CLUSTAL format seed alignment for MF_00148

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

C4XE67_MYCFP      ----------------------------------------MNLTMKNSFQTFLKQEESKN
I5D5D5_MYCAA      --------------------------------------------MKNKFAEFINKESQKP
Q8EWJ6_MYCPE      -----------MIFVLLLIRKYTFFLYVLLRYNELMYLNKFISEVKDSWKEFFEQEFEKE
UNG_MYCPU         ------------------------------------------MNKEQRWKSFFEKEKAQK
UNG1_LISIN        --------------------------------------------MVKTWDEFLEQEAKQP
UNG1_LISMO        --------------------------------------------MVKTWEEFLKQEAKQP
UNG_BACHD         -----------------------------------------MSILHNDWADVLEAEFQKP
UNG_BACSU         ----------------------------------------MKQLLQDSWWNQLKEEFEKP
UNG2_LISIN        -----------------------------------------MIKLENDWDELLKDEFNQP
UNG2_LISMO        -----------------------------------------MIKLGNDWDELLKNEFNQP
UNG_CLOPE         ----------------------------------------MAAEFNNDWDDLLKDEFKKE
UNG_FUSNN         -----------------------------------------MSKINNDWKEILEEEFEKE
UNG_DEIRA         ----------------------MTDQPDLFGLAPDAPRPIIPANLPEDWQEALLPEFSAP
UNG2_STRCO        ----------------------MTDI----------------AMLPESWREVLGGELQQP
UNG_CHLMU         ----------------------------MHEAFT-------IEQLPQSWQEQLKDEWSQP
UNG_CHLTR         ----------------------------MHEAFT-------IEQLPPSWQEQLKDEWSQP
UNG_CHLPN         ----------------------------MQNATIDQLPVSWQEQLPLCWREQLKEEWSKP
UNG_RALSO         MTRRADPAQATLFDDDEPAGAPTATGGFVPLADQ-------FDALPADWKALLGPCLART
F5Y0U9_RAMTT      ------------------------------MVDA-------FFASPAGQR----------
B1XSY3_POLNS      ----------------------------MKALFS-------KEDIPDDWRELLGNYLESN
H7EMR7_9SPIO      ------------------------MNSGAKTMEL-------FNNIPREWREAIIASYDGN
UNG_MYCLE         ----------------------------MTARPL-------SELVEQGWAAALEPVVDQV
UNG_MYCTU         ----------------------------MTARPL-------SELVERGWAAALEPVADQV
UNG1_STRCO        ----------------------------MAPRPL-------NEIVEAGWAKALEPVAGQI
G0HBI2_CORVD      ------------------MTTPSTDPTAAIAGTI-------LATVHPSWRAELDAAGVDL
Q1GY28_METFK      --------------------------MSTMLDPV-------THPRPESLPPAWVEAIPEL
UNG_STRP1         -------------------------------------------MAHSIWHEKIKSFLPEH
UNG_STRP8         -------------------------------------------MAHSIWHEKIKSFLPEH
UNG_STRA3         -------------------------------------------MKHSSWHDLIKRELPNH
UNG_STRPN         -------------------------------------------MEHSSWHALIKAQLPEG
UNG_LACLA         -------------------------------------------MKKTDWSQPLRNRLAED
UNG_STAAM         ----------------------------------------------MEWSQIFHDITTKH
UNG_HAEIN         ---------------------------------------------MKNWTDVIGTEKAQP
UNG_PASMU         ---------------------------------------------MKTWKDVIGTEKTQP
UNG_YERPE         ------------------------------------------MSPSLTWHDVIGQEKEQP
UNG_VIBCH         ------------------------------------------MSESLTWHDVIGNEKQQA
UNG_ECO57         ------------------------------------------MANELTWHDVLAEEKQQP
UNG_ECOLI         ------------------------------------------MANELTWHDVLAEEKQQP
UNG_SALTY         ------------------------------------------MATELTWHDVLADEKQQP
UNG_NEIMB         ---------------------------------------------MDTWHDALGGEKQQP
UNG_NEIMA         ---------------------------------------------MDTWHDALGGEKQQP
UNG_BUCAI         --------------------------------------------MILSWKDVLSQEKKKK
UNG_XANAC         ---------------------------MTE--------GEGRIQLEPSWKARVGDWLLRP
UNG_XANCP         ---------------------------MTE--------GEGRIQLEPSWKARVGEWLLQP
UNG_XYLFA         ---------------------------MNEQGEAINNSAESRIQLESSWKAHVGNWLLRP
UNG_PSEAE         ---------------------------MTD--------NDDRIKLEASWKEALREEFDKP
UNG_AGRFC         ---------------------------MEA------GMAEAGVKLEDSWKHVLSGEFASP
UNG_RHIME         --------------------------------------MDATIRLEESWKAVLGGEFRHG
UNG_HELPJ         ------------------------------------MKLFDYAPLSLAWREFLQSEFKKP
UNG_HELPY         ------------------------------------MKLFDYAPLSLAWREFLQSEFKKP
UNG_CAMJE         --------------------------------MEEITINIDKIKINDDWKEFLRDEFQKK
UNG_BORBU         ----------------------------------------MKVKIEESWKEVLNNEFNKE
UNG_UREPA         ----------------------------------------------MKWKEFIINETKQS
UNG_MYCPN         ---------------------------------MEQLLDQFLSGVLSEWKAFILQEAKQT
UNG_MYCGE         -------------------------------MVMDDLFQRMVSCVLPSWRAFIDEEVKKP
J3VHG5_MYCGL      --------------------------------MLEQLIGEIKTNWKDLINQFFATHKTIY
E4PU96_MYCLG      -----------------------------------------MTNLHPSWNKLFTDLNLFD
Q6MTB2_MYCMS      -----------------------------------------MTNLHPSWNKLFTDLNLSD
                                                                              

C4XE67_MYCFP      --YYQ-ELIKKVTQEEQ--KHNVFPPKELRFDALNYFEAEETKLIIIGQDPYYLKN----
I5D5D5_MYCAA      --YFK-GLIASIEKEKS--KFNVFPSDERIFECLKYSSPEKLKLIIIGQDPYYKNG----
Q8EWJ6_MYCPE      --YFH-SLDSFIEQEYK--NKTIYPLTSNIFRAFTFFAVSETNLVIIGQDPYQTED----
UNG_MYCPU         --YFKDELWPFLENEYK--NKIIFPKKEDIFKAFDLVDFNNLKVVIIGQDPYINEN----
UNG1_LISIN        ---YFIELMKAVSEARE--EGNVYPSEEDMFSCFRLCPYDKVKVVILGQDPYHGPG----
UNG1_LISMO        ---YFIELMEAVKDARA--KGNVYPSEEDMFSCFRLCPYNQVKVVILGQDPYHGPG----
UNG_BACHD         ---YYVQLREFLKQEYS--TQTIYPSMYDIFNALHYTPLAEAKVVILGQDPYHGPN----
UNG_BACSU         ---YYQELREMLKREYA--EQTIYPDSRDIFNALHYTSYDDVKVVILGQDPYHGPG----
UNG2_LISIN        ---YYLKLRQFLKNEYQ--TKRIFPDMYDIFNALKHTAYKDVKVVILGQDPYHGPG----
UNG2_LISMO        ---YYLTLRQFLKKEYQ--TKKVFPDMYDIFNALKHTAYKDVKVVILGQDPYHGPG----
UNG_CLOPE         ---YYLNLRKFLINEYK--TQKIHPSMYDIFNALKFTPYKDVKVVILGQDPYHGPN----
UNG_FUSNN         ---YFIKLKETLEEEYK--NYTVYPPKRDILNAFFLTPYSEVKVVLLGQDPYHQRG----
UNG_DEIRA         ---YFHELTDFLRQERK--EYTIYPPAPDVFNALRYTPLGEVKVLILGQDPYHGPN----
UNG2_STRCO        ---YFKELMEFVEEERA--NGPVYPPREEVFAALDATPFDRVKVLVLGQDPYHGEG----
UNG_CHLMU         ---YWSQLLTFLKSEYA--NATVYPKKEHVFSALRSTPFDQVKVVILGQDPYHGEG----
UNG_CHLTR         ---YWSQLLAFLKSEYA--QATIYPKKENVFAALQSTPFDQVRVVILGQDPYHGEG----
UNG_CHLPN         ---YMQQLLIFLKQEYK--EHTVYPEENCVFSALRSTPFDQVRVVILGQDPYPGKG----
UNG_RALSO         ---DWPALCAFVDGERAAGKPIFPTEV---FHALHLTPVDAVRVIILGQDPYHGTGTVDG
F5Y0U9_RAMTT      -------LGEFMRQRLAAGAVIYPPQP---LRALELTPLASVRAVILGQDPYHGPG----
B1XSY3_POLNS      ---GWQSLEKNLQAILDLDASVVRPEPRHFFKALKLTPVNSVKAVILGQDPYHSPG----
H7EMR7_9SPIO      FAEEFGRLCDFIDSEYDSFPDDMRPVEKTDVFNALSVPFGDVKAVILGQDPYPDAE----
UNG_MYCLE         -----AEMGRFLRAEIAAGRRYL-PAGHSVLRAFTY-PFDNVRVLIVGQDPYPTPGHAV-
UNG_MYCTU         -----AHMGQFLRAEIAAGRRYL-PAGSNVLRAFTF-PFDNVRVLIVGQDPYPTPGHAV-
UNG1_STRCO        -----TSMGEFLRAEIAAGRTYL-PAGANVLRAFQQ-PFDDVRVLIVGQDPYPTPGHAV-
G0HBI2_CORVD      -----PAAAERTAARITAGEQLL-PAPENIFRALAR-PADETRVLILGQDPYPTPGHSV-
Q1GY28_METFK      -----QALYHSISASLEPEQDVR-PRRGLWFEALRQVEPAAARVVLLGQDPYHGEDHGIQ
UNG_STRP1         ---YYGRINHFLDEAYA--SGLVYPPRENVFKALQVTPLEETKVLILGQDPYHGPK----
UNG_STRP8         ---YYGRINHFLDEAYA--SGLVYPQRENVFKALQVTPLEETKVLILGQDPYHGPK----
UNG_STRA3         ---YYNKINTFMDAVYE--SGIVYPPRDKVFNAIQITPLENVKVVIIGQDPYHGPQ----
UNG_STRPN         ---YFGKINQFMEQVYS--QGIIYPPKEKVFQALLTTLLEEVKVVILGQDPYHGPG----
UNG_LACLA         ---YFPKMIEFINQTYQ--EGKVYPPENQIFRAIELTPLAQTKVIIVGQDPYPQPG----
UNG_STAAM         ---DFKAMHDFLEKEYS--TAIVYPDRENIYQAFDLTPFENIKVVILGQDPYHGPN----
UNG_HAEIN         ---YFQHTLQQVHLARA-SGKTIYPPQEDVFNAFKYTAFEDVKVVILGQDPYHGPN----
UNG_PASMU         ---YFKHILDQVHQARA-SGKIVYPPPQEVFSAFQLTEFEAVKVVIIGQDPYHGPN----
UNG_YERPE         ---YFKDTLAYVAAERR-AGKTIYPPQKDIFNAFRLTELDQVKVVILGQDPYHGPN----
UNG_VIBCH         ---YFQQTLQFVESQRQ-AGKVIYPPAKDVFNAFRFTEFGDVKVVILGQDPYHGPN----
UNG_ECO57         ---YFLNTLQTVASERQ-SGVTIYPPQKDVFNAFRFTELGDVKVVILGQDPYHGPG----
UNG_ECOLI         ---YFLNTLQTVASERQ-SGVTIYPPQKDVFNAFRFTELGDVKVVILGQDPYHGPG----
UNG_SALTY         ---YFINTLHTVAGERQ-SGITVYPPQKDVFNAFRFTELGDVKVVILGQDPYHGPG----
UNG_NEIMB         ---YFQEILNAVRQERL-SGQIIYPPAADVFNAFRLTAFDRVKAVILGQDPYHGAG----
UNG_NEIMA         ---YFQEILNAVRQERL-SGQIIYPPAADVFNAFRLTAFDRVKAVILGQDPYHGAG----
UNG_BUCAI         ---YFINIIRFLKKER--LKKIIYPDQKDIFNAFFLTSFNDIKVVILGQDPYFSKN----
UNG_XANAC         ---QMRELSAFLRQRKA-AGARVFPPGPQIFAAFDATPFEQVKVVILGQDPYHGEG----
UNG_XANCP         ---QMQELSAFLRQRKA-ANARVFPPGPQIFAAFDATPFEQVKVVVLGQDPYHGEG----
UNG_XYLFA         ---EMRDLSAFLRARKV-AGVSVYPPGSQIFAAFEATPFQRVKAVILGQDPYHGQG----
UNG_PSEAE         ---YMKQLGEFLRQEKA-AGKVIFPPGPLIFNALNTTPLENVKVVIIGQDPYHGPG----
UNG_AGRFC         ---YMQKLKEFLLAEKT-AGKRIFPKGAEYFRALDLTPLDEVKVVILGQDPYHGLG----
UNG_RHIME         ---YMAELKRFLLEEKQ-QGRQIFPRGVEYFRALDLTPLDRVRVVILGQDPYHGDG----
UNG_HELPJ         ---YFLEIEKRYLEALK-SPKTIFPKSSNLFCAFNLTPPYAVKIILLGQDPYHSTYLENE
UNG_HELPY         ---YFLEIEKRYLEALK-IPKTIFPKSSNLFYALNLTPPCAVKIILLGQDPYHSTYLEND
UNG_CAMJE         ---YFLEIKKQYLNAIN-QNIIIYPPANLIFNAFNLCPLKEIKIIILGQDPYHQPNQ---
UNG_BORBU         ---YFKKLVKFIKHEYKTKNGKIFPPPKLIFNAFNSLPFKDIKVVIIGQDPYHGKN----
UNG_UREPA         ---YLKNIIKKINNIEN--HQVVFPLKKQRFRCFDFFDIEQTKVVILGQDPYHTPK----
UNG_MYCPN         ---YFQELLAKLKNVEQ----ELTPKASQVFRPFSFFAPNNTKLIIYGQDPYPNPQ----
UNG_MYCGE         ---YFQALLEKLKALKA----TIIPKPELIFRVFSFFKPIDTKVIIFGQDPYPSPN----
J3VHG5_MYCGL      ---HQLDQLIKNRSEKN----ELIPKKELIFNAFNFFDYQETKVVIIGQDPYADLK----
E4PU96_MYCLG      ---QINNLMNKAYSSND----IVFPKQKDVLNLFKLSDLNNIKVVIIGQDPYHDFN----
Q6MTB2_MYCMS      ---QINNLINKAYSSND----IVFPKQKDVLNLFKLSDLNNIKVVIIGQDPYHDFN----
                                          .                 . :: *****        

C4XE67_MYCFP      ----QADGLAFSTQGNICP---KSLNNIFKELK-----KDYSETNIETYSLKSWAKQGVL
I5D5D5_MYCAA      ----YADGLAFSTESQKCP---KSLENILIELK-----KDYPEAVIETFSLKSWAKNHIL
Q8EWJ6_MYCPE      ----MADGLAFSTQLKVKP---RSLSNIFKELK-----NDF-NIDRTNYDLSDIAKQNVL
UNG_MYCPU         ----QAHGLAFSTLDFLLP---KSLKNIFIELK-----NNYPNVVLKSGNLTSWASQGIL
UNG1_LISIN        ----QAHGLSFSVQKDVRI--PPSLRNIYKELK-----SDLDIDPANHGYLAKWAEQGVL
UNG1_LISMO        ----QAHGLSFSVQKDVRI--PPSLRNIYKELK-----TDLDIEPADHGYLAKWAEQGVL
UNG_BACHD         ----QAHGLSFSVKPGVPL--PPSLQNIFKELR-----EDLGCPIPNNGHLTPWAEQGVL
UNG_BACSU         ----QAQGLSFSVKPGVKQ--PPSLKNIFLELQ-----QDIGCSIPNHGSLVSWAKQGVL
UNG2_LISIN        ----QAHGLSFSVQKGVQI--PPSLQNIYLELH-----NDLNCEIPNNGYLIPWADQGVL
UNG2_LISMO        ----QAHGLSFSVQQGVQI--PPSLQNIYLELH-----NDLNCEIPNNGYLIPWADQGVL
UNG_CLOPE         ----QAHGFSFSVKPGVQT--PPSLRNMFKELN-----SDLGCYIPNNGFLESWAKQGIL
UNG_FUSNN         ----QAHGLAFSVNYEIKT--PPSLVNMYKELQ-----DDLGLYIPNNGFLEKWSKQGVL
UNG_DEIRA         ----QAHGLSFSVRPGVRV--PPSLRNIYKELTE----DIPGFVAPKHGYLRSWAEQGVL
UNG2_STRCO        ----QGHGLCFSVRPGVKV--PPSLRNIYKEMHA----ELDTPI-PDNGYLMPWAEQGVL
UNG_CHLMU         ----QAHGLSFSVPKGQALP-PSLRNIFQELQA------DLGIRNE-TGCLQTWADQGVL
UNG_CHLTR         ----QAHGLSFSVPRGQALP-PSLRNIFQELHT------DLGIRNE-SGCLQAWADQGVL
UNG_CHLPN         ----QAHGLSFSVPEGQRLP-PSLINIFRELKT------DLGIENH-KGCLQSWANQGIL
UNG_RALSO         REVPQAHGLAFSVPAGVRVP-PSLRNIYKEIEA-----EYGRKLSAGSGNLEGWAQQGVL
F5Y0U9_RAMTT      ----QAEGLAFSVAPGVRLP-PSLRNIFAELG-----------IVPPHGSLVEWARSGVL
B1XSY3_POLNS      ----LAQGLAFSIPAEIAVN-S--REFPSSLRNISKALALEGFGQLPNGDLHNWANQGVL
H7EMR7_9SPIO      ----KAHGLAFDTADGSVSA-SLRNVFYEIEREKNPDTEQKGFKTERTGDLSGWTRQGVL
UNG_MYCLE         -------GLSFSVAPDVRPL-PRSLANVFDEYT-----ADLGYPLPVCGDLTPWAQRGVL
UNG_MYCTU         -------GLSFSVAPDVRPW-PRSLANIFDEYT-----ADLGYPLPSNGDLTPWAQRGVL
UNG1_STRCO        -------GLSFSVAPEVRPL-PGSLVNIFRELN-----TDLNLPQPANGDLTPWTRQGVL
G0HBI2_CORVD      -------GLAFSSAATTRPL-PKSLRNIYTEYE-----SDLGLPRPASADLTPWADHGVM
Q1GY28_METFK      ----QAHGLSFSVPEGVRP--PPSLRNMLKEMQ-----TDVGQTLS-SGNLMPWAKQGVL
UNG_STRP1         ----QAQGLSFSVPEEISA--PPSLINILKELA------DDIG-PRDHHDLSTWASQGVL
UNG_STRP8         ----QAQGLSFSVPEEISA--PPSLINILKELA------DDIG-PRDHHDLSTWASQGVL
UNG_STRA3         ----QAQGLSFSVPDNLPA--PPSLQNILKELA------EDIG-SRSHHDLTSWAQQGVL
UNG_STRPN         ----QAQGLSFSVPDSIPA--PPSLQNILKELS------DDIG-VKKSHDLTAWAEQGVL
UNG_LACLA         ----KAQGLAFSYPATFKVNRPDSIVNIQKELR------EEGF-SKDDSDLTAWAEQGVL
UNG_STAAM         ----QAHGLAFSVQPNAKF--PPSLRNMYKELA------DDIGCVRQTPHLQDWAREGVL
UNG_HAEIN         ----QAHGLAFSVKPEVAI--PPSLLNIYKELT----QDISGFQMPSNGYLVKWAEQGVL
UNG_PASMU         ----QAHGLAFSVKPGVVP--PPSLMNMYKELT----QDIEGFQIPNHGYLVPWAEQGVL
UNG_YERPE         ----QAHGLSFSVLPGVPA--PPSLGNIYKELV----TDIPGFQRPNHGFLQSWAEQGVL
UNG_VIBCH         ----QAHGLCFSVLPGVKT--PPSLVNIYKELA----QDIPGFQIPPHGYLQSWAQQGVL
UNG_ECO57         ----QAHGLAFSVRPGIAT--PPSLLNMYKELE----NTIPGFTRPNHGYLESWARQGVL
UNG_ECOLI         ----QAHGLAFSVRPGIAI--PPSLLNMYKELE----NTIPGFTRPNHGYLESWARQGVL
UNG_SALTY         ----QAHGLAFSVRPGIAP--PPSLVNMYKELE----ASIPGFVRPAHGYLESWARQGVL
UNG_NEIMB         ----QAHGLAFSVRQGIRI--PPSLLNIYKELE----TDIEGFSIPAHGCLTAWAEQGVL
UNG_NEIMA         ----QAHGLAFSVRQGIRI--PPSLLNIYKELE----TDIEGFSIPAHGCLTAWAEQGVL
UNG_BUCAI         ----QAHGLSFSVPKHVTI--PPSLKNIYKELN----TDFKKEHIFHHGCLESWANQGVF
UNG_XANAC         ----QAHGLCFSVLPGVPV--PPSLLNIYKEIQ----DDL-GIARPDHGYLMPWARQGVL
UNG_XANCP         ----QAHGLCFSVLPGVPV--PPSLLNIYKEIQ----DDL-GIPRPDHGYLMPWARQGVL
UNG_XYLFA         ----QAHGLCFSVRPGMPL--PPSLLNIYKELE----EDL-GLLRPDHGCLLPWAKRGVL
UNG_PSEAE         ----QAHGLCFSVQPGVPT--PPSLQNIYKELN----RDL-NIPIPNNGYLQRWAEQGVL
UNG_AGRFC         ----QAHGLCFSVQPGVRI--PPSLVNIYKELQ----SDL-GIRPVKHGFLESWAKQGVL
UNG_RHIME         ----QAHGLCFSVRPGVRT--PPSLVNIYKELQ----EDL-GIPPARHGFLESWARQGVL
UNG_HELPJ         QELPVAMGLSFSVEKNAPI--PPSLKNIFKELH-----ANLGVPVPCCGDLSAWAKRGML
UNG_HELPY         QELPVAMGLSFSVEKNAPI--PPSLKNIFKELH-----ANLGVPVPCCGDLSAWAKRGML
UNG_CAMJE         -----AMGLSFSVPKNVKI--PPSLNNIFKELQ-----NDLNITPAKSGDLSSWAKQGVL
UNG_BORBU         ----QANGLAFSVDSKIKI--PPSLQNIFKEIE-----KSLKIKTIPNGDLKRWAIQGVF
UNG_UREPA         ----IANGLCFSVDLGNNL--PGSLINIFKALE------YDLQIKRTNPDLSDWAKQGVL
UNG_MYCPN         ----HACGLSFASNAPKLP---QSLKRMILRLQQEY-PELAGQNHWTKQLLEGWAQQGIL
UNG_MYCGE         ----DACGLAFASNNSKTP---ASLKRIILRLEKEY-PSLKQESSWQQNFLLNWAEQGVL
J3VHG5_MYCGL      ----KANGLAFGVDNNNPP---VSLRNIIKELINNL-KLDEQQLDDFDYSLKSWANQGVL
E4PU96_MYCLG      ----QANGIAFSSNALKTP---PSLKNIFNELYSDL-NIDHFN----NNDLTNWVTQGVF
Q6MTB2_MYCMS      ----QANGIAFSSNALKTP---PSLKNIFNELYSDL-NIDHFN----NNDLTNWVKQGVF
                         *:.*                                       *       ::

C4XE67_MYCFP      LINTCLSVN------ENQPLSHKNFGWEIFVINLIKYILKKNKNVIFGIWGNDAKRILQI
I5D5D5_MYCAA      LLNGVLTVS------ENKPNSHSNFGWKIFVSNLLDFILEQNKNVIFGAWGNKAYLLIK-
Q8EWJ6_MYCPE      LLNTILTVE------KNKSFSHSNKGWEIFTNNAIKYLSETNPNVIYLLMGNNAISLKP-
UNG_MYCPU         LLNRVLSVE------KGLSSSHYNRGWEIFTFNVIDYISKNFENIIFVLWGKKAQDLKK-
UNG1_LISIN        LMNTSWSVE------EGKAGSHKKLGWATFTDHVLEELNNYDKPLVFILWGNHAIKAASG
UNG1_LISMO        LMNTSWSVE------EGKAGSHKKLGWATFTDHVLEELNNYDKPLVFILWGNHAIKAASG
UNG_BACHD         LLNTVLTVR------KGQAASHRGKGWESFTDRVITCLNEREKPVIFVLWGRHAQEKQAL
UNG_BACSU         LLNTVLTVR------RGQANSHKGKGWERLTDRIIDVLSERERPVIFILWGRHAQMKKER
UNG2_LISIN        LLNTVLTVR------AGQANSHRGQGWELLTNRIIEMINQKEEPVVFLLWGNNAKEKLQL
UNG2_LISMO        LLNTVLTVR------AGQANSHRGQGWEILTNHIIEIINQKEEPVVFLLWGSNAKEKLQL
UNG_CLOPE         LLNTVLTVR------EGQANSHKGKGWEIFTDRVIELLNKREEPIVFILWGRNAISKEAL
UNG_FUSNN         LLNTTLTVR------DSEANSHSKIGWQTFTDNVIKSLNEREKPVIFILWGNNAKSKEKF
UNG_DEIRA         LLNAVLTVR------AGQANSHQGKGWEHFTDAVIKAVNAKEERVVFILWGSYARKKKKL
UNG2_STRCO        LLNAVLTVR------AGEANSHKSRGWELFTDAVIRAVAARTDPAVFVLWGNYAQKKLPL
UNG_CHLMU         LLNTVLTVR------AGEAFSHAGRGWEHFTDAIVTKLIQNRTHIIFVLWGSAARKKCDL
UNG_CHLTR         LLNTVLTVR------AGEAFSHAGRGWERFTDAIVTKLIQNRTHVIFVLWGNAARQKCNL
UNG_CHLPN         LLNTVLTVR------AGEPFSHAGKGWELFTDAIVTKLIQERTHIIFVLWGAAARKKCEL
UNG_RALSO         LLNTVLTVE------QGQAASHARRGWERITDCLLEHLARVGHARVFMLWGSHAQAKRAL
F5Y0U9_RAMTT      LLNASLTVE------DGQPGSHARKGWELLTDALLARVAATASPCAYLLWGAHAQAKAGL
B1XSY3_POLNS      LLNTALSVKSALSVKLGGAGSHANLGWKSLIDHLISALSMAKPHLVWMLWGGYAQSKLPL
H7EMR7_9SPIO      LLNTILTFKKKSG--TTGVNAHAGIGWEKFTDAIISALDGREHPPVFLLWGKPAEKKASL
UNG_MYCLE         LLNRVLTVR------PSNPASHRGKGWEVITECAIRALAARSEPMVAILWGRDAATLKPL
UNG_MYCTU         LLNRVLTVR------PSNPASHRGKGWEAVTECAIRALAARAAPLVAILWGRDASTLKPM
UNG1_STRCO        LLNRALTTA------PRKPAAHRGKGWEEVTEQAIRALAARGKPMVSILWGRDARNLRPL
G0HBI2_CORVD      LLNRVLTVQ------AGAAGSDRGTGWEEIAGAVVSHLATR--PVAAVLWGRQAQSVAGL
Q1GY28_METFK      LLNASLTTR------GGVAGAH-SKIWQAFTHAVMRYLGQREAPLVFILWGNHAQQFRPL
UNG_STRP1         LLNACLTVP------AGQANGHAGLIWEPFTDAVIKVLNEKDSPVVFILWGAYARKKKAF
UNG_STRP8         LLNACLTVP------AGQANGHAGLIWEPFTDAVIKVLNEKDSPVVFILWGAYARKKKAF
UNG_STRA3         LLNACLTVP------EHQANGHAGLIWEPFTDAVIKVVNQKETPVVFILWGGYARKKKSL
UNG_STRPN         LLNACLTVP------AGQANGHAGQIWEPFTDAVIQVVNHLDRPVVFVLWGAYARKKKAL
UNG_LACLA         LLNAVLTVP------EFASNAHAGKIWEPLTDEIIKIASDDERPKVFILWGGFARKKAKL
UNG_STAAM         LLNTVLTVR------QGEANSHRDIGWETFTDEIIKAVSDYKEHVVFILWGKPAQQKIKL
UNG_HAEIN         LLNTVLTVE------RGMAHSHANLGWERFTDKVIAVLNEHREKLVFLLWGSHAQKKGQM
UNG_PASMU         LLNTVLTVE------QGKAHSHASFGWETFTDRVIAALNAQREKLVFLLWGSHAQKKGQF
UNG_YERPE         LLNTVLTVE------AGKAHSHANLGWETFTDKVIAALNEHREGVIFMLWGSHAQKKGRI
UNG_VIBCH         LLNTVLTVE------QGMAHSHANTGWETFTDRVIDALNQHRNGLIFLLWGSHAQKKGQM
UNG_ECO57         LLNTVLTVR------AGQAHSHASLGWETFTDKVISLINQHREGVVFLLWGSHAQKKGAI
UNG_ECOLI         LLNTVLTVR------AGQAHSHASLGWETFTDKVISLINQHREGVVFLLWGSHAQKKGAI
UNG_SALTY         LLNTVLTVR------AGQAHSHASLGWETFTDKVISLINQHREGVVFLLWGSHAQKKGAI
UNG_NEIMB         LLNTVLTVR------AGQAHSHALLGWERFTDTVIRQLATHRKHLVFMLWGGYAQQKGRL
UNG_NEIMA         LLNTVLTVR------AGQAHSHALLGWERFTDTVIRQLATHRKHLVFMLWGGYAQQKRKL
UNG_BUCAI         LLNSILTVE------SGKPKSHSNIGWNIFTDKVISVINLYKNSVVFLFWGSNAQKKSHL
UNG_XANAC         LLNAVLTVE------QGRAGAHQNKGWEGFTDHVVETLNREREGLVFLLWGSYAQSKGKV
UNG_XANCP         LLNAVLTVE------QGRAGAHQNKGWEGFTDHVVETLNREREGLVFLLWGSYAQSKGKV
UNG_XYLFA         LLNAVLTVE------DGRAGAHQGKGWEGFTDHVVDTLNREREGLVFMLWGSYAQAKGKV
UNG_PSEAE         LLNTSLTVE------QAKAGSHANAGWQPFTDRVIEVVNERCERLVFLLWGSHAQSKQKL
UNG_AGRFC         LLNSVLTVE------EARAASHQGQGWEKFTDAVIRAVNDECDHVVFLLWGSYAQKKAAF
UNG_RHIME         LLNSVLTVE------RGRAASHQGRGWERFTDAVIRAVNEQAQPVVFMLWGSYAQRKAAF
UNG_HELPJ         LLNAILSVE------KNQAASHKYIGWEAFSDQILIRLFETTTPLIVVLLGKVAQKKIAL
UNG_HELPY         LLNAILSVE------KNQAASHQYIGWEAFSDQILMRLFETTAPLIVVLLGKVAQKKIAL
UNG_CAMJE         LLNSILSVE------ANKAASHSSWGWQEFSDAIIHKLSNEKSGLVFMLWGNYAKNKEIL
UNG_BORBU         LINTILTVE------EGKPSSHKAIGWEIFTDEVIKIISKNLKNIVFMLWGNLARSKKGL
UNG_UREPA         LLNTVLTVN------AHQPNSHKNFGYEELIKNVFNELRKQ-KHVVYLLWGKQAMSYINL
UNG_MYCPN         LLNGVFTTN------AFQTNAHRNWGWEQFNCHLLDFLLSQKLYVLLVFLGKQTENFVLK
UNG_MYCGE         LLNGILTTT------VFIRNAHKNWGWEEFNCNLLTFLKNQNIKPLLVFLGVQTKNFVVK
J3VHG5_MYCGL      LINTILTVK------KQNPLSDQNLGWEELIKFLILKLLENQTQPVFVLWGKKAQGF---
E4PU96_MYCLG      LINTCWTVI------AHKPNSHNNLGWQKITKKILEQIILHNQNVIFCLWGNFAIKMY--
Q6MTB2_MYCMS      LINTCWTVI------AHKPNSHNNLGWQKITKKILEQIILHNQNVIFCLWGNFAIKMY--
                  *:*   :             ..    :  .    .               *  :      

C4XE67_MYCFP      VQNDYKIDENK-IIF-TSHPSPLAYSKTTN------SFKDSKFFIRVNSLLKNPINWDLR
I5D5D5_MYCAA      ----DKVEEER-IIF-TSHPSPLSYSKTKS------SFKDSHFFKKVNAKLTNPIDFSIR
Q8EWJ6_MYCPE      -----LISKSL-AIFETSHPSPFSYRK---------SLMNSKVFKEINKALITNNKKAII
UNG_MYCPU         ----DINFKNH-FILESSHPSPFSANI---------SFFGSQIFLKINKILEQINKEKIN
UNG1_LISIN        ITNPKHL------LIKGVHPSPLAASRG---------FFGSKPFSKTNEFLKENNRTPID
UNG1_LISMO        ITNPQHL------IIKGVHPSPLAASRG---------FFGSKPFSKTNAFLEEHERKPID
UNG_BACHD         ITNDRHY------ILTAPHPSPFSANRG---------FFGSRPFSTINRILQEQGESQIH
UNG_BACSU         IDTSKHF------IIESTHPSPFSARNG---------FFGSRPFSRANAYLEKMGEAPID
UNG2_LISIN        LTNPKHI------AFTSVHPSPLSASRG---------FMGCKHFSKTNHFLEQNGIKPID
UNG2_LISMO        LTNPKHT------AFTSVHPSPLSASRG---------FMGCKHFSKTNQFLEQNGVKPID
UNG_CLOPE         ITNPIHK------IIKSVHPSPLSATRG---------FFGSKPFSKTNDFLVSINKEPID
UNG_FUSNN         IDTNKHY------ILKGVHPSPLSANKG---------FFGCKHFSEANRILKNLGEKEID
UNG_DEIRA         ITGKNHV------VIESGHPSPLSEQY----------FFGTRPFSKTNEALEKAGRGPVE
UNG2_STRCO        IDEARHV------VVKGAHPSPLSAKK----------FFGSRPFTQINEAVAGQGHEPID
UNG_CHLMU         LFQTKHQH----AILACPHPSPLAAHRG---------FFGCCHFSKINYLLKKQGKPMIN
UNG_CHLTR         LFQTKHQH----AVLACPHPSPLAAHRG---------FFGCCHFSKINYLLKKQGKTMIN
UNG_CHLPN         LFNSKHQH----AVLSSPHPSPLAAHRG---------FFGCSHFSKINYLLNKLNKPMIN
UNG_RALSO         LPEGH-------LVLEAPHPSPLSAHRG---------FLGCGHFRAANDWLAAQGQSTID
F5Y0U9_RAMTT      IQAQAAAHGRQALVLQANHPSPLSARRPPVP------FLGCGHFRHARDWLAERGQPGVF
B1XSY3_POLNS      IESGQDQ-----LVLQSSHPSGLGVYKTDKPFLMPGGKASCNHFTKTNQWLADHQIPAIQ
H7EMR7_9SPIO      LKKTPAD-----RILATSHPSPLSARR---------GFIGSGIFKKANDALGDGN--EIE
UNG_MYCLE         LTVDNCV------VIESPHPSPLSASRG---------FFGSRPFSRTNEILVGMGAGPIN
UNG_MYCTU         LAAGNCV------AIESPHPSPLSASRG---------FFGSRPFSRANELLVGMGAEPID
UNG1_STRCO        L--GDLP------ALESAHPSPMSADRG---------FFGSRPFSRANDLLMRLGGQPVD
G0HBI2_CORVD      V--GEDR------CVMSAHPSPLSAYRG---------FFGSRPFSRANGILAAQAAAPVN
Q1GY28_METFK      IA-SWHQ------VISSAHPSPLSAHRG---------FFGSQPYSRVNAALRKLGLGEVQ
UNG_STRP1         ITNPKHH------IIESPHPSPLSSYRG---------FFGSKPFSRTNAILEKEGMTGVD
UNG_STRP8         ITNPKHH------IIESPHPSPLSSYRG---------FFGSKPFSRTNAILEKEGMIGID
UNG_STRA3         IDNPIHH------IIESPHPSPLSAYRG---------FFGSRPFSRTNHFLEEEGINEID
UNG_STRPN         VTNPHHL------IIESAHPSPLSVYRG---------FWGSKPFSKANAFLKETGQEPID
UNG_LACLA         IDGSKHL------ILEAAHPSPLSASRG---------FFGSHPFSKTNEFLVESGQSPID
UNG_STAAM         IDTSKHC------IIKSVHPSPLSAYRG---------FFGSKPYSKANAYLESVGKSPIN
UNG_HAEIN         IDRTRHL------VLTAPHPSPLSAHRG---------FFGCRHFSKTNSYLESHGIKPID
UNG_PASMU         IDRQKHC------VFTAPHPSPLSAHRG---------FLGCRHFSKTNAYLMAQGLSPIQ
UNG_YERPE         INTERHY------ILKAPHPSPLSAHRG---------FLGCKHFSQANQLLQQQNQQPID
UNG_VIBCH         IDRQRHH------VLMAPHPSPLSAHRG---------FLGCRHFSKTNQLLQAQGIAPIN
UNG_ECO57         IDKQRHH------VLKAPHPSPLSAHRG---------FFGCNHFVLANQWLEQHGETPID
UNG_ECOLI         IDKQRHH------VLKAPHPSPLSAHRG---------FFGCNHFVLANQWLEQRGETPID
UNG_SALTY         IDPQRHH------ILKAPHPSPLSAHRG---------FFGCNHFALTNQWLEQHGEKTID
UNG_NEIMB         IDSQNHL------ILTAPHPSPLSAYRG---------FFGCRHFSQANSYLSRHGIDPIN
UNG_NEIMA         IDSQNYL------ILTAPHPSPLSAYRG---------FFGCRHFSQANSYLSRHGIDPIN
UNG_BUCAI         INRKNHY------ILKAAHPSPLSAYRG---------FFGCKHFSLTNKILLKTKKKPIN
UNG_XANAC         IDQTRHR------VLKAPHPSPLSAHRG---------FLGCQHFSKTNDHLRRRGLSPID
UNG_XANCP         IDQARHR------VFKAPHPSPLSAHRG---------FLGCKHFSKTNEHLQRRGLSPID
UNG_XYLFA         IDTRRHL------VLKAAHPSPLSAHRG---------FLGCRHFSLCNQYLSQHGLGMVD
UNG_PSEAE         IDPQRHL------ILKSAHPSPLSAYRG---------FLGNGHFSRTNKFLEQNGKTPID
UNG_AGRFC         VDQRKHL------VLRSPHPSPLSAHNG---------FFGNGHFSKANAFLVSHGRDPID
UNG_RHIME         VDRSRHL------VLTAPHPSPLSAHAG---------FFGCRHFSKANAFLTSKGLDPID
UNG_HELPJ         IPKNKHI------IITAPHPSPLSR-----------GFLGSGVFTSVQKAYREVYRKDFD
UNG_HELPY         IPKNKHI------IITAPHPSPLSR-----------GFLGSGVFTSVQKAYREVYRKDFD
UNG_CAMJE         IDNTKHL------ILKAAHPSPLART----------GFLGCKHFSKANEFLKKVGKIPID
UNG_BORBU         IDPTKHL------ILETSHPSPYSANNG---------FLGSNHFSSALDYLKKHNKNIIN
UNG_UREPA         IDQKQNL------ILCASHPSPLSAHRG---------FLTCKHFSKCNDYLIKHLRTPIK
UNG_MYCPN         KIGGASQF----ASLSYPHPSPLTGRKF--------FDHPDALFKQINQWLKHHNHTPID
UNG_MYCGE         SIGNVDGF----EHLSYPHPSPLSGNLF--------LTNPNDLFKTINNWLKQHNQKIIN
J3VHG5_MYCGL      -LEPYQLK----HVLKSAHPSFFSAKQF--------FNNNH--FNLINELLKTKNEQLIQ
E4PU96_MYCLG      DSLLVKSN----FVIKSAHPSPLSYKGF--------EDTKP--FSQINNLLINLNLEPIN
Q6MTB2_MYCMS      DSLLVKSN----FVIKSAHPSPLSYKGF--------KNTKP--FSQINNLLINLNLDPIN
                                .   ***                      :              . 

C4XE67_MYCFP      KD------------------
I5D5D5_MYCAA      KEN-----------------
Q8EWJ6_MYCPE      W-------------------
UNG_MYCPU         WNIE----------------
UNG1_LISIN        WDLNSK--------------
UNG1_LISMO        WDLNEQ--------------
UNG_BACHD         WEIPNL--------------
UNG_BACSU         WCIKDL--------------
UNG2_LISIN        WQIPSI--------------
UNG2_LISMO        WQIPSI--------------
UNG_CLOPE         WQIPNI--------------
UNG_FUSNN         WQIENKEI------------
UNG_DEIRA         WQLPATVTEE----------
UNG2_STRCO        WTIPNLG-------------
UNG_CHLMU         WKIA----------------
UNG_CHLTR         WKIE----------------
UNG_CHLPN         WKLP----------------
UNG_RALSO         WLRPQAD-------------
F5Y0U9_RAMTT      --------------------
B1XSY3_POLNS      WVDRLQTDLFD---------
H7EMR7_9SPIO      W-------------------
UNG_MYCLE         WRLP----------------
UNG_MYCTU         WRLP----------------
UNG1_STRCO        WRLP----------------
G0HBI2_CORVD      WSLADQEVAP----------
Q1GY28_METFK      WGEPIAR-------------
UNG_STRP1         WLK-----------------
UNG_STRP8         WLQ-----------------
UNG_STRA3         WLN-----------------
UNG_STRPN         WLR-----------------
UNG_LACLA         WSK-----------------
UNG_STAAM         WCESEA--------------
UNG_HAEIN         WQI-----------------
UNG_PASMU         WQLASL--------------
UNG_YERPE         WQPKLPAVE-----------
UNG_VIBCH         WQPELES-------------
UNG_ECO57         WMPVLPAESE----------
UNG_ECOLI         WMPVLPAESE----------
UNG_SALTY         WTPVLPAESE----------
UNG_NEIMB         WKL-----------------
UNG_NEIMA         WKL-----------------
UNG_BUCAI         WFLI----------------
UNG_XANAC         WSLPPRSALDLTSAGA----
UNG_XANCP         WSLPSRAALDLSLAGG----
UNG_XYLFA         WSLPPCIALDGAILNGRIAV
UNG_PSEAE         WSLPDL--------------
UNG_AGRFC         WQLPD----VVEGDKNLL--
UNG_RHIME         WRLPEDPPLAVERQMAPNC-
UNG_HELPJ         FSL-----------------
UNG_HELPY         FSL-----------------
UNG_CAMJE         WKIV----------------
UNG_BORBU         FQ------------------
UNG_UREPA         W-------------------
UNG_MYCPN         WT--NGQVQYQF--------
UNG_MYCGE         WAVVKNASFDQLS-------
J3VHG5_MYCGL      WVKQNK--------------
E4PU96_MYCLG      WSL-----------------
Q6MTB2_MYCMS      WSL-----------------