGQVTKALAGLTEE------QVKATVIAYEPIWAIGTGKSSSSADANEVCAHIRKVVAEV
TPIS_BACSU        ADQVKKGLAGLSEE------QVAASVIAYEPIWAIGTGKSSTAKDANDVCAHIRKTVAES
TPIS_BACLD        ADQVKKALAGLTTE------QVAASVIAYEPIWAIGTGKSSTAQDANEVCAHIRKTVASE
TPIS1_LISIN       RGQIRAALAGLTEE------QVIKSVIAYEPIWAIGTGKSSTSADANETCAVIRAEVADA
TPIS1_LISMO       RGQIRAALAGLTEE------QVIKSVIAYEPIWAIGTGKSSTSADANETCAVIRAEVADA
TPIS_STAAC        GEQVKKAVAGLSED------QLKSVVIAYEPIWAIGTGKSSTSEDANEMCAFVRQTIADL
TPIS_STAEQ        GNQVKKAVEGLSDD------QLKEVVIAYEPIWAIGTGKSSTSEDANEMCAHVRQTLADL
TPIS_STRT2        GAQVSAALAGLTPE------QVASSVIAYEPIWAIGTGKSASQDDAQKMCKVVRDVVAAD
TPIS_STRR6        GAQVSAALAGLTAE------QVAASVIAYEPIWAIGTGKSASQDDAQKMCKVVRDVVAAD
TPIS_STRA5        GAQVSAALAGLSEE------QVSSLVIAYEPIWAIGTGKSATQDDAQNMCKAVRDVVAAD
TPIS_STRPF        GAQVSAALAGLSAE------QVASLVLAYEPIWAIGTGKSATQDDAQNMCKAVRDVVAAD
TPIS_STRP6        GAQVSAALAGLSAE------QVASLVLAYEPIWAIGTGKSATQDDAQNMCKAVRDVVAAD
TPIS_STRP8        GAQVSAALAGLSAE------QVASLVLAYEPIWAIGTGKSATQDDAQNMCKAVRDVVAAD
TPIS_STRSY        GAQVSAALKDLTAD------QVASLVIAYEPIWAIGTGKSATKDDAQNMCKAVRDVVAAD
TPIS_STRMU        EGQITADLKGLSAE------QVSSMVIAYEPIWAIGTGKSADANIADDICGVVRATVEKL
TPIS_LACGA        VAQIKAALDGLTAE------QVSKLVIAYEPIWAIGTGKTASADQAEEMCKTIRETVKDL
TPIS_OCEIH        GEQVKQAVAGLTNE------QVAETIIAYEPVWAIGTGKTATSEQANEVCTEIRKVVAEV
TPIS_SYNY3        VDQVKKGLVNVDQ---------SNLVIAYEPIWAIGTGDTCAATEANRVIGLIREQLTNS
TPIS_GLOC7        INQLKRDLVDVDQ---------NKLVIAYEPIWAIGTGDTCESSEANRVIGIIREQLTNK
TPIS_THEEB        FQQLALDLVDVDQ---------TNLVIAYEPIWAIGTGDTCEETEANRVIGLIRSQLHNP
TPIS_PROMA        RRQVEQGLEQTDL---------TKLVIAYEPIWAIGTGKTCESNEANRICGLIREWAGFS
TPIS_PROMM        RRQVEQGLEDTDP---------DKLVVAYEPIWAIGTGKTCEASEANRICGLIRRWVGAS
TPIS_SYNPX        RRQIEQGLEGLDA---------NKLVVAYEPIWAIGTGKTCEAAEANRICGLIRSWVGAT
TPIS_PROMP        TRQVEQGLENTDP---------SNLIVAYEPIWAIGTGKTCEASDANKICALIRSLIGFS
TPIS_AQUAE        ETQIKLALTGVEE-------HTDKIDIAYEPVWAIGTGTPATPEDAVEVHTFIRNLINQL
TPIS_TREDE        ERQIKKGLAEVSAK------DLDKVTIAYEPVWAIGTGKNASPEDADAIHSSIRKTLAAL
TPIS_TREPA        GTQVRAGMADVCGS------LMHNVTVAYEPVWAIGTGKTATPAQANAVHAHIRSVVREM
TPIS_BORBU        LNQVKKGLNCVSES------DIQRIILAYEPVWAIGTGKTATKEEAEEVHKAIRLEITKL
TPIS_LEPIN        SSQIREGLKGIDSV------FFSNLILAYEPVWAIGTGKVATPSQAQEVHSFIRKEISGL
TPIS_FUSNN        AKQIKEGLVDLSKE------DAEKTIVAYEPVWAIGTGKTATPEMAQETHKEIRNVLAEM
TPIS_COREF        VEQTRASLAGLSAD------ELANTVIAYEPVWAIGTGKVASAADAQEVCKAIRGLVTEL
TPIS_CORGL        VEQTRKSLAGLDAA------ELANTVIAYEPVWAIGTGKVASAADAQEVCKAIRGLIVEL
TPIS_MYCTU        IEQLRGSLAGLLAE------QIGSVVIAYEPVWAIGTGRVASAADAQEVCAAIRKELASL
TPIS_MYCLE        QNQLRGSLAGLSPE------QIGNVVIVYEPVWAIGTGRVASAADAQEVCEAIRKELGAL
TPIS_STRCO        LAQVEGGLKDLAAE------QAESVVIAYEPVWAIGTGKVCGADDAQEVCAAIRGKLAEL
TPIS_CUTAK        VGQIKADLDGIPAE------QVAKLVIAYEPIWAIGTGETATADDAQEVCQAIREAVKEL
TPIS_BIFLO        VGQVRDVTRDLNEE------QAAKLIVAYEPVWAIGTGMVATPQSAQDAANAIRNDLKTT
TPIS_BIFAA        VGQVHDVTRDLSDE------EAAKLIVAYEPVWAIGTGMVATPQSAQDAARAIRNDLSDT
TPIS_AGRFC        KRQLAGSLPDEA--------TAENTVIAYEPVWAIGTGLTPTTQDVREAHAFMRDELVKR
TPIS1_RHIEC       KRQLSASVPDAA--------TAENTVIAYEPIWAIGTGVTPTSGDVEKAHAFMRAELVSR
TPIS_BRUSU        GDQLSGSLPDGV--------TAENTIIAYEPVWAIGTGLTPTVQDVRAAHAFMREQLIER
TPIS_BARHE        TRQLEGSLPDGA--------TAENIIIAYEPVWAVGTGNTATSADVAEVHAFIHHKMHSR
TPIS_RUEPO        CAQLAGSVPDGI--------DGTRVVVAYEPVWAIGTGLVPTLEQIAEVHDTLRQQLIGR
TPIS_CAUVC        VSQVRDSLPTSL--------AGKAFSVAYEPLWAIGTGRTASVDNIVEMHAAIRAELVSR
TPIS_HYPNA        TTQMAESIPEGA--------EAAAIVIAYEPVWAIGTGRVATSEQIAEVHTSIRNLLVRR
TPIS_DEIRA        LAQLRGSLEG----------VGADVVVAYEPVWAIGTGKTATADDAEELAAAIRGALREQ
TPIS_RHOBA        ETQIRGSLEGLDEA------RAANIVIAYEPVWAIGTGKTASKEQAEAVHAFIRELLGKM
TPIS_CHLTE        TAQVVEGLIDV--T------DISKLVIAYEPVWAIGTGKTATKEQAQEVHALIRAKVTEL
TPIS_PROA2        TCQVKEGLEGV--A------DIGDIVIAYEPVWAIGTGKTASSLQAQEVHASIRATVAGL
TPIS_CHLPM        STQVTGGLQGV--V------DISDIVIAYEPVWAIGTGRTASSEQAQEVHKIIRNKVAEL
TPIS_BACTN        AAQME-SVFSLSAE------DFSKIILAYEPVWAIGTGKTASPEQAQEIHAFIRSIVADK
TPIS_PORGI        ARQVEEALFTLDQT------DFAKLILAYEPVWAIGTGKTATADQAQEMHAHIRKSIAAK
TPIS_CHLPN        KKQLLLGLEQMD--------NGSEFLIAYEPVWAIGTGKVAEASDVQDIHMFCREVVAER
TPIS_CHLCV        SNQLMLGLAQLP--------ETAPVIIAYEPVWAIGTGKVASTADVQEVHAFCREVLSRI
TPIS_CHLTR        LNQLTTGLSKLP--------EQASFILAYEPVWAIGTGKVAHPDLVQETHAFCRKTIASL
TPIS_PARUW        RTQIQECLAGLTAE------DLKTLIIAYEPVWAIGNGQNAKPEGAQEIHQFCRKIIKEI
TPIS_MYCGE        KTDLTNCLDTIDKS------LIKNLVIAYEPLWAIGTGKTATPEVANQTIKTIREYINDL
TPIS_MYCPN        KEDLTQVLQGIDLS------LLKQLVIAYEPIWAIGTGKTATPEIANNTIAQIRVYLSEL
TPIS_MYCGA        KDQLEKDLKGIDSS------LLKDLIIAYEPVWAIGTGKTASSQTAQDAIAYIRTVLGLL
TPIS_ACIB5        LQQICDIAPVVTAE-----QWQNQVVIAYEPIWAIGTGKTASPQDAQAMHAKIREGLCQL
TPIS_ACIBS        LQQICDIAPVVTAE-----QWQNQVVIAYEPIWAIGTGKTASPQDAQAMHAKIREGLCQL
TPIS_ACIAD        LQQICDIAPVVSAE-----QWQHQIVIAYEPIWAIGTGRTASPEDAQAIHAKIREGLCQI
TPIS_NEIMA        AHQLSILQGLDT----------KNIAVAYEPVWAIGTGKVATVEQIADMHAFIYKEILSL
TPIS_NEIMB        AHQLSILQGLDT----------KNIAVAYEPVWAIGTGKVATVEQIADMHAFIYKEILSL
TPIS_PSYCK        DNQLAVIKEFITQQPELIKALPTRLIIAYEPVWAIGTGKVPTVAEVSATHKHIKQILAGF
TPIS_PSYA2        DSQLAVVKKLIAEQPEVIDSLSTRLIIAYEPVWAIGTGKVPTVSEVSATHQYIKQTLAGF
TPIS_ORITB        AQQLSSISFSFTKN----------IIIAYEPVWSIGSCMVPTIDDIYEVVTMIREIQNRY
TPIS_UREPA        LNQLANIINYKGLK---------KIIIAYEPIWAIGTDLELDFKHINYMIEGIKTYLYNC
TPIS_TROW8        SDKKHSIGYALGSKTHFLDSDQLHMLVAYEPSSAINSGNCANSGDIVRMAAAIKDIVN--
                                            :. ..  .                          

TPIS_HELPY        ----------TPLLYGGSVNTQNAKEILGIDSVDGLLIGSASWELENFKTIISFL-----
TPIS_HELAH        ----------MPLLYGGSVNTQNAKEILGIDSVDGLLIGSTSLELENFKTIISFL-----
TPIS_WOLSU        ----------CPLLYGGSVNLSNIAEILALPEVDGALIGSASLKVEDFCQMIQKI-----
TPIS_HELHP        ----------APLLYGGSVNPTNAREILCTPYVNGVLVGSASLNIQSFTDIIRASK----
TPIS_CAMJE        ----------VPLLYGGSVNENNIKEILSVNHCGGVLIGSAALKVENFIKLIKG------
TPIS_CAMJD        ----------VPLLYGGSVNENNIKEILSVNHCGGVLIGSAALKVENFIKLIKG------
TPIS_CAMC5        ----------APLLYGGSVNAANIGEIARIRECGGVLVGTASWDATNFLNLIASSRERI-
TPIS_WOLTR        ----------KHVIYGGSVSLENIENLSNILNLSGVLIGSASLDFDRFHKIVQQVEKAY-
TPIS_WOLPM        ----------KHIIYGGSVSSENIENLLSISNLSGVLIGSASLDFDHFYKIIQQVEKKFS
TPIS_EHRCR        ----------SNIIYGGAVNQSNIKDVIAINQLSGVLVGSASLKVSSFCDIIYGAVNVRQ
TPIS_MYCH2        TM----------VIYGGSVNSKNINELVSQKSIDGALVGGASLDPEEFGKILVNS-----
TPIS_MYCH7        TT----------VIYGGSVNSKNINELVSQKSIDGALVGGASLDPEEFGKILVNS-----
TPIS_MYCPU        LI----------IQYGGSVSPSNIENLMKQEDIDGALVGGASLEVDSFFELITFNALK--
TPIS_MYCAP        VP----------VLYGGSVNENNINDFTKLPNLNGFLVGSASLKIDKFLKLISVNSDGIM
TPIS_SALTY        AD--AKIAEQVIIQYGGSVNASNAAELFAQPDIDGALVGGASLKADAFAVIVKAAEAAKQ
TPIS_SALTI        AD--AKIAEQVIIQYGGSVNASNAAELFAQPDIDGALVGGASLKADAFAVIVKAAEAAKQ
TPIS_SALPA        AD--AKIAEQVIIQYGGSVNASNAAELFAQPDIDGALVGGASLKADAFAVIVKAAEAAKQ
TPIS_ECOLI        VD--ANIAEQVIIQYGGSVNASNAAELFAQPDIDGALVGGASLKADAFAVIVKAAEAAKQ
TPIS_PHOLL        KD--AAIAQQIIIQYGGSVNADNAAELFSQPDIDGALVGGASLKANAFAVIVKAAAAAKK
TPIS_YERPE        QD--AAVAAQVIIQYGGSVNDKNAAELFTQPDIDGALVGGASLKADAFAVIVKAAAKAKK
TPIS_HAEIN        KS--QAVAEQVIIQYGGSVNDANAAELFTQPDIDGALVGGASLKAPAFAVIVKAAAAAKN
TPIS_HAEDU        KS--QAVADQLIIQYGGSVNDTNAAELFSQPDIDGALVGGASLKATAFAEIVKAAEKAKA
TPIS_VIBCH        KD--AAVAEQVIIQYGGSVKPENAASYFAQPDIDGALVGGASLDAKGFAAIAKAAAEAKK
TPIS_VIBVY        KD--AAVAEQVIIQYGGSVKPENAEAYFAQPDIDGALVGGASLDAKSFAAIAKAAAKMKA
TPIS_ALIF1        KS--EEVAKNVVIQYGGSVKPENAAAYFAQPDIDGALVGGAALDAKSFAAIAKAAAEAKA
TPIS_MORMI        KS--EAVAKNVVIQYGGSVKPENAAAYFAQPDIDGALVGGAALDAKSFAAIAKAAAEAKA
TPIS_BUCCC        KS--NHNIENFFIQYGGSVTKNNAKELIYQKDIDGFLVGGASLQLEEFSKIIEITNI---
TPIS_WIGBR        YD--NDISKKIILQYGGSVNSKNVKKIISQKDVNGVLLGRSSTNIEEFLYILDIIEKTKK
TPIS_BUCAI        YS--SINRNDIIIQYGGSINHTNVKKFIEQPDINGLLIGNSSLSAKEFLEIIKIAHEHYS
TPIS_BUCBP        KQ--NSTIKLFSLQYGGSVNEHNIIELYDVKNIDGFLVGSASLSLDFFKKLLNNC-----
TPIS_BLOPB        YD--TSIADKITIQYGGSVTPENVTKFFDQKDIDGVLVGAASLNANSFSMIVQTAENHKK
TPIS_ACIAC        AS--E-HADRIRLLYGGSMNAANAAALLAQPDIDGGLVGGASLKAQDFLQIIAAAA----
TPIS_BORPE        L-----QASQVRVLYGGSVKGANAASLFAMPDIDGGLVGGASLVAEEFLRIAAA------
TPIS_RALSO        CD--AGVAQRMPILYGGSVKPDNAAELFTMADIDGGLIGGASLKAEDFLAIGRA------
TPIS_NITEU        HS--GGIAENIQILYGGSVKADNARELFTMPDIDGGLIGGASLVAAEFISICLAAQN---
TPIS_PSEPK        ED--AEVAAKVQLLYGGSVKAANAAELFGMPDIDGGLIGGASLNADEFGAICRAAGN---
TPIS_PSEAE        EN--AEVAKGVRLLYGGSVKAASAAELFGMPDIDGGLVGGASLNADEFGAICRAAGS---
TPIS_PSESM        EN--AEVAQGVRLLYGGSVKAANAVELFSMPDIDGGLIGGASLNADEFGAICRAAGN---
TPIS_XANCP        AD--ARIADSLPILYGGSVKPDNASELFSQPDVDGGLVGGASLVAEDFLAIARAAAAC--
TPIS_SHESM        VS--PFIGENIRILYGGSVTPSNAADLFAQPDVDGGLIGGASLNSSEFLSLCTIAMSA--
TPIS_SHEON        VS--PFIGENIRILYGGSVTPSNAADLFAQPDVDGGLIGGASLNSTEFLSLCTIAMSA--
TPIS_SHEPC        VS--PFIGENIRILYGGSVTPSNAADLFAQPDVDGGLIGGASLNSSEFLSLCTIAMSA--
TPIS_POLNS        FN--EDVASHVGILYGGSVKPDNAVELFAMPDIDGGLVGGASLSPQDFLAICKA------
TPIS_LEGPC        IN--DSDAKHLTLIYGGSVNENNAKALFSMPDIDGGLVGGASLNAKQFVEIVKCIN----
TPIS_FRATH        VD--ERLAKNIKIVYGGSLKAENAKDILSLPDVDGGLIGGASLKAAEFNEIINQANKICT
TPIS_ARATH        VS--ADVAATTRIIYGGSVNGGNCKELGGQADVDGFLVGGASL-KPEFIDIIKAAEVKKS
TPIS_HUMAN        VS--DAVAQSTRIIYGGSVTGATCKELASQPDVDGFLVGGASL-KPEFVDIINAKQ----
N4TND9_FUSC1      IS--DKVADETRILYGGSVNEKNCGELSKQPDIDGFLVGGASL-KPAFVDIINATKQ---
C9SPK3_VERA1      VS--DKVADETRILYGGSVSEKNCKDLAKEADIDGFLVGGASL-KPAFVEIINSKQ----
TPIS_CANAL        IG--AEQAEKTRILYGGSVNGKNAKDFKDKANVDGFLVGGASL-KPEFVDIIKSRL----
TPIS_DICDI        VS--EDVAKKTSIMYGGSVNADNCHNLSKQSDIDGFLVGGASLVASDFIAIIKSAVPKKY
TPIS_CLOPE        F--GQEVADKVRIQYGGSVKPNTIAEQMAKSDIDGALVGGASLVAADFAQIVNY------
TPIS_CLOBB        Y--GKEVADKVRIQYGGSVKPNTITEQMAMSDIDGALVGGASLKAEDFSGIVNY------
TPIS_CLOAB        F--GKEVAEKVRIQYGGSVKPNTIKAQMAKPEIDGALVGGASLKAADFAAIVNF------
TPIS_CLOTE        Y--GDKVAESLRIQYGGSVKPSTIKEQMSMSDIDGALVGGASLKANDFSAIVNY----K-
TPIS_BACHD        F--SQEAADAVRIQYGGSVKPANIAEYMAQSDIDGALVGGASLDPQSFLQLLEA----VK
TPIS_BACAN        V--SPAAAEAVRIQYGGSVKPENIKEYMAQSDIDGALVGGASLEPASFLGLLGA----VK
TPIS_BACSU        F--SQEAADKLRIQYGGSVKPANIKEYMAESDIDGALVGGASLEPQSFVQLLEE----GQ
TPIS_BACLD        F--GQTAADSVRIQYGGSVKPANIKEYMAESDIDGALVGGASLEPQSFVQLLEA----GQ
TPIS1_LISIN       V--SQKAADAVRIQYGGSVKPENIADYLAESDIDGALVGGASLEPASFLALLEA----VK
TPIS1_LISMO       V--SQKAADAVRIQYGGSVKPENIADYLAESDIDGALVGGASLEPASFLALLEA----VK
TPIS_STAAC        S--SKEVSEATRIQYGGSVKPNNIKEYMAQTDIDGALVGGASLKVEDFVQLLEG----AK
TPIS_STAEQ        S--SQEVADATRIQYGGSVKPNNIKEYMAQSDIDGALVGGASLKVEDFVQLLEG----AK
TPIS_STRT2        F--GQEVADKVRVLYGGSVKPENVAEYMACPDVDGALVGGASLEPESFLALLDF----VK
TPIS_STRR6        F--GQEVADKVRVQYGGSVKPENVASYMACPDVDGALVGGASLEAESFLALLDF----VK
TPIS_STRA5        F--GQAVADKVRVQYGGSVKPENVAEYMACPDVDGALVGGASLEAESFLALLDF----VK
TPIS_STRPF        F--GQEVADKVRVQYGGSVKPENVKDYMACPDVDGALVGGASLEADSFLALLDF----LN
TPIS_STRP6        F--GQEVADKVRVQYGGSVKPENVKDYMACPDVDGALVGGASLEAGSFLALLDF----LN
TPIS_STRP8        F--GQEVADKVRVQYGGSVKPENVKDYMACPDVDGALVGGASLEADSFLALLDF----LN
TPIS_STRSY        F--GQEVADKVRVQYGGSVNPSNVAEYMACPDVDGALVGGASLEAESFLALLNF------
TPIS_STRMU        Y--GKEVAQAVRIQYGGSVKPENVAEYMAKENVDGALVGGASLQADSFLALLDF----VK
TPIS_LACGA        Y--NEETAENVRIQYGGSVKPANVKELMSKPDIDGGLVGGASLDPESFLALVNY----QD
TPIS_OCEIH        T--SADVAEKVIIQYGGSVKPANVDELLAQSDIDGALVGGASLDPESFLQLVEA----GT
TPIS_SYNY3        ---------QVTIQYGGSVNANNVDEIMAQPEIDGALVGGASLEPQSFARIVNF----QP
TPIS_GLOC7        ---------NVSIQYGGSVKPGNIDEIMKQSEIDGALVGGASLNPADFAQIVNY----K-
TPIS_THEEB        ---------DVPIQYGGSVNANNIDAIMAQPEIDGVLVGGASLQPQSFGRIVNY----KP
TPIS_PROMA        ---------DLIIQYGGSVKPANIDEIMSMSDIDGVLVGGASLDPENFARIANY----QS
TPIS_PROMM        ---------ELIIQYGGSVKPGNIDELMAMSDIDGVLVGGASLDPESFARIANY----QT
TPIS_SYNPX        ---------DLIIQYGGSVKPTNIDELMAMSDIDGVLVGGASLKPDSFARIANY----QA
TPIS_PROMP        ---------DVIIQYGGSVKPNNIDEIMSMSDIDGVLVGGSSLDPISFSRIANF----E-
TPIS_AQUAE        N--PKNEG-KTRILYGGSVNPQNAKEFMKHEEINGLLVGTASLDPESFAKIVYS----F-
TPIS_TREDE        Y--GEKAAKNMIIQYGGSMKPENAAGLLKKHNIDGGLIGGAGLKTETFLPIALF----SE
TPIS_TREPA        Y--GAAIAEALCIQYGGSMKAENARALLAEEHIDGGLIGGASLEAASFVPIARS----V-
TPIS_BORBU        Y--SKSASDNIIIQYGGSVNSNNVKELMNEPNIDGALIGGASLKAESFLSIINN----VL
TPIS_LEPIN        FVGASSISESISILYGGSVKPDNIQDLLKEKDIDGGLVGGASQKISSFAELF--------
TPIS_FUSNN        F--GKDVADKMIIQYGGSMKPENAKDLLSQEDIDGGLVGGASLKADSFFEIIKA----GN
TPIS_COREF        A--GEEVAEGMRILYGGSVKAETIAEIVSQPDVDGGLVGGASLDGEAFAKLAAN----AA
TPIS_CORGL        A--GDEVAEGLRILYGGSVKAETVAEIVGQPDVDGGLVGGASLDGEAFAKLAAN----AA
TPIS_MYCTU        A--SPRIADTVRVLYGGSVNAKNVGDIVAQDDVDGGLVGGASLDGEHFATLAAI----AA
TPIS_MYCLE        A--SPQVAETVRVLYGGSLNAKNIGDIVAQQDVDGGLVGGASLDGAQFATLAVI----AA
TPIS_STRCO        Y--SQELADKVRIQYGGSVKSGNVAEIMAKPDIDGALVGGASLDSDEFVKIVRF----RD
TPIS_CUTAK        Y--DAPTAEAVRIQYGGSVKPANVAEIMAKPDVDGALVGGASLKAGDFSKIVTF----YE
TPIS_BIFLO        F--GTKVSDSVRILYGGSVTSKNAAELISQPDVDGFLIGGAALDVEELAKIARL----AL
TPIS_BIFAA        F--GTRVGETVRILYGGSVSSKNAVELINEPDVDGFLIGGSALKVDELTRICKL----TL
TPIS_AGRFC        F--GDAGKT-MRILYGGSVKPANALELMGVENVDGALIGGASLKAADFLSIYAA----YE
TPIS1_RHIEC       F--GDEGRK-MRLLYGGSVKPANAGELLGIANVDGALIGGASLKAADFLAIYRA----YE
TPIS_BRUSU        F--GAKGAH-LRLLYGGSVKPSNAAELLGVADVDGALVGGASLKAADFLAICET----YR
TPIS_BARHE        F--GDEGAK-IRLLYGGSVKPSNAFELLSTAHVNGALIGGASLKAIDFLTICDV----YR
TPIS_RUEPO        F--GSETAEAIRLLYGGSVKPGNAAEIFAVSNVDGALVGGASLTAADFSPIVSA----LE
TPIS_CAUVC        F--CEQGRT-VLILYGGSVKPENAREILAAPEVGGALVGGASLKAKDFLAIIQA----L-
TPIS_HYPNA        F--GDAGRT-TRILYGGSMNPGNAAEILAVAEVNGGLIGGASLKAADFLAIYRL----AA
TPIS_DEIRA        Y--GARAEG-IRVLYGGSVKPENIAEICGKPNVNGALVGGASLKVPDVLGMLDA----LR
TPIS_RHOBA        F--STEVAEQIRIQYGGSVKPGNAEELLSQPNIDGALVGGSSLKVDDFAGIIKA----AP
TPIS_CHLTE        Y--GQKAADHLRIQYGGSVKPSNAAELFAMPDIDGGLIGGASLNADDFMAIVEA----AG
TPIS_PROA2        Y--SEPAAAGVRIQYGGSVKPSNAEELFAMPDIDGGLIGGASLNAEDFVAIVKA----AE
TPIS_CHLPM        Y--GAPAADAVRIQYGGSVKPSNAAELFAMPDIDGGLIGGAALKAEDFAAIVKA----AC
TPIS_BACTN        Y--GKEIADNTSILYGGSCKPSNAKELFSNPDVDGGLIGGAALKVSDFKGIIDA----FN
TPIS_PORGI        Y--GKEVANGCSILYGGSCNAANAKELFSRADVDGGLIGGASLSVDKFLPIIEA----F-
TPIS_CHLPN        F--SEATAEEISILYGGSVKVDNAQRFGQCSDVDGLLVGGASLEGQSFFEVAKN----FN
TPIS_CHLCV        F--SKEKSEIISILYGGSVKADNAEGFARCPDVDGLLVGGASLDPQGFANVLRN----FN
TPIS_CHLTR        F--SKDIAERTPILYGGSVKADNARSLSLCPDVNGLLVGGASLSSENFLSIIQQ----ID
TPIS_PARUW        F--SEELAEQIVIQYGGSVNPSNAISLLKQPDIDGLLIGGASLSLETFVEIVNDGGSIFN
TPIS_MYCGE        YD--ENVANNISILYGGSVDHNNIQKLAIMEQIDGFLVGKASLEIKNFLEMARVYA----
TPIS_MYCPN        YN--KEIAQQTSILYGGSVAKDNIKELAQTEQIDGFLVGKASLDVNDFLVMAQVYA----
TPIS_MYCGA        SS--KTIANELPILYGGSVTPDNVSELLAQKDINGALVGGASLDPHKFIQLIEAK-----
TPIS_ACIB5        TP----AGSNIAILYGGSVKAENAVELAACPDINGALVGGASLKAASFYQIVQAFAQSK-
TPIS_ACIBS        TP----AGSNIAILYGGSVKAENAVELAACPDINGALVGGASLNAASFYQIVQAFAQSK-
TPIS_ACIAD        TP----AGSQIALLYGGSVKPENAVELAACPDINGALVGGASLNAESFYKIAQAFAQTQQ
TPIS_NEIMA        CG----SDVKIRVLYGGSVKADNAADIFAVPYVDGALVGGASLSYDSFTAIISAAQNA--
TPIS_NEIMB        CG----SDVKIRVLYGGSVKADNAADIFAVPYVDGALVGGASLSYDSFTAIISAAQNA--
TPIS_PSYCK        AD----SLSNMTVLYGGSVNADNANSFAADPMIDGALVGGASLKADSFLTIATAFSQASI
TPIS_PSYA2        AD----SLSNMTVLYGGSVNADNADSFAADPMIHGALVGGASLKAESFLAIVTAFSKGSM
TPIS_ORITB        IP--HNIENSVKIVYGGSVSANNINQILT-AGIDGVLIGKASLKLESLTTIIKTVQGLD-
TPIS_UREPA        TG------INIPILYGGSVNDNNINELCNQKLIDGFLIGNASLDVNVFNKIIDKCK----
TPIS_TROW8        ----------VRVLYGGGVNLFNASAVFNEDLLDGILVGRASLNASDFASLIKTCCL---
                              : ***.    .           * *:* :.     .  :         

TPIS_HELPY        --------
TPIS_HELAH        --------
TPIS_WOLSU        --------
TPIS_HELHP        --------
TPIS_CAMJE        --------
TPIS_CAMJD        --------
TPIS_CAMC5        --------
TPIS_WOLTR        --------
TPIS_WOLPM        LINSKISN
TPIS_EHRCR        N-------
TPIS_MYCH2        --------
TPIS_MYCH7        --------
TPIS_MYCPU        --------
TPIS_MYCAP        PK------
TPIS_SALTY        A-------
TPIS_SALTI        A-------
TPIS_SALPA        A-------
TPIS_ECOLI        A-------
TPIS_PHOLL        A-------
TPIS_YERPE        A-------
TPIS_HAEIN        --------
TPIS_HAEDU        --------
TPIS_VIBCH        A-------
TPIS_VIBVY        --------
TPIS_ALIF1        --------
TPIS_MORMI        --------
TPIS_BUCCC        --------
TPIS_WIGBR        S-------
TPIS_BUCAI        --------
TPIS_BUCBP        --------
TPIS_BLOPB        SYPA----
TPIS_ACIAC        --------
TPIS_BORPE        --------
TPIS_RALSO        --------
TPIS_NITEU        --------
TPIS_PSEPK        --------
TPIS_PSEAE        --------
TPIS_PSESM        --------
TPIS_XANCP        --------
TPIS_SHESM        --------
TPIS_SHEON        --------
TPIS_SHEPC        --------
TPIS_POLNS        --------
TPIS_LEGPC        --------
TPIS_FRATH        E-------
TPIS_ARATH        A-------
TPIS_HUMAN        --------
N4TND9_FUSC1      --------
C9SPK3_VERA1      --------
TPIS_CANAL        --------
TPIS_DICDI        --------
TPIS_CLOPE        --------
TPIS_CLOBB        --------
TPIS_CLOAB        --------
TPIS_CLOTE        --------
TPIS_BACHD        --------
TPIS_BACAN        --------
TPIS_BACSU        YE------
TPIS_BACLD        YE------
TPIS1_LISIN       --------
TPIS1_LISMO       --------
TPIS_STAAC        --------
TPIS_STAEQ        --------
TPIS_STRT2        --------
TPIS_STRR6        --------
TPIS_STRA5        --------
TPIS_STRPF        --------
TPIS_STRP6        --------
TPIS_STRP8        --------
TPIS_STRSY        --------
TPIS_STRMU        --------
TPIS_LACGA        --------
TPIS_OCEIH        K-------
TPIS_SYNY3        --------
TPIS_GLOC7        --------
TPIS_THEEB        L-------
TPIS_PROMA        I-------
TPIS_PROMM        S-------
TPIS_SYNPX        I-------
TPIS_PROMP        --------
TPIS_AQUAE        --------
TPIS_TREDE        --------
TPIS_TREPA        --------
TPIS_BORBU        --------
TPIS_LEPIN        --------
TPIS_FUSNN        --------
TPIS_COREF        NAV-----
TPIS_CORGL        SVA-----
TPIS_MYCTU        GGPLP---
TPIS_MYCLE        GGPLP---
TPIS_STRCO        Q-------
TPIS_CUTAK        A-------
TPIS_BIFLO        KSTKSRN-
TPIS_BIFAA        ETTA----
TPIS_AGRFC        QLTA----
TPIS1_RHIEC       ALLA----
TPIS_BRUSU        NL------
TPIS_BARHE        KL------
TPIS_RUEPO        QAAG----
TPIS_CAUVC        --------
TPIS_HYPNA        Q-------
TPIS_DEIRA        --------
TPIS_RHOBA        SA------
TPIS_CHLTE        --------
TPIS_PROA2        KS------
TPIS_CHLPM        --------
TPIS_BACTN        A-------
TPIS_PORGI        --------
TPIS_CHLPN        V-------
TPIS_CHLCV        L-------
TPIS_CHLTR        IP------
TPIS_PARUW        LKAKLL--
TPIS_MYCGE        --------
TPIS_MYCPN        --------
TPIS_MYCGA        --------
TPIS_ACIB5        --------
TPIS_ACIBS        --------
TPIS_ACIAD        --------
TPIS_NEIMA        --------
TPIS_NEIMB        --------
TPIS_PSYCK        --------
TPIS_PSYA2        --------
TPIS_ORITB        --------
TPIS_UREPA        --------
TPIS_TROW8        --------