CLUSTAL format seed alignment for MF_00149

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

MUTL_AQUAE      --------MFVKLLPPEVRKVIAAGEVIESPVDVVKELVENSLDAKATKVEVEIVKGGKR
MUTL_AQUPY      --------MFVKILPPEVRRKIAAGEVIDAPVDVVKELIENSLDAKATRIEIEVVKGGKR
MUTL_THEMA      --------MRIKRLPESLVRKIAAGEVIHNPSFVLKELVENSLDAQADRIVVEIENGGKN
MUTL_CHLCV      ---MSSRNP-IQLLDTITINQIAAGEVIENSISVVKELVENALDAGADEIEVETLGGGQG
MUTL_CHLPN      ---MSTRRP-IQLLDPLTINQIAAGEVIENSVSVVKELIENSLDAGADEIEIETLGGGQG
MUTL_CHLMU      ---MSLSSSRIRLLDSATVNQIAAGEVIENAASVVKELIENALDAGADEISIETLGGGKG
MUTL_CHLTR      ---MSLSPSRIRLLDSVTVNQISAGEVIENAASVVKELIENSLDAGADEIHIETLGGGRG
MUTL_BUCAP      -------MQPIRMLSSSLSSQISAGEVIERPSSVIKELLENSIDAQAKNIDISVERSGLN
MUTL_BUCAI      --------MPIRILPSDLSSQISAGEIIERPASVVKEIIENSIDAGSKNINIIVENSGFQ
MUTL_ECOLI      --------MPIQVLPPQLANQIAAGEVVERPASVVKELVENSLDAGATRIDIDIERGGAK
MUTL_ECO57      --------MPIQVLPPQLANQIAAGEVVERPASVVKELVENSLDAGATRIDIDIERGGAK
MUTL_SALTI      --------MPIQVLPPQLANQIAAGEVVERPASVVKELVENSLDAGATRVDIDIERGGAK
MUTL_SALTY      --------MPIQVLPPQLANQIAAGEVVERPASVVKELVENSLDAGATRVDIDIERGGAK
MUTL_YERPE      --------MPIQILPPQLANQIAAGEVVERPASVVKELVENSLDAGATRIDIDIERGGAK
MUTL_VIBCH      --------MTIRILPARLANQIAAGEVVERPASVVKELVENSLDAGATRIDIDLEKGGAK
MUTL_HAEIN      --------MPIKILSPQLANQIAAGEVVERPASVVKELVENSLDAGANKIQIDIENGGAN
MUTL_PASMU      --------MAIKVLSPQLANQIAAGEVVERPASVVKELVENSLDAGATRIQIDIENGGST
MUTL_BRUME      --------MTIRHLSETIINQIAAGEVIERPASVIKELVENAIDAGATRIEVVTAGGGKT
MUTL_RHILO      --------MPIRQLSETMINQIAAGEVIERPASVVKELVENALDAGASRVEVVTAGGGLN
MUTL_RHIME      --------MAIKQLSETLINQIAAGEVIERPASAAKELIENALDAGATRIEIATAGGGKT
MUTL_CAUVC      --------MPIRRLPPETVNRIAAGEVVERPASAIKELVDNAIDAGATRIEVEAHGGGLT
MUTL_RICCN      --------MTIKFLSESTINRIAAGEVIERPASVVKELVENAVDASSTKIDIILERAGKN
MUTL_RICPR      --------MTIKFLSESTINRIAAGEVIERPASVVKELVENAIDGGSTKIDIILERAGKN
MUTL_NEIMA      -------MPRIAALPDHLVNQIAAGEVVERPANALKEIVENSIDAGATAIDVELDGGGIR
MUTL_NEIMB      -------MSRIAALPDHLVNQIAAGEVVERPANALKEIVENSIDAGATAIEVELAGGGIR
MUTL_PSEAE      ----MSEAPRIQLLSPRLANQIAAGEVVERPASVAKELLENSLDAGSRRIDVEVEQGGIK
MUTL_XYLFA      --------MPIRQLPEILINQIAAGEVVQRPASVVKELVENAIDAGATRVDIELEAAGGR
MUTL_RALSO      MTAATPARRPIRPLPDQLISQIAAGEVVERPASVVKELLENALDAGATQLQIKLEEGGVR
MUTL_LISIN      ------MAKHIVELTDALSNKIAAGEVVERPASVVKELVENAIDAGSTVIDILVEEAGLN
MUTL_LISMO      ------MAKHIVELTDALSNKIAAGEVVERPASVVKELVENAIDAGSTVIDILVEEAGLN
MUTL_BACSU      -------MAKVIQLSDELSNKIAAGEVVERPASVVKELVENAIDADSTVIEIDIEEAGLA
MUTL_BACHD      -------MAKIIKLDDHLSNKIAAGEVVERPASVVKELVENALDANSRKITIEVEAGGLD
MUTL_STAAM      -------MGKIKELQTSLANKIAAGEVVERPSSVVKELLENAIDAGATEISIEVEESGVQ
MUTL_STAA8      -------MGKIKELQTSLANKIAAGEVVERPSSVVKELLENAIDAGATEISIEVEESGVQ
HEXB_STRPN      -------MSHIIELPEMLANQIAAGEVIERPASVVKELVENAIDAGSSQIIIEIEEAGLK
MUTL_STRP1      -------MTNIIELPEVLANQIAAGEVVERPASVVKELVENAIDAKSSQITVEIEESGLK
MUTL_LACLA      -------MGKIIELNEALANQIAAGEVVERPASVVKELVENSIDAGSSKIIINVEEAGLR
MUTL_CLOAB      --------MRINILSEDTSNKIAAGEVVERPFSVVKELVENSIDAGAKTINIEIENGGRT
MUTL_CLOPE      -------MNRINILNADTANKIAAGEVVERPSSVVKELVENSLDAGAKNITIEIQNGGES
MUTL_THEAQ      ---------MIRPLPPELRGLLARGEVLLSVKDAVRELLENALDAGARRVRVELWGGGLE
MUTL_THET8      ---------MIRPLPPELRGLLARGEVLLTVKDAVRELLENALDAGARRVRVELWGGGLK
MUTL_DEIRA      ------MPTPIHVLPPHVARLIAAGEVVSRPLDVVRELVENALDAGASRIEIEVDGGGLE
MUTL_NOSS1      ------MASTIQALPQEVVYLITAGEVIDSFAAVVRELVENSLDAGANRIVVYLWPQQWR
MUTL_SYNY3      ---------MIQVLDRQLVDLIAAGEVIDSPLAVVRELVENALDAGADRILVRVWWDQWR
MUTL_HALSA      ------MTDRIRALDDATVARIAAGEVVERPASVVKELVENSLDAGAASVDVSVDAGGTD
MUTL_TREPA      --MHETSYKPIHRLSPDTAKKIAAGEVIERPASVVRELLENALDAGATKIHLEINAGGCA
MUTL_BORBU      -------MNKIRFLDKYLVQKIAAGESIDRPCSILRELLDNSIDSGATKIEVFLEEGGIQ
                          :  *       :: ** :       :*:::*::*. :  : :        

MUTL_AQUAE      LIRVKDNGTGIHPEDVEKVVLQGATSKIETEKDL----MNISTYGFRGEALYSISSVSKF
MUTL_AQUPY      LIRVKDNGIGIHPEDIEKVVLSGATSKIEKETDL----LNVETYGFRGEALYSISSVSKF
MUTL_THEMA      MVRVSDNGIGMTREEALLAIEPYTTSKIESEEDL----HRIRTYGFRGEALASIVQVSRA
MUTL_CHLCV      LIVVKDNGCGMSSEDVALALKRHATSKIGEFSDV----FSLSSFGFRGEALPAIASISKM
MUTL_CHLPN      AIIIRDNGCGFRAEDIPIALQRHATSKIREFSDI----FSLNSFGFRGEALPSIASISKM
MUTL_CHLMU      QIVVRDNGIGMDADEVAVAIQRHATSKISHFADI----FSLASFGFRGEALPAIASISKM
MUTL_CHLTR      QIVVRDNGVGMDPEEVPVALQRHATSKIAHFADI----FSLASYGFRGEALPSIASISKM
MUTL_BUCAP      SITVKDDGFGIEKDQLLLAISRHATSKINRLSDL----DNINTFGFRGEALASIRAVSRM
MUTL_BUCAI      SIILKDDGCGIDKKDLLLAVCHHATSKINSLSDL----DKLTTFGFRGEALASIRAVSRL
MUTL_ECOLI      LIRIRDNGCGIKKDELALALARHATSKIASLDDL----EAIISLGFRGEALASISSVSRL
MUTL_ECO57      LIRIRDNGCGIKKDELALALARHATSKIASLDDL----EAIISLGFRGEALASISSVSRL
MUTL_SALTI      LIRIRDNGCGIKKEELALALARHATSKIASLDDL----EAIISLGFRGEALASISSVSRL
MUTL_SALTY      LIRIRDNGCGIKKEELALALARHATSKIASLDDL----EAIISLGFRGEALASISSVSRL
MUTL_YERPE      LIRIRDNGCGISKDDLALALARHATSKISSLEDL----EAILSMGFRGEALASISSVSRL
MUTL_VIBCH      LIRIRDNGSGIDKDELGLALSRHATSKIHTLDDL----EAIMSLGFRGEALASISSVSRL
MUTL_HAEIN      LIRIRDNGCGIPKEELSLALARHATSKIADLDDL----EAILSLGFRGEALASISSVSRL
MUTL_PASMU      LIRIRDNGIGIAKDELSLALARHATSKIASLDDL----DNILSLGFRGEALASISSVSRL
MUTL_BRUME      LLRVTDNGSGIPADELALAVSRHCTSKLTDDVHD------IRALGFRGEALPSIGSVSKL
MUTL_RHILO      LIRVTDDGSGIPEPELALAIARHCTSKLAEDIND------IRSLGFRGEALPSIGSVSRL
MUTL_RHIME      LLRVTDNGIGMSPADLELAIRRHCTSKLNDSLAD------IRTLGFRGEALPSIGSVARL
MUTL_CAUVC      RILVADDGCGLSPEELPVAIERHATSKLAPDADGLWDLLRIHTMGFRGEALPSIGSVARL
MUTL_RICCN      LIIISDDGIGMTDKELEIAVERHTTSKFDESDFL-----NINTFGFRGEALPSIAAISKM
MUTL_RICPR      LIIVSDDGIGMTDKELEIAVKRHTTSKLNESDFF-----NIHTFGFRGEALASIAAISKM
MUTL_NEIMA      LIRVSDNGSGIHPDDIELALHRHATSKIKTLNDL----EHVASMGFRGEGLASIASVSRL
MUTL_NEIMB      LIRVSDNGGGIHPDDIELALHRHATSKIKTLNDL----EHVASMGFRGEGLASIASVSRL
MUTL_PSEAE      LLRVRDDGRGIPADDLPLALARHATSKIRELEDL----ERVMSLGFRGEALASISSVARL
MUTL_XYLFA      LIRIRDNGHGMAAQELPLAVLRHATSKIASLDDL----EAVATLGFRGEALPSIVSVSRF
MUTL_RALSO      RIAITDNGGGIPVDELPVALMRHATSKIGSLEEL----ESVATLGFRGEALASIASVAEL
MUTL_LISIN      KITIIDNGSGIEEEDVAIAFLRHATSKIKNEADL----FRVHTLGFRGEALPSIASVSHL
MUTL_LISMO      KITIIDNGSGIEEEDVATAFLRHATSKIKNEADL----FRVHTLGFRGEALPSIASVSHL
MUTL_BACSU      SIRVLDNGEGMENEDCKRAFRRHATSKIKDENDL----FRVRTLGFRGEALPSIASVSHL
MUTL_BACHD      RIRVIDDGDGIEREDVETAFFRHATSKIKTDKDL----FQIATLGFRGEALPSIASVSHV
MUTL_STAAM      SIRVVDNGSGIEAEDLGLVFHRHATSKLDQDEDL----FHIRTLGFRGEALASISSVAKV
MUTL_STAA8      SIRVVDNGSGIEAEDLGLVFHRHATSKLDQDEDL----FHIRTLGFRGEALASISSVAKV
HEXB_STRPN      KVQITDNGHGIAHDEVELALRRHATSKIKNQADL----FRIRTLGFRGEALPSIASVSVL
MUTL_STRP1      MIQVTDNGEGMSHEDLPLSLRRHATSKIKSQSDL----FRIRTLGFRGEALPSVASISKI
MUTL_LACLA      LIEVIDNGLGLEKEDVALALRRHATSKIKDSADL----FRIRTLGFRGEALPSIASVSQM
MUTL_CLOAB      LIKVLDDGYGIDKDDIEKAFMPHATSKISKLQDI----YSINTLGFRGEALPSIASVSKT
MUTL_CLOPE      LIKIIDDGSGVHPEDVEKAFNPHATSKIKDTYDI----FSINTLGFRGEALPSIASIARV
MUTL_THEAQ      RIVVEDDGEGIPLEELPLAVEPFATSKLQ-------DLERIATLGFRGQALYALRQAATL
MUTL_THET8      RLVVEDDGEGIPLEDLPLAVEPYATSKLQ-------DLEGIRTLGFRGQALYALRQAARL
MUTL_DEIRA      RVQVRDNGSGIAAQSVPLAPARHATSKLTAGPET--GSLSVTTLGFRGEALWAAAQAGEL
MUTL_NOSS1      -VRVADNGCGMNLDDLQQAASAHSTSKIRSSADL----WKIHSLGFRGEALHSLTTLADV
MUTL_SYNY3      -LEVLDNGQGMDVTELKTSVLPHATSKISTQADL----QRIKTLGFRGEALHSLAQVARL
MUTL_HALSA      RIVVADDGRGMTGDDLRMAVRQHTTSKLDDASGL----DGVGTLGFRGEALYTIGSVAEL
MUTL_TREPA      LIRVSDNGHGMSPQDLLLCAEAHTTSKISSADDL----LQLRTLGFRGEALASIAAVSRL
MUTL_BORBU      KILIIDNGSGISKEDLKICYLPHTTSKISSEEDL----RKIETLGFRGEALSSIAICSNI
                 : : *:* *.   .         ***:            : : ****:.* :    .  

MUTL_AQUAE      KLRSRFFQEKEGKEIEVEAG----NILGTRRVGM--------PVGTEVEVRDLFFNLPVR
MUTL_AQUPY      RLRSRFYQEKEGREIEVEGG----TLKSVRRVGM--------EVGTEVEVYDLFFNLPAR
MUTL_THEMA      KIVTKTEKDALATQLMIAGG----KVEEISETHR--------DTGTTVEVRDLFFNLPVR
MUTL_CHLCV      EILSCPRAGEGSRTIIHGGE---IVTSEAKPRQ----------VGTTISIDSLFYNVPVR
MUTL_CHLPN      EIQSSIEGDEGVRTVIHGGD---IVSCEPCARQ----------LGTTVIVNSLFYNVPVR
MUTL_CHLMU      EIHTAKVNGLGSKTLIEKGE---PVCCEACPRQ----------PGTTISVNSLFYNVPMR
MUTL_CHLTR      EIHTARAGGLGSKTLIEKGE---PVCCEPAPRQ----------QGTTIAVHSLFYNVPMR
MUTL_BUCAP      KLISCSQNSNIAWSIYSEGF-SNHTLLQPIAHP----------IGTSIIVDNLFYNIPVR
MUTL_BUCAI      TLISCTRFNDVAAKIYLEGFCSKNIILQPIAHP----------EGTTIIVDNLFYNIPVR
MUTL_ECOLI      TLTSRTAEQQEAWQAYAEGR-DMNVTVKPAAHP----------VGTTLEVLDLFYNTPAR
MUTL_ECO57      TLTSRTAEQQEAWQAYAEGR-DMDVTVKPAAHP----------VGTTLEVLDLFYNTPAR
MUTL_SALTI      TLTSRTAEQAEAWQAYAEGR-DMDVTVKPAAHP----------VGTTLEVLDLFYNTPAR
MUTL_SALTY      TLTSRTAEQAEAWQAYAEGR-DMDVTVKPAAHP----------VGTTLEVLDLFYNTPAR
MUTL_YERPE      ILTSRTAEQSEAWQAYAEGR-DMAVTIKPAAHP----------VGSTLEVLDLFYNTPAR
MUTL_VIBCH      TLTSRTVAQEEAWSAYSEGR-DMAVKLQPAAHP----------VGTTVEVLDLFFNTPAR
MUTL_HAEIN      TLTSRTEEQTEAWQVYAQGR-DMETTIKPASHP----------VGTTVEVANLFFNTPAR
MUTL_PASMU      TLTSRPATQNEAWQVYAQGR-EMETTLQPASHP----------VGTTVEVANLFFNTPAR
MUTL_BRUME      TLKSRPQDADSGFEVCVTG--GHLDGPRPTALN----------RGTIVEVRDLFYATPAR
MUTL_RHILO      SIRSRTALGDSAAEIGIEG--GRVLPVRPAAAN----------RGTTVEVRDLFFATPAR
MUTL_RHIME      SITTRTAEAREGAAITVTG--GRSEPARPSAAI----------VGTVVEVRDLFFATPAR
MUTL_CAUVC      QISSRAKGAKDAFSILVEG--GQVGEVAPAAFPG--------PHGARIEVRDLFYATPAR
MUTL_RICCN      LITSKKRDADKAFQIKLIG--GNEKQVTISVHN----------EGTKIEIRDLFFATPAR
MUTL_RICPR      LITSKKREADKAFQIKLIG--GNKQQITVSVHN----------EGTKIEVRDLFFATPAR
MUTL_NEIMA      TLTSRQEDSSHATQVKAED--GKLSSPTAAAHP----------VGTTIEAAELFFNTPAR
MUTL_NEIMB      TLTSRQNDSSHATQVKAED--GKLSSPTAAAHP----------VGTTIEAAELFFNTPAR
MUTL_PSEAE      TMTSRTADAGEAWQVETEGR-DMQPRVQPAAHP----------VGTSVEVRDLFFNTPAR
MUTL_XYLFA      TLMSRRAMDEHGAVLQIEG--GTLGEVIPHAHA----------PGTTVEVRDLFYNVPAR
MUTL_RALSO      TLTSRTAQDAHATQIIAQT-----GRVQPASGG----------VGTTVDVQHLYFNTPAR
MUTL_LISIN      TLETSTGE-TKGTTISLEGG--KIIEQKSGHAR----------KGTQIEVSQLFFNTPAR
MUTL_LISMO      AMETSTGE-TKGTSISLEGG--KIIEQKSGHAR----------KGTQIEVSQLFFNTPAR
MUTL_BACSU      EITTSTGE-GAGTKLVLQGG--NIISESRSSSR----------KGTEIVVSNLFFNTPAR
MUTL_BACHD      QIKTSTGG-DGGTEMVLEGG--VIKKIGSTAMG----------KGTDLTVTQLFYNTPAR
MUTL_STAAM      TLKTCTDN-ANGNEIYVENG--EILNHKPAKAK----------KGTDILVESLFYNTPAR
MUTL_STAA8      TLKTCTDN-ANGNEIYVENG--EILNHKPAKAK----------KGTDILVESLFYNTPAR
HEXB_STRPN      TLLTAVDGASHGTKLVARGG--EVEEVIPATSP----------VGTKVCVEDLFFNTPAR
MUTL_STRP1      TIKTATKEVTHGSLLIATGG--EIETLEAISTP----------TGTKIKVENLFYNTPAR
MUTL_LACLA      TIETSTAEEESGTKLVAKGG--NIETLEPLAKR----------VGTKISVANLFYNTPAR
MUTL_CLOAB      TLKSRTKENEFGREISISGG--SVDYIKDCGTN----------IGTHIEVRDLFYNVPAR
MUTL_CLOPE      DFKSKTEDFDMGKELIISGG--EKESLTDCSMN----------RGTQIEVRDLFFNVPAR
MUTL_THEAQ      KIRSRPRGQVGGGLLLARGE-----RVELRPAPA--------PPGTRVEVLGLFAG----
MUTL_THET8      RIRSRPRGQLGGGLLLAEGE-----RVEVRPVPA--------PPGTRVEVEGLFLG----
MUTL_DEIRA      ELTTRPAAQVGAARLRAQGD-----AVEVSRTSA--------PAGTTVTVSQLFARLPAR
MUTL_NOSS1      EIISR--APENVGWRVVYGDSGKAVHVEATAIA----------PGTVVTVSNLFASCAAR
MUTL_SYNY3      TISSRSVASPGCGWRITYSPQGSPEQIEPVAIA----------MGTRVEVRQLFANFPQR
MUTL_HALSA      TVTTRPRNAGDTGARITVDH-GDAGSVAPAGHP----------AGTTVEVTDLFGETPAR
MUTL_TREPA      HLTSTRSGPLAWHYQPKAAGTAAHVPPVPQGTEAGVLEPASLERGTVVRVEQLFENFPAR
MUTL_BORBU      SITSSTTSNESYQIEVENGI---EKCFKKQPAI----------NGTIVDVTKIFHNFPAR
                 . :                                        *: :    ::      

MUTL_AQUAE      RKFLKKEDTERRKVLELIKEYALTNPEVEFTLFSEGRETLKLKKSS--------------
MUTL_AQUPY      KKFLRKEDTERRKITELVKEYAITNPQVDFHLFSEGKETLNLKKKD--------------
MUTL_THEMA      RKSLKSSAIELRMCREMFERFVLVRNDVDFVFTSDGKIVHSFPRTQNIF------ERALL
MUTL_CHLCV      RGFQKSPQTDRMAMRKLLENRILSVENVGWSWVSERQQEFHIFKHQGFA-----ERVAFV
MUTL_CHLPN      RGFQKSMQSDRLGIRKLIENRILSTANIGWSWISEGHHEIQIAKQQGFQ-----ERVAYV
MUTL_CHLMU      QSFQKSPQMDRLAIRRLLENSILSTEGIKWTWISERRQELNIAKNQGFT-----ERVALV
MUTL_CHLTR      QSFQKSPQMDRLAIRRLLENSVLSSEGIGWTWISECRQELYVAKKQGFI-----ERVALV
MUTL_BUCAP      LKFIKNERSEFLKIDETIKKIALSNFGINIFFKKDKKLFVSYKAITKNN--NKIHRLKTV
MUTL_BUCAI      LKFLKNKKLEFSKICEVVKKIALSHFYINFSLKHNNKLITQYNSINNRK--NKINRLKDI
MUTL_ECOLI      RKFLRTEKTEFNHIDEIIRRIALARFDVTINLSHNGKIVRQYRAVPEGG--QKERRLGAI
MUTL_ECO57      RKFLRTEKTEFNHIDEIIRRIALARFDVTINLSHNGKIVRQYRAVPEGG--QKERRLGAI
MUTL_SALTI      RKFMRTEKTEFNHIDEIIRRIALARFDVTLNLSHNGKLVRQYRAVAKDG--QKERRLGAI
MUTL_SALTY      RKFMRTEKTEFNHIDEIIRRIALARFDVTLNLSHNGKLVRQYRAVAKDG--QKERRLGAI
MUTL_YERPE      RKFMRTEKTEFGHIDEVVRRIALARFDVAINLNHNGKLIRQYRAAPDPA--QHERRLASI
MUTL_VIBCH      RKFLRTEKTEFTHIDELLKRIALSRFDVSFTLRHNGKIVRQYRAATTLP--QQEKRLAAV
MUTL_HAEIN      RKFLRTDKTEFSHIDEVIRRIALTKFNTAFTLTHNGKIIRQYRPAEAIN--QQLKRVAAI
MUTL_PASMU      RKFLRTDKTEFAHIDEVIRRIALAKMAISFTLTHNGKIVRQYRSAHDRT--QKLKRVAAI
MUTL_BRUME      LKFMKTDRAEATAITDVVKRIGIAFPHIRFSLAGTDRTPFEMPATGTGA-EATLERIGQV
MUTL_RHILO      LKFMKGERAESSATSDVVKRIAIAFPAVRFTLAGSDRSTLELPATDDSP-EGSLRRVAQV
MUTL_RHIME      LKFMKSEKAEAAAISEVVRRMAIAFPRVRFVLSGSDRTTLEFPATGDD----RLARMAQV
MUTL_CAUVC      LKFMKSERAEALAITEEIKRQAMANESVGFSLDIDGRRVLRLPPEHPGP-QGRLARLAAV
MUTL_RICCN      LKFLRADKTELTATVDVVKKIALAHPKISFSLTHDGKNLLKLKGQNKDAETNLKQRIIDV
MUTL_RICPR      LKFLRSDKTELAASIDIVKKIALAHPRISFNLIHDNKNLLKLKGQNKDSETNLKQRIIDV
MUTL_NEIMA      RKFLKSENTEYAHCATMIERLALAHPHIAFSLKRDGK----QVFKLPA--QSLHERIAAI
MUTL_NEIMB      RKFLKSENTEYAHCATMLERLALAHPHIAFSLKRDGK----QVFKLPA--QSLHERIAAI
MUTL_PSEAE      RKFLRAEKTEFDHLQEVIKRLALARFDVAFHLRHNGKTIFALHEARDE--LARARRVGAV
MUTL_XYLFA      RKFLRAERTELGHIEEWARSLALAHPDLELRLSHNGK--LSRRYKPGD--WYSDARLIEI
MUTL_RALSO      RKFLKTEQTELGHCLEVIRRTALARPDVAISVHHNGK----PLEHWNA--AQADMRTAAV
MUTL_LISIN      LKYLKSLPTELGNITDILNRLALAHPDISFRFSHNGKPLLQTNGNGDL-----RQVIAAI
MUTL_LISMO      LKYLKSLPTELGNITDILNRLALAHPDISFRFSHNGKPLLQTNGNGDL-----RQVIAAI
MUTL_BACSU      LKYMKTVHTELGNITDVVNRIALAHPEVSIRLRHHGKNLLQTNGNGDV-----RHVLAAI
MUTL_BACHD      LKYVKTVHTELGNISDVVNRLALAHPYVSFQLFHNGKNVLRTSGNGDQ-----LQVIAAI
MUTL_STAAM      LKYIKSLYTELGKITDIVNRMAMSHPDIRIALISDGKTMLSTNGSGRT-----NEVMAEI
MUTL_STAA8      LKYIKSLYTELGKITDIVNRMAMSHPDIRIALISDGKTMLSTNGSGRT-----NEVMAEI
HEXB_STRPN      LKYMKSQQAELSHIIDIVNRLGLAHPEISFSLISDGKEMTRTAGTGQL-----RQAIAGI
MUTL_STRP1      LKYMKSLQAELAHIVDVVNRLSLAHPEVAFTLISDGRQLTQTSGTGDL-----RQAIAGI
MUTL_LACLA      LKYIKSLQAELSHITDIINRLSLAHPEISFTLVNEGKEFLKTAGNGDL-----RQVIAAI
MUTL_CLOAB      EKFLKSTAKEASSISDIVNRLALAHSEISFRLINNGKRVITTYATDNL-----IDTIRAI
MUTL_CLOPE      KKFLKTTARESALINDLVNRISLANPDVSFKLFNNNKKILNTYGNGKL-----IDVIRTI
MUTL_THEAQ      --EGRDPKAEARGVLDLLKRYLLHHPHLSLVLFLEGEARLLFPGAGLKE------AARQA
MUTL_THET8      --EGRDPKGEVRGVLELLKRYLLHHPRLALALFAEGEARLLFPGAGLEE------AARLA
MUTL_DEIRA      LRTQASAAAEVRDITALLGRYVLHHSALHWRLTVDGDPRLTHAPADHRG------AVATV
MUTL_NOSS1      RQGLPTTAQQMKAVQATIQQIALCHPQTTWQVWQNDRIWFTISPAATAG-QLIPQFLPQL
MUTL_SYNY3      RQAFAKSQQFWRPMVTYLQQLALCHPQVTWQLWQDERLRLSLSPGPNPE-AILLQCLKSL
MUTL_HALSA      RKYLKRAATEFGHVNRAVTRYALANPDVAVSLTHDGREVFATTGTGDVQ-----DAALAV
MUTL_TREPA      KRFLGRQSAETTLCRSALIDVSLAHHPVEFRFTVDGTHKLTLLSQQTRK----DRCLETQ
MUTL_BORBU      KRFLKQEPIETKMCLKVLEEKIITHPEINFEINLNQKLRKIYFKESLID------RVQNV
                                      :                                     

MUTL_AQUAE      LKERVEEVF----------QTKTEELYAEREGITLRAFVSRNQ-RQGKYYVFINKRPIQN
MUTL_AQUPY      LKGRIEEIF----------ESIFEEESSEREGIKVRAFISRNQ-KRGKYYLFVNSRPVYN
MUTL_THEMA      ILEDLRKGY----------ITFEEELSGLRIKGIVSSREVTRS-SRTGEYFYVNGRFVVS
MUTL_CHLCV      MGEGFMQEA----------LRVDKGGNLVRVVGFLGSPGFHRP-TRLGQRVFINDRPVDS
MUTL_CHLPN      MGDHFMQDA----------LTIDKEANGVRIVGVLGSPSFHRP-TRQGQKIFINDRPIES
MUTL_CHLMU      MGEAFVNEA----------FLIDKRQNELHLTGFLGSPSMHRS-TRQGQRLFINNRAVES
MUTL_CHLTR      LGESFVQEA----------FFIDKQQGDLRVLGFLGSPNQHRS-TRQGQRLFINNRAVES
MUTL_BUCAP      FNQIDLNYV----------LEIKEKMHNITLFGWLIFPSSLSSTFKKIQYCYVNNRFVYN
MUTL_BUCAI      FDTLDTSEF----------LEIKEKKYRMVLFGWISHPYNFK-KIKNIQYCYVNNRYLYN
MUTL_ECOLI      CGTAFLEQA----------LAIEWQHGDLTLRGWVADPNHTTPALAEIQYCYVNGRMMRD
MUTL_ECO57      CGTAFLEQA----------LAIEWQHGDLTLRGWVADPNHTTPALAEIQYCYVNGRMMRD
MUTL_SALTI      CGTPFLEQA----------LAIEWQHGDLTLRGWVADPNHTTTALTEIQYCYVNGRMMRD
MUTL_SALTY      CGTPFLEQA----------LAIEWQHGDLTLRGWVADPNHTTTALTEIQYCYVNGRMMRD
MUTL_YERPE      CGPAFLQHA----------LAIAWQHGDLNIHGWVADPAASHT-LSEMQYCYVNNRMMRD
MUTL_VIBCH      CGNPFVQHM----------LRIELEHQGLKLHGWITTPEGARQ-QSDLQYCYVNGRMMRD
MUTL_HAEIN      CGDDFVKNA----------LRIEWKHDDLHLSGWVATPNFSRT-QNDLSYCYINGRMVRD
MUTL_PASMU      CGDEFVQNA----------LEIDWKHDDLHLSGWVAQPTFSRT-QNDLSYCYINGRMVRD
MUTL_BRUME      LGREFGENA----------LAIDAERDGVRLAGFVGIPSFNRG-NALHQFAYVNGRPVRD
MUTL_RHILO      MGAEFPDNS----------IAIDAMREGVHLTGHVSIPSFSRA-NALQQYAYVNGRPVRD
MUTL_RHIME      LGRDFRDNA----------IEIDAEREGARLTGFAGVPTFNRG-NSLQQYAFVNGRPVQD
MUTL_CAUVC      LGREFQENA----------LEIDQTRDGVRLSGFAGLPTYNRG-NAAHQYLFVNGRPVRD
MUTL_RICCN      IGDDFIKNA----------AYIDFKTPDFSICGYTSSPTYNRA-SSEDQFLFINNRPVKD
MUTL_RICPR      IGDVFIKNA----------AYIDFKTPDFSICGYTSIPTYNKA-SSEDQFLFINNRPIKD
MUTL_NEIMA      VGDDFQTAS----------LEIDSGSGALRLYGAIAKPTFAKG-KTDKQYCFVNHRFVRD
MUTL_NEIMB      VGEDFQTAS----------LGIDSGNGALRLYGAIAKPTFAKG-KTDKQYCFVNHRFVRD
MUTL_PSEAE      CGQAFLEQA----------LPIEVERNGLHLWGWVGLPTFSRS-QPDLQYFYVNGRMVRD
MUTL_XYLFA      LGEDFAHQA----------LRVDHSGAGLRLHGCIVQPHYSRS-NTDQQYLYVNGRAVRD
MUTL_RALSO      LGTEFARAR----------LPFEEAAGELRLFGFAGLPTASRG-RADHQFFYVNGRFVRD
MUTL_LISIN      YGVSIARKS----------IPVKAESLDFKISGYAVLPEVNRS-NRNYISTIINGRFIKN
MUTL_LISMO      YGISIAKKS----------IPVKAESLDFKISGYAVLPEVNRS-NRNYISTIINGRFIKN
MUTL_BACSU      YGTAVAKKM----------LPLHVSSLDFEVKGYIALPEITRA-SRNYMSSVVNGRYIKN
MUTL_BACHD      YGRTVAKQM----------VPLSGETIDFTVSGFAAKPEVTRA-SRQYMSLLVNGRYIRN
MUTL_STAAM      YGMKVARDL----------VHISGDTSDYHIEGFVAKPEHSRS-NKHYISIFINGRYIKN
MUTL_STAA8      YGMKVARDL----------VHISGDTSDYHIEGFVAKPEHSRS-NKHYISIFINGRYIKN
HEXB_STRPN      YGLVSAKKM----------IEIENSDLDFEISGFVSLPELTRA-NRNYISLFINGRYIKN
MUTL_STRP1      YGLNTTKKM----------LAISNADLDFEVSGYVSLPELTRA-NRNYMTILVNGRYIKN
MUTL_LACLA      YGIGTAKKM----------RQIKGSDLDFELTGYVSLPELTRA-NRNYITILINGRFIKN
MUTL_CLOAB      YGKKICDNV----------ISFERHTDLVSVHGYVGNAEISRG-SRNNQSIFINKRYIKN
MUTL_CLOPE      YGKSTAENL----------IYFEEHKDTASVYGFIGNDTLARA-SRNNQSLFVNKRYVKN
MUTL_THEAQ      FGGLLAERL----------FPLEKG-GAFALEGLLTGPQVSRTRPDLLFLAVNGRPVALP
MUTL_THET8      FGRLLAKRL----------LPLAYGAGGLEVQGLVSRPEVSRTRPDRLFLAVNGRPVAFP
MUTL_DEIRA      YGPLSANRV----------LTLDTP----GVRGVVSRPELTRARRDRMHFAVNGRPIVAP
MUTL_NOSS1      RPSDLQEIKLEIPNPENPQLSTNNKPNASALALVVGLPDRCHRHRPDWVRVAINGRMIKL
MUTL_SYNY3      QAGQLGYTQQSLSLP----VDLENQATSAQLSLTFGYPDRCHRPRPDWLIIAINGRPVNV
MUTL_HALSA      YGREVAQSLRTV-------DADPAADSVERVHGYVSDPEVTRS-TREYLATFVNGRAVTD
MUTL_TREPA      MLKGDPALF----------HTIEGGDCSFHFHLVLSEPAICRR-ERRGIFTFVNGRRIFD
MUTL_BORBU      YGNVIENNK---------FRVLKKEHDNIKIEIFLAPDNFSKK-SKRHIKTFVNRRPIDQ
                                                                     .      

MUTL_AQUAE      KNLKEFLRKVFGYKT------LVVLYAELPPFMVDFNVHPKKKEVNILKERKFLELVREL
MUTL_AQUPY      KNLKEYLKKTFGYKT------IVVLFIDIPPFLVDFNVHPKKKEVKFLKERKIYELIREL
MUTL_THEMA      EELHEVLMKVYDLPKRSYP--VAVLFIEVNPEELDVNIHPSKIVVKFLNEEKVKKSLEET
MUTL_CHLCV      TFISKKISEAYSMLLPPQRYPVFVLKLYLPPEWCDFNVHPQKTEVRILREEFVGEFLSET
MUTL_CHLPN      LFISKKVGDAYALLLPLHRYPVFVLKLYLPSSWCDFNVHPQKIEARILKEELVGDCIKEA
MUTL_CHLMU      SFISRKVAEAYAWMLPAQRYPAFVLKLSVPPMWCDFNVHPQKTEVRLLQEGQIGALLVEA
MUTL_CHLTR      SFISKKVAEAYAWMIPAQRYPIFVLKLFLPPMWCDFNVHPQKTEVRLLQEGQISNLLVEA
MUTL_BUCAP      NLIKSAVFNSFYEIIGNKRSTSFILYLTLPSNEIDINIHPTKNEIKFHKSNIIYFFVYQS
MUTL_BUCAI      NIFVNAVRAAYSKIE-QKKNISFVLYLTIESFNIDINIHPTKNEIKFHNPDVVYTFIYEA
MUTL_ECOLI      RLINHAIRQACEDKLGADQQPAFVLYLEIDPHQVDVNVHPAKHEVRFHQSRLVHDFIYQG
MUTL_ECO57      RLINHAIRQACEDKLGADQQPAFVLYLEIDPHQVDVNVHPAKHEVRFHQSRLVHDFIYQG
MUTL_SALTI      RLINHAIRQACEDKLGADQQPAFVLYLEIDPHQVDVNVHPAKHEVRFHQSRLVHDFIYQG
MUTL_SALTY      RLINHAIRQACEDKLGADQQPAFVLYLEIDPHQVDVNVHPAKHEVRFHQSRLVHDFIYQG
MUTL_YERPE      RLINHAIRQAYQDRLNDAQQPAYVLYLDIDPHQVDVNVHPAKHEVRFHQARLVHDFIYQA
MUTL_VIBCH      KLINHAIRQSYETSLRVDQFATYVLFIELDPHQVDVNVHPAKHEVRFHQARLVHDFIYQA
MUTL_HAEIN      KVISHAIRQAYAQYLPTDAYPAFVLFIDLNPHDVDVNVHPTKHEVRFHQQRLIHDFIYEG
MUTL_PASMU      KIITHAIRQAYADFLSPEQYPAFVLFIDLNPNDVDVNVHPTKHEVRFHQQRLVHDFICQG
MUTL_BRUME      KQIFGALRGAYSDVIARDRHPVAVLFLTLDPALVDVNVHPAKADVRFRDPGLVRGLIVGA
MUTL_RHILO      KLIAGAIRGAFADVLPRDRHAVTVLFLTLDPAIVDVNVHPAKADVRFRDPGLVRGLIVGA
MUTL_RHIME      KLIMSALRAAYAETIPQGRYPIAVLSITLDPALVDVNVHPAKSDVRFRDPGLIRGLIIGA
MUTL_CAUVC      RLLQGALRAAYADFLARDRHPTAALYVTLETTEVDVNVHPAKAEVRFRDPALVRGLIVGA
MUTL_RICCN      KLLQVALRVAYQDYLARDRYPICAIFLQIDPQLVDVNVHPAKAEVRFHDPNYVRNLLIEA
MUTL_RICPR      KLLQVALRVAYQDYLARDRYALCVIFLQIDPQLVDVNVHPAKAEVRFHDPNYVRNILIEA
MUTL_NEIMA      KVMLHAVKQAYRDVLHNALTPAFVLFLDLPPEAVDVNVHPTKTEIRFRDSRQVHQLVFHT
MUTL_NEIMB      KVMLHAVKQAYRDVLHNALTPAFVLFLDLPPEAVDVNVHPTKTEIRFRDSQQVHQLVFHT
MUTL_PSEAE      KLVAHAVRQAYRDVLYNGRHPTFVLFFEVDPAVVDVNVHPTKHEVRFRDSRMVHDFLYGT
MUTL_XYLFA      RSVAHAVKQAYSDVLYQGRHPAYVLFLELDPARVDVNVHPAKQEVRFRDARLIHDFVYRT
MUTL_RALSO      RLLTHAVRSAYEDVLHGDRFPAYVLCLELPPEAVDVNVHPSKIEVRFRDSRAVHQFVYHA
MUTL_LISIN      FALVKAIQEGYHTLLPIGRFPIIVLQIEMDPIIVDVNVHPAKLEVRLSKEKELGQLISQM
MUTL_LISMO      FALVKAIQEGYHTLLPIGRFPIIVLQIEMDPIIVDVNVHPAKLEVRLSKEKELGQLISQM
MUTL_BACSU      FPLVKAVHEGYHTLLPIGRHPITFIEITMDPILVDVNVHPSKLEVRLSKETELHDLIRDG
MUTL_BACHD      VALSKAIQQGFHTLLPIGRYPIAIVNIELDPQLIDVNVHPSKLEVRVSKEEELCRLVTET
MUTL_STAAM      FMLNKAILEGYHTLLTIGRFPICYINIEMDPILVDVNVHPTKLEVRLSKEEQLYQLIVSK
MUTL_STAA8      FMLNKAILEGYHTLLTIGRFPICYINIEMDPILVDVNVHPTKLEVRLSKEEQLYQLIVSK
HEXB_STRPN      FLLNRAILDGFGSKLMVGRFPLAVIHIHIDPYLADVNVHPTKQEVRISKEKELMTLVSEA
MUTL_STRP1      FLLNRAILDGYGSKLMVGRFPIVVIDIQIDPYLADVNVHPTKQEVRISKERELMALISTA
MUTL_LACLA      FLLNRAILEGYGNRLMVGRFPFAILSIKIDPTLADVNVHPTKQEVRLSKERELMALISKA
MUTL_CLOAB      KLITAAVENAVKSFMMINKFPFFIIFLDIFPEFVDVNVHPTKSEVKFQNERDIFKIIFDT
MUTL_CLOPE      RSLTVAVENAFRSFNVTGKFPFFVLFIDTYPELIDVNIHPTKSEIKFKDERFIFKVVFDA
MUTL_THEAQ      EGVLRAVRRAYRELLPEGHYPVGVLNLSLPPGAYRLRLDARKEEVALSK--EAEAFLEEA
MUTL_THET8      EGLLRRVRRAYRELLPEGHYPVGVLNLFLPQEAFRLRLDARKEEVVLSE--EVEALVEEA
MUTL_DEIRA      PELERAVIDAYAELLPAGTAPLCVLDLTVAPEDYDPNIHPAKQVVALADLPAVALRVRDA
MUTL_NOSS1      PELEQTILAAFHRTLPRDRYPLCFVHLLISPDQINWNRNPAKTEIYLHDLSYWQEQVTQA
MUTL_SYNY3      PELTQTILAVFHRTLPRQRYPLCFAHWQLPPQCIDWHRHPAKTEIYLQDLPHWQGQLKTL
MUTL_HALSA      AVLREAVLDGYGDQLAPDRYPFAVLFVDCEG--VDANVHPRKLEVRFEDEAGVKAAVEAG
MUTL_TREPA      YGLVQALVLGSEGYFPNGTFPVACLFLTVNSERIDFNIHPAKKEVHLQDYAHIRHTLSRS
MUTL_BORBU      KDLLEAITNGHSRILSPGNFPICYLFLEINPEYIDFNVHPQKKEVRFYNLPFLFKLISDN
                  .   :                             . .. *    .         :   

MUTL_AQUAE      AGKE--------------------------------------KPIVDIP-LSQPV-----
MUTL_AQUPY      SSRK--------------------------------------HTILEIPTLNQKT-----
MUTL_THEMA      LKRNLAR--------------------------------KWYRSVAYEEISSRAL-----
MUTL_CHLCV      IGEVLAR-PQEVSVF-------------------------ETASTLPALRFFDE------
MUTL_CHLPN      IVETLAC-PPGILCR-------------------------THQEIEESDSVPLP------
MUTL_CHLMU      ISEVLLHRSPSLEEK-------------------------MVEPTMESPLIENG------
MUTL_CHLTR      ISEALLRRSPSLEET-------------------------VLKVPTEKIPIENE------
MUTL_BUCAP      ILSSLKKCKIKYISN-------------------NFFLK-THSNKCKNNNSDSL------
MUTL_BUCAI      VFSYLKKIKEKYYFN-------------------FSCKKQTQLNKEKEFYFYDS------
MUTL_ECOLI      VLSVLQQQLETPLPL-------------------DD-EPQPAPRSIPENRVAAG------
MUTL_ECO57      VLSVLQQQLETPLPL-------------------DD-EPQPAPRPIPENRVAAG------
MUTL_SALTI      VLSVLQQQTETTLPL-------------------E--EIAPAPRHVPENRIAAG------
MUTL_SALTY      VLSVLQQQTETALPL-------------------E--EIAPAPRHVQENRIAAG------
MUTL_YERPE      VTAVLQQTNAPILNI-------------------SEEGEVDAPRWQQENRVAAG------
MUTL_VIBCH      LSSALVQGAQVMAPT-------------------INEGAFHLPHCAEEVNPPVV------
MUTL_HAEIN      ISHALNNQEQINWHT-------------------DQSAVENH---EENTVREPQ------
MUTL_PASMU      ISNALHSEQASLYQT-------------------NEACVSANYQVEESAQHEYR------
MUTL_BRUME      IKQALAQSGIR-------------------------------PATSGAEAMLQA------
MUTL_RHILO      IRQALADAGIR-------------------------------SATTGAAGMMAA------
MUTL_RHIME      IREALTREGDR-------------------------------AATTGAHGLMRA------
MUTL_CAUVC      LRHALAGAGHR-------------------------------ASTTVAAQALDS------
MUTL_RICCN      IKNALTNKSHV-------------------------------TSTTIASDVLEL------
MUTL_RICPR      IKNALTNKSQI-------------------------------TATTIGSD----------
MUTL_NEIMA      LNKALADTRADLTES-------------------VSNAGEVLHDITGVTPAPMPSENDSE
MUTL_NEIMB      LNKALADTRANLTES-------------------VGNAGEVLHDITGVVSTPMPSENDSE
MUTL_PSEAE      LHRALGEVRPD-----------------------------DQLAPPGATSLTEP------
MUTL_XYLFA      VQGTLAQTRAG-----------------------------TPPLAVGAGDVGGE------
MUTL_RALSO      VQRALSRHAGEQGDS-------------------LRTDIADAPEQPGATATPAD------
MUTL_LISIN      IKDAFHQLQLIPDG--------------------EVSKKQKEQQKSEQIQMSFEE-----
MUTL_LISMO      IKEAFHKLQLIPEG--------------------EISKKQKEVQKSEQIQMSFEE-----
MUTL_BACSU      IKDVFKQQQLIPSA--------------------QVPKKSAPAIKNEQQFITFDE-----
MUTL_BACHD      IERAFKKEQLIPEA--------------------TKPTGGK--QKSEQLSFTLDD-----
MUTL_STAAM      IQEAFKDRILIPKNN-----------------LDYVPKKNKVLYSFEQQKIEFEQR----
MUTL_STAA8      IQEAFKDRILIPKNN-----------------LDYVPKKNKVLHSFEQQKIEFEQR----
HEXB_STRPN      IANSLKEQTLIPDAL-----------------ENLAKSTVRNREKVEQTILPLKEN----
MUTL_STRP1      ISESLKEQDLIPDAL-----------------ENLAKSSTRHFSKPEQTQLPLQSR----
MUTL_LACLA      IDEALSEGVLIPEAL-----------------ENLQGRAKEKESLSVQTELPLQNN----
MUTL_CLOAB      VHEGIRNSLKESFKV-----------------EALKEEEDKLFDIKEDVITKN-EI----
MUTL_CLOPE      VHSAMREYVKDTFTLPEEEEKKFEALKEEVIQESLDKEISTLEKLKENINYKVSED----
MUTL_THEAQ      LEEAFRGQNLARALPEP---------------------------RPLPALRPPP------
MUTL_THET8      LLALFRRENLARALPEP---------------------------KPLQPLSPPT------
MUTL_DEIRA      VAGALAGHPLVRAAPALI--------------------------APPEPHPAPT------
MUTL_NOSS1      INQALRISAANIPES------------------------VQTTRVSQLLKAAEE------
MUTL_SYNY3      LHQSLAILGNDAP-----------------------------PRLNQLLKAAEP------
MUTL_HALSA      VRDALLDAGLVRAGAPRGAS-------------KPGDAEISPEHSPTDRDAGAAGG----
MUTL_TREPA      VAHFYRQCTIAHYVR---------------------AEPAHAPATQGNAPTHSSPP----
MUTL_BORBU      INNFFDKNINNYQDI------------------------IIKRQLTEDDHLIEMTN----
                                                                            

MUTL_AQUAE      ------------------------------------------------------------
MUTL_AQUPY      ------------------------------------------------------------
MUTL_THEMA      ------------------------------------------------------------
MUTL_CHLCV      -------------QLPESALEGLQGSNVLPVVKLTPSS----------------------
MUTL_CHLPN      -------------MFRMLETSDVQEEESVEFDQNLFAY----------------------
MUTL_CHLMU      -------------GLEIPSIRPVAISTPLSCPNFL-------------------------
MUTL_CHLTR      -------------GISVPSIRPAIVSAPLSCPTFS-------------------------
MUTL_BUCAP      ------------NTKLVSQIHSKYEKKDLYKDVISTDLFKIN------------------
MUTL_BUCAI      ------------DPTFLTLISSIFLKKKQICKNIKNKIKHNNFIS---------------
MUTL_ECOLI      ------------RNHFAEPA----AREPVAPRYTPAPASGS-------------------
MUTL_ECO57      ------------RNHFAEPA----VREPVAPRYTPAPASGS-------------------
MUTL_SALTI      ------------RNHFAVPAEPTAAREPATPRYSDGASGGNGGR----------------
MUTL_SALTY      ------------RNHFAVPAEPTAAREPATPRYSGGASGGNGGR----------------
MUTL_YERPE      ------------TNKYAQPE----AAKSSAAEQAVARERSSARE----------------
MUTL_VIBCH      ------------PMIDTTQQERVWQAVQNTPDYPRKAPRDNDRDESDNPQVRERAVSNPW
MUTL_HAEIN      ------------PNYSIRPNRATAGQNSFAPQYHEKPQQNQPHFSNT-------------
MUTL_PASMU      ------------PSYS-KPNRAAAGQNIFDSSTTTPSTALFQTNKKN-------------
MUTL_BRUME      ------------FRAEGFGAQQSAPRPANSYSPASWRTAPPAP-----------------
MUTL_RHILO      ------------FRPGAASYNHGGPANGHRSYEAAYRASGSAGFDPA-------------
MUTL_RHIME      ------------FRPEFHRAGQQRPQEPWSAAA---------------------------
MUTL_CAUVC      ------------IRAQQSPFPGYQPQYQPGPSPAGFSAWREGG--WT-------------
MUTL_RICCN      ------------FKNPLVNKQSPVSKVINVNSKS--------------------------
MUTL_RICPR      -------------KNSLVNKEPTIHKATNVNSKA--------------------------
MUTL_NEIMA      NLFNRASDYPTGNKPDTRNAFGSSGKTAPMPYQSAYAPQQRSLSLRE-------------
MUTL_NEIMB      NLFDSVSNYPTGNKSDTHNAFGSSGKTAPMPYQSAYAPQQRSLSLRE-------------
MUTL_PSEAE      -----------RPTGAAAGEFGPQGEMRLAESVLESPAARVGWSG---------------
MUTL_XYLFA      -----------GARPPVRHAVSFSGRRGGASHVLGSYSA---------------------
MUTL_RALSO      -----------NTTRWVNQMAARQTSLGIAQPRAEYLAMMRG------------------
MUTL_LISIN      --------NRQPKEPPTL-----FSKPN---------IPEYVPSDE--------------
MUTL_LISMO      --------NKPAKEIPTL-----FSKPT---------IPEYVPSDE--------------
MUTL_BACSU      --------KPPEKKVPEK-----STAPSYSPMKLSSVVKEPVDAEE--------------
MUTL_BACHD      --------FTSAKPSEDR-----GSTSSNEENEQRSSIDKNVLFQEE----------RKL
MUTL_STAAM      -------QNTENNQEKTF-----SSEESNSKSFMAENQNDEIVIKEDSYNPFVTKTSESL
MUTL_STAA8      -------QNTENNQEKTF-----SSEESNSKPFMEENQNDEIVIKEDSYNPFVTKTSESL
HEXB_STRPN      -------TLYYEKTE--------PSRPSQTEVADYQVELTDEGQDL-------------T
MUTL_STRP1      -------GLYYDPQKNDFFVKESAVSEKIPETDFYSGAVDNSVKVE-------------K
MUTL_LACLA      -------PLYYDNVRQDF------YVREEATFKINKNQASNDSSEQ-------------T
MUTL_CLOAB      -------KHDDKIDGYIKKD--SFPVPVQIPIDLKRPIENYDNSTK--------------
MUTL_CLOPE      -------KKKEEIYSYNPSKDYEAKTEVNIPVDFLSK-ENQDESFS--------------
MUTL_THEAQ      ------------------------------------------------------------
MUTL_THET8      ------------------------------------------------------------
MUTL_DEIRA      ------------------------------------------------------------
MUTL_NOSS1      -----------------------KGNYNFNPRN---------------------------
MUTL_SYNY3      -----------------------KGVYQLQGASSL-------------------------
MUTL_HALSA      -----------GDAAGQSDGNGQRTAASGATSESPASAFETGGGDE--------------
MUTL_TREPA      -----------CTGVREEPAAPCAHTPRYESLFPLPVQHAHLLPP---------------
MUTL_BORBU      -------------QPENFNKINTYDIPQNNNLETEDVNEPNKN-----------------
                                                                            

MUTL_AQUAE      ------------------------------------------------------------
MUTL_AQUPY      ------------------------------------------------------------
MUTL_THEMA      ------------------------------------------------------------
MUTL_CHLCV      --------------------SGSLPFLDREPDPLPVDRQTQ-------------------
MUTL_CHLPN      --------------------SSEDVSLEKQ-EYTSRGPKSQ-------------------
MUTL_CHLMU      ----------------------QQSFVETEANRALCKEQEN-------------------
MUTL_CHLTR      ----------------------QQPYLKTEMATIVSRDSAS-------------------
MUTL_BUCAP      ------------------------------------------------------------
MUTL_BUCAI      ------------------------------------------------------------
MUTL_ECOLI      ------RPAAPWPNAQPGYQKQQGEVYRQLLQTPAPMQKLKAPEPQ--------------
MUTL_ECO57      ------RPAAPWPNAQPGYQKQQGEVYRQLLQTPAPMQKPKAPEPQ--------------
MUTL_SALTI      ------QSAGGWPHAQPGYQKQQGEVYRTLLQTPTTSP---APEPV--------------
MUTL_SALTY      ------QSAGGWPHAQPGYQKQQGEVYRTLLQTPTASP---APESV--------------
MUTL_YERPE      ------RAAPAYKEDHP-YQKQQGELYRQLLQPSAAAKPATSPAAIPASSVSSPSIPVQR
MUTL_VIBCH      VASPKTASTGKERYGSASVSKKEAAVYQTLMQTPDLSDEEPSTASTIVSSI---------
MUTL_HAEIN      PMFPNHVSTGYRDYRSDAPSKTEQRLYAELLRTLPPTAQKDISDTAQQNIS---------
MUTL_PASMU      TQNRPHFSTNIPATRI---SKTEQAAYSALLSN---------SEMATVLPQ---------
MUTL_BRUME      --RSEWSP-QTAHPAHRPLDLQAAPALRENGQAVLGDVAVPAADA--RASV---------
MUTL_RHILO      --RSPQRP-LDMQFGDFERAGARHGGFSEPGQAAFDTGPLVSADA--RVGQ---------
MUTL_RHIME      ---SPHRP-LRFEEAARGFAEAPQAAFSDFAQPSARSAAAAVEAT--RATD---------
MUTL_CAUVC      --PPTQRP-MDLPGLNEVSARVEPSYGGDLAGVVREAYAAAAFED--RPPTDYP------
MUTL_RICCN      ---ADYRPTTHSTLNTVPQNHVCQKLIDTLSHAKIEQEVENRIEHEQQT-----------
MUTL_RICPR      ---SEY----------TSFNFKRNTAYHTLPYGKIEQEVGKCIEHNNQS-----------
MUTL_NEIMA      --SRAAMNTYAELYKKTDDIDLELSQFEQARFGNMPSETPAPKTDTPLSDGIP-------
MUTL_NEIMB      --SRAAMNTYAELYKKTDDIDLELSRFEQARFGNMPSETPAPQTDTPLSDGIP-------
MUTL_PSEAE      --GSSASGGSSGYSAYTRPEAPPSLAEAGGAYKAYFAPLPAGEAPAALPESA--------
MUTL_XYLFA      ---STAPLMQSAPSVSVADAPAAYAALYAAPPTQVIDAVPQMQTGLPLAAGA--------
MUTL_RALSO      --GSAPQPSSRPAWMADVPSAATLFDGAASAPADAAPAQASEPAAAPQADDS--------
MUTL_LISIN      --IVP----------------KEDDFILETMPTYNPETQPEQVEEQKE------------
MUTL_LISMO      --DAP----------------REDDFILETMPPYEPQAEQE--EHSKE------------
MUTL_BACSU      --KLPPLQFDAPPIVDQEQTLEVSDVSAEQPETFEQECHEEQPQPASD------------
MUTL_BACHD      SNDLPSINMVREASASVEPALEKEPPAAELTAGAKGAMEQASMEEETSNSL---------
MUTL_STAAM      ITDDESSGYNNTREKDEDYFKKQQEILQEMDQTFDSNEDASVQNYENKASDDYYDVN---
MUTL_STAA8      IADDESSGYNNTREKDEDYFKKQQEILQEMDQTFDSNDGTTVQNYENKASDDYYDVN---
HEXB_STRPN      LFAKETLDRLTKPAKLHFAERKPANYDQLDHPELDLAS---IDKAYDKLERE--------
MUTL_STRP1      VELLPHSEEVIGPSSVKHASRPQNTFTETDHPNLDLKNRQKLSQMLTRLENE--------
MUTL_LACLA      FDNFTENQLNTDAVSEKMTDRTVESTTEITDNSLENTVSNFEIDFDNEAKIS--------
MUTL_CLOAB      ENKDRSFDDFRE------------------KDIIKETSQEKE------------------
MUTL_CLOPE      INNSLENNEFKEVSAKREISYDPILIKNELKDKVSESTSESLERSDYKCNKNEYGN----
MUTL_THEAQ      ------------------------------------------------------------
MUTL_THET8      ------------------------------------------------------------
MUTL_DEIRA      ------------------------------------------------------------
MUTL_NOSS1      ------------------------------------------------------------
MUTL_SYNY3      ------------------------------------------------------------
MUTL_HALSA      -AADSAASTDGTRERPGSGTESRTGRFDAPAENARLPTGAGGPEADDQDTTS--------
MUTL_TREPA      --------------------SPPHISCEHARDCTHPAPAAEGDAPV--------------
MUTL_BORBU      ------TTQSNIDLRRYNSIIQNRPTLRENIGNIFSDNFLEFEEPPNK------------
                                                                            

MUTL_AQUAE      ------------KTYKPTYEILGQMDETFILVKDSEYLYFVDQHLLEERINYEKLK----
MUTL_AQUPY      ------------ESYKPTYEVIGQLNETFILVSDGNFLYFIDQHLLDERINYEKNG----
MUTL_THEMA      ------------SVAEAPSHRWFLVKGKYAVVEVEDGLLFVDLHALHERTIYEEILSKKS
MUTL_CHLCV      -----------ISWGASQEVRFLTSLGKIVLAEDSEGVHAIFTESARKHLFYLSLVENH-
MUTL_CHLPN      -----------MDWIYSSDVRFLTSLGRVVLAEDLEGVHIIFTAAARKHLFFLSLMQEN-
MUTL_CHLMU      -----------LALPIIERVRFLASLGKVILVEDSEGVHALFVQAARKHLFYISLLSKRS
MUTL_CHLTR      -----------SSLSVVEKVRFLTSLGKVLLVEDSEGVHVVFVQAARKHLFYVSLLSERL
MUTL_BUCAP      ---SQRFLKEYF---FSFGKLLIVFQKYYGLMYYSNTFSLISFPLAKKIVEQYKLRSAI-
MUTL_BUCAI      ---KSTPLEKYE---SSIGRLLIIIHKYYGLIYHDNNFLLLSFPVAKGIVRKQKLKNNI-
MUTL_ECOLI      ----EPALAANS---QSFGRVLTIVHSDCALLERDGNISLLSLPVAERWLRQAQLTPG--
MUTL_ECO57      ----EPALAANS---QSFGRVLTIVHSDCALLERDGNISLLALPVAERWLRQVQLTPG--
MUTL_SALTI      ----APALDGHS---QSFGRVLTIVGGDCALLEHAGTIQLLSLPVAERWLRQAQLTPG--
MUTL_SALTY      ----TPALDGHS---QSFGRVLTIVGGDCALLEHAGTIQLLSLPVAERWLRQAQLTPG--
MUTL_YERPE      ITQAEEPLHGDN---YSFGRVLTVFPPCYALIEYQGGVALLSLAVAERWLKQAQLSPP--
MUTL_VIBCH      ---EAVKANIAI---EKLGKAIQVVAGQYLLMSSPQGCVLISLYQAQQLKLRGLLNAQ--
MUTL_HAEIN      --DTAKIISTEIIECSSHLRALSLIENRALLLQQNQDFFLLSLEKLQRLQWQLALK----
MUTL_PASMU      --EDGALLERKT---PSILKALALVENKALLLQQQQQFYLLSLQQLQRLKIELSLQ----
MUTL_BRUME      ------AEAPVELMQKPLGAARAQIHENYIVAQTEDSLVIVDQHAAHERLVYEALKNALH
MUTL_RHILO      ------NETTETLLGTVLGAARAQVHENYIVAQTRDSLVIVDQHAAHERLVYEALKNALH
MUTL_RHIME      ------GQAA----SFPLGAARAQLHENYIVAQTDDGLVIVDQHAAHERLVFETMRTALH
MUTL_CAUVC      -----GATAPFDPVDYPLGAARAQVHETYIVAQTRDGMVIVDQHAAHERLVYERMKGEMA
MUTL_RICCN      ------------RKQYKLGAAKAQLHTTYIISQTEDSIVITDQHAAHERLGYEKIKDYLK
MUTL_RICPR      ------------HKQYKFGVAKAQLHTTYIISQTEDSIVIIDQHAAYERLGYAKIKYCLK
MUTL_NEIMA      ----------SQSELPPLGFAIAQLLGIYILAQAEDSLLLIDMHAAAERVNYEKMKRQRQ
MUTL_NEIMB      ----------SQSELPPLGFAIAQLLGIYILAQAEDSLLLIDMHAAAERVNYEKMKRQRQ
MUTL_PSEAE      ------------QDIPPLGYALAQLKGIYILAENAHGLVLVDMHAAHERITYERLKVAMA
MUTL_XYLFA      ------------GDVPPLGYAIAQLHGIYILAECADGLIVVDMHAAHERIGYERLKRAHD
MUTL_RALSO      ------------DDAHPLGFAVAQLHGIYVLAQNARGMVLVDMHAAHERILYEQLKTALE
MUTL_LISIN      --------------RIPKMYPIGQMHATYIFAQNENGLYIIDQHAAQERIKYEFYREKIG
MUTL_LISMO      --------------RIPKMYPIGQMHATYIFAQNENGLYIIDQHAAQERIKYEFYREKIG
MUTL_BACSU      --------------RVPIMYPIGQMHGTYILAQNENGLYIIDQHAAQERIKYEYFREKVG
MUTL_BACHD      -----------PANRVPTMYPIGQMHGTYILAQNDQGLYIIDQHAAQERMKYEYFREKVG
MUTL_STAAM      --DIKGTKSKDPKRRIPYMEIVGQVHGTYIIAQNEFGMYMIDQHAAQERIKYEYFRDKIG
MUTL_STAA8      --DIKGTKSKDPKRRIPYMEIVGQVHGTYIIAQNEFGMYMIDQHAAQERIKYEYFRDKIG
HEXB_STRPN      -----------EASSFPELEFFGQMHGTYLFAQGRDGLYIIDQHAAQERVKYEEYRESIG
MUTL_STRP1      -----------GQSVFPELDYFGQMHGTYLFAQGKDGLFIIDQHAAQERVKYEYYRDKIG
MUTL_LACLA      -----------QSSTFPQLEYLAQLHATYLLCQSKEGLYLVDQHAAQERIKYEYWKDKIG
MUTL_CLOAB      ----TYDIITNKKAKFPELRVIGQFNNTYILAESFEELYIIDQHAAHEKILFEKYREDIK
MUTL_CLOPE      ----SIEEIIYREAKFPKLRVIGQFNKTYILAEYDSTLYLIDQHAAHEKILFEKYSSDIA
MUTL_THEAQ      ------------LPACPPCATWATFRESYLLAEAEDAVYIVDQHAAHERILFEELLARLR
MUTL_THET8      ------------ASGLPRLRFLAQFRESYLLAEAGDTLYVVDQHAAHERILYEDLLKRVA
MUTL_DEIRA      ------------AGNFPDLTLLGVYQELYLLAQGEGDLWVVDAHAAHERALYERLGRELG
MUTL_NOSS1      --------ANPADNTQNYLKAVAQVSNTYIVAEHPGGMWLVEQHIAHERVLYEQLCDNWR
MUTL_SYNY3      --------TETVLGYPKAFKAIAQVCQTYVVVEHDQGIWLVEQHVAHERVLFEQLQRHWQ
MUTL_HALSA      -----------ERDSLPDLRVLGQLHDTYVVAEAGDGLVLVDQHAADERVHYERLQARVD
MUTL_TREPA      ----------HNHTHTGAFKVLGQVAGTFIAVERNNALYLIDQHAAHERIIFDTLQRNLG
MUTL_BORBU      -----------NEKEEIKFNYIGQIFSEFLIVEKINEIYFIDQHAVHEKIIYEKLRNSKK
                                                                            

MUTL_AQUAE      ------------------------------------------------------------
MUTL_AQUPY      ------------------------------------------------------------
MUTL_THEMA      WGKRRVKRNITVVLSREEKQKLEEYGFSFQGEEGALKVIEIPEFLTED-VVEEFFRDFPV
MUTL_CHLCV      -QHNYKSQSFLVPLCLEVT-PQERIFLSSHIEEFKLLGIEISQMGPCV-FSIESAPTFIG
MUTL_CHLPN      -SRMYQSQALLIPLRLQVT-PEEAFFFSHHGRTLCDLGIEISQVGPCV-FSIESTPTVIG
MUTL_CHLMU      -DSLLACQMFLVPPTVQMT-KLEADFLQTRLESLAAQGIELCRISPDS-FAIESAPPFIQ
MUTL_CHLTR      -ESRLACQTFLLPSSVQMT-KLEADFLQMRLEALTALGIELSRISPDS-FAIESAPPFIQ
MUTL_BUCAP      -KNNMIPEIFSYNFLYFIT-FKQNKILSNNLKLLLKFGFNLILKEKY--FFLKTIPIFLK
MUTL_BUCAI      -QKENIIEYFLSNIKINLT-SQEYLILFNKKEILSKFGFHLIFKKKY--VILSSIPAFLK
MUTL_ECOLI      -EAPVCAQPLLIPLRLKVS-AEEKSALEKAQSALAELGIDFQSDAQH--VTIRAVPLPLR
MUTL_ECO57      -EAPVCAQPLLIPLRLKVS-GEEKSALEKAQSALAELGIDFQSDAQH--VTIRAVPLPLR
MUTL_SALTI      -QSPVCAQPLLIPLRLKVS-ADEKAALQKAQSLLGELGIEFQSDAQH--VTIRAVPLPLR
MUTL_SALTY      -QSPVCAQPLLIPLRLKVS-ADEKAALQKAQSLLGELGIEFQSDAQH--VTIRAVPLPLR
MUTL_YERPE      -EEGLRPQPLLIPLKITLD-KNEIAACQNHEKLLITMGIELSVEQGR--ATLRAVSLPLR
MUTL_VIBCH      -HGALKAQPLLVPLALKLN-ESEWQVAQRHSSALLQLGIELKSRTNHS-IMVMAVPQPLR
MUTL_HAEIN      -QIQIEQQALLIPIVFRLT-ESQFQAWQQYSDDFKKIGFEFIENQAQLRLTLNKVPSALR
MUTL_PASMU      -RDPVLQQPLLIPIVFRLN-PQQLTYWQQQKTFFTQIGFEFHENLGQQRITLNRVPSCLR
MUTL_BRUME      ARP-IAGQMLLIPEIVDLP-EEDAQRLAGHAETLARFGLGVEQFGPGA-IAVRETPAMLG
MUTL_RHILO      SRP-VPSQMLLLPEIIDLP-EEDAERLAMHSETLARFGLGIERFGPGA-VAVRETPSMLG
MUTL_RHIME      ARP-VPAQALLIPEIVGLP-EDDCDRLMAHAEEFTRLGLAIERFGPAA-VAVRETPAMLG
MUTL_CAUVC      SGG-VTRQTLLLPEVVDLD-PAEAERVVARAEELAGLGLVLESFGPGA-VLVRETPALLG
MUTL_RICCN      TEE-LIKQRLLIPEIVELPNEKKADCLYDHREKLYKLGLTLEKFGEKS-IIVTEIPNILG
MUTL_RICPR      NGE-LVKQRLLIPEIVELSSQKKADCLYENREKLFKLSLTIEKFGEKS-IIVTEIPNILG
MUTL_NEIMA      ENGRLQSQRLLIPITFAAS-HEECAALADYAETLAGFGLELSDMGGNT-LAVRAVPTMLG
MUTL_NEIMB      ENGNLQSQRLLIPVTFAAS-HEECAALADYAETLAGFGLELSDMGGNT-LAVRAVPAMLG
MUTL_PSEAE      SEG-LRGQPLLVPESIAVS-EREADCAEEHSSWFQRLGFELQRLGPES-LAIRQIPALLK
MUTL_XYLFA      GIG-LRTQPLLVPMTLMVA-EREADVAECEAETLASLGFEVTRSGPGS-LQVRSIPALLA
MUTL_RALSO      ARR-IEVQPLLIPVTFAAS-PVEIGTAEEFGDTLDLLGFDISAVSPTT-LAVRAVPTLLQ
MUTL_LISIN      -EVSRELQELLVPIVLEFP-SDEYVRLEEQKAKLEEVGVFLENFGQNS-FIIRAHPTWFP
MUTL_LISMO      -EVSRELQELLVPIVLEFP-ADEYVRLEEQKAKLEEVGVFLENFGQNS-FIIRAHPTWFP
MUTL_BACSU      -EVEPEVQEMIVPLTFHYS-TNEALIIEQHKQELESVGVFLESFGSNS-YIVRCHPAWFP
MUTL_BACHD      -EVTNELQELIVPITVECT-LQEAAYIEEHLEDLKQVGLFFEEFGPQT-FMIRQHPTWFP
MUTL_STAAM      -EVTNEVQDLLIPLTFHFS-KDEQLVIDQYKNELQQVGIMLEHFGGHD-YIVSSYPVWFP
MUTL_STAA8      -EVTNEVQDLLIPLTFHFS-KDEQLVIDQYKNELQQVGIMLEHFGGHD-YIVSSYPVWFP
HEXB_STRPN      -NVDQSQQQLLVPYIFEFP-ADDALRLKERMPLLEEVGVFLAEYGENQ-FILREHPIWMA
MUTL_STRP1      -EVDSSLQQLLVPYLFEFS-GSDFINLQEKMALLNEVGIFLEVYGHNT-FILREHPIWMK
MUTL_LACLA      -EVSMEQQILLAPYLFTLA-KNDFIVLAEKKDLLHEAGVFLEEYGENQ-FILREHPIWLK
MUTL_CLOAB      -NKGVSSQILITPSVVELL-PEDFIYYDENKEVFKNAGFVIEYFGDNT-VAIKEVPLFLG
MUTL_CLOPE      -KKKVEIQPLMIPLVVTLP-TEDYLYYDENKEIFEKAGFKISDFGDNS-IRIEEVPYFLD
MUTL_THEAQ      EEGLKPLPYPVLVELDEE------------PPEASPL-FGIEGFGPGR-VRLLSAPPFLH
MUTL_THET8      E-GPKPLPRPLLVPLAPEE----EALLEAGQEALAAL-FRWEPFGPGR-VRLLMAPAFLH
MUTL_DEIRA      TAAPLELPTPELLHLTPEQ----TARLHERGAELRGWGLTIEDFGAGL-ARLRTLPAALA
MUTL_NOSS1      ---LIPVEPPIILYQLSPA----------QVAQLQRIGLDIDIFGEQL-WAVRNLPAMLQ
MUTL_SYNY3      ---CLPLEQPLVLQGFNPE----------QVERLQNLGLEIDPFGEDI-WAVRSLPALLQ
MUTL_HALSA      ----GASQALVAPAELELT-AGEAAVFEAALGGLRELGFDAELAGRTA--RVTAVPAVLA
MUTL_TREPA      -----TAQILLIPYHIHPRSDEEARIMHRACTELSPAGFRFHEEPDGS-WHVTAVPLHWR
MUTL_BORBU      -----NVQKLLVPIEFTVVDKNIEEIIDSEIEEYKQMDIIISKIGPKK-YQLESIPNICS
                                                                            

MUTL_AQUAE      DENLACRISVKAGQKLS-------------------------------EEKIRELIKTWR
MUTL_AQUPY      NEELACRISVKAGEKLT-------------------------------NEKIKELIKEWK
MUTL_THEMA      DEKLKERIALAACKLATKSGEF--------------------------DEEIASKLLDVF
MUTL_CHLCV      EEELKLWILSLAAE-SAKVDK----RAMTLLIKEALTQTIFCKTLRAFDISWLSLLWQLG
MUTL_CHLPN      EEELKEWLLLLAARGSTDINS----EALTALMKETLTQATFSKHQHVFDVSWLKLLWSVG
MUTL_CHLMU      EEELKEWIISLAHEGAFQVN-----ESFEQLVENTVQKLAFSKNTRAFDHSWINVLWQIG
MUTL_CHLTR      EEELKEWIVALAQEGALHVG-----ESFEQLVENTVQKLVFSRNARAFDYAWLDILWKLG
MUTL_BUCAP      NQNLDVLLSSFFSFIFFKKK------IYIKDIIKWFDTTILIEKNSWNYEDGISILLEIE
MUTL_BUCAI      KCNFHIIISNFFAFLFLKKQ------VFISDIVDWFYINVFIELKNWTYIRGIEVLLEIE
MUTL_ECOLI      QQNLQILIPELIGYLAKQSV------FEPGNIAQWIARNLMSEHAQWSMAQAITLLADVE
MUTL_ECO57      QQNLQILIPELIGYLAKQSV------FEPGNIAQWIARNLMSENAQWSMAQAITLLADVE
MUTL_SALTI      QQNLQILIPELIGYLAQQTT------FATVNIAQWIARNVQSEHPQWSMAQAISLLADVE
MUTL_SALTY      QQNLQILIPELIGYLAQQTT------FATVNIAQWIARNVQSEHPQWSMAQAISLLADVE
MUTL_YERPE      QQNLQKLIPELLGYLSQHEE------ISPDTLATWLARHLGSEHEVWNVSQAIQLLTEVE
MUTL_VIBCH      QQNLQQLLPDLLSYAASCSES---QALSHQALADWLTQRIVVEKRDYTLAEAIGLIAELE
MUTL_HAEIN      TQNLQKCVMAMLTRDENS-----------SSFLTALCAQLECKT-FNALADALNLLSETE
MUTL_PASMU      QQNLQKCIIVLLSQPLDTF----------SHFLTTLCDVIELEQ-ITVYADAVTLLTETE
MUTL_BRUME      EMNVQQLIRDLADEIAEHDTADGLKAMLHHVAATMACHGSVRSGRRLKPEEMNALLRDME
MUTL_RHILO      ETNVQQLVRDLADEIADNDTVETLKERLDKIAATMACHGSVRSGRLLKAEEMNALLRQME
MUTL_RHIME      EMDAAGLVRQLADELAEWDTASGLAGRLEYLAATMACHGSVRSGRRLRTEEMNALLRQME
MUTL_CAUVC      KTDAAALVRDIADDLAENGQALALKERLEEVCSTMACHGSVRAGRRLNGAEMNALLREME
MUTL_RICCN      DVNVQKLIQDLADHLSDFGKNIALTELIEHVTETYACHYSIRAGRKLSADEMNALLRQME
MUTL_RICPR      DVNVQKLIQDLADHLSDFAKNMPLKELIEHVIKIYICHYSIRAARKLSADEMNSLLRQME
MUTL_NEIMA      KADVVSLARDVLGELAQVGSSQTIEEHENHILATMSCHGSVRAGRQLTLPEMNALLRDME
MUTL_NEIMB      KADVVSLAKDVLNELAQVGSSQTIEEHENRILATMSCHGSIRAGRRLTLPEMNALLRDME
MUTL_PSEAE      QAEATQLVRDVIADLLEYGTSDRIQAHLNELLGTMACHGAVRANRRLTLPEMNALLRDME
MUTL_XYLFA      QAEPEILLRDVLSDLSEHGHTRRVAEARDTLLATMACHGAVRAQRRLSISEMNALLRDME
MUTL_RALSO      KADAQALARDVLRDLQAYGGSRVLAERQNELLATLACHSAVRANRRLNLDEMNALLRQME
MUTL_LISIN      KDQEEEMLREIIDEALSAPSIS-IHKLREDTAIMMSCKKSIKANHYLTMQDMEALLDTLR
MUTL_LISMO      KDQEEEMLREIIDEALSAPSIS-IHKLREDTAIMMSCKKSIKANHYLTTQDMEALLDTLR
MUTL_BACSU      KGEEAELIEEIIQQVLDSKNID-IKKLREEAAIMMSCKGSIKANRHLRNDEIKALLDDLR
MUTL_BACHD      KGLEEETIREMIDQLMEKRKVD-IKKLREEVAILMSCKAAIKANRHLRHDEMYALLEALR
MUTL_STAAM      KDEVEEIIKDMIELILEEKKVD-IKKLREDVAIMMSCKKSIKANHYLQKHEMSDLIDQLR
MUTL_STAA8      KDEVEEIIKDMIELILEEKKVD-IKKLREDVAIMMSCKKSIKANHYLQKHEMSDLIDQLR
HEXB_STRPN      EEEIESGIYEMCDMLLLTKEVS-IKKYRAELAIMMSCKRSIKANHRIDDHSARQLLYQLS
MUTL_STRP1      EEEIASGVYEMCDMLLLTNEVS-IKTYRAELAIMMSCKRSIKANHSLDDYSARNLLLQLA
MUTL_LACLA      ETEIEKSINEMIDIILSSKEFS-LKKYRHDLAAMVACKSSIKANHPLDAESARALLAELA
MUTL_CLOAB      KPLVKDLFLEIIDNLKNMGSGE-TSEVKYRSIATAACKSAVKAYHELTHDEMKTLIQDLR
MUTL_CLOPE      KLNPTELITSMINNLKKMGTGE-TVEVKYNKIASMSCRAAVKANDVLSILEMENLIEDLR
MUTL_THEAQ      PYPLL-PPEIFRESLKGEGRSR-----LRGLLARLACLPALKAGHPLARAEGQALLDALL
MUTL_THET8      PYPLL-LPEVFKEALRGEGRS------LKALLARLACLPAVKAGHPLGEAQGQALLDALL
MUTL_DEIRA      ALPVPRLHEVVVETALSGGPDP-----RREVLARLACLPALKAGM-LDAERGALVLAALR
MUTL_NOSS1      QREDCAEAILELSWGGDLQTAQ----------VAVACRSAIRNGTPMSLPEMQKLLDDWQ
MUTL_SYNY3      GQEEIIAILRELSQVFSLSTAQ----------AAIACRSAIKNGMELDRIAINKLIEQWQ
MUTL_HALSA      DALDAELARDVLSSFLADADGTPVADAADAVLADLACSPAIKGNTSLAEGSVVALLDALD
MUTL_TREPA      GSEEQLAHDILYSGKNAHDILR-------HVLATCACRSACKDGTILDDATLHSLVEQAF
MUTL_BORBU      QYENTLINFFQSRRSRTINSLE------SDLYATIACRKAVKRNDMLSAEFSKFLINEFF
                                                                       :    

MUTL_AQUAE      NLENPHVCPHGRPIYYKIPLREIYEKVGRNY--------------------------
MUTL_AQUPY      KLENPHVCPHGRPIYYKLPLKEVYEKLGRSF--------------------------
MUTL_THEMA      FKKRFERCPHGRPISFKISYEDMDRFFER----------------------------
MUTL_CHLCV      KPEKAFDGSQIRRLVLDEDFIKE----------------------------------
MUTL_CHLPN      KPEKGFDGARIRRLILDSDFMEG----------------------------------
MUTL_CHLMU      KPEKAFDGETIRRLVLEEDFM------------------------------------
MUTL_CHLTR      KPEKAFDGEMIRRLVLDDDFM------------------------------------
MUTL_BUCAP      YFCPSIFKKPPLKLLQKINVDEVLCILKV----------------------------
MUTL_BUCAI      YYCPLLLINPPSKLLQKININAALCILKI----------------------------
MUTL_ECOLI      RLCPQLVKTPPGGLLQSVDLHPAIKALKDE---------------------------
MUTL_ECO57      RLCPQLVKTPPGGLLQSVDLHPAIKALKDE---------------------------
MUTL_SALTI      RLCPQLVKAPPGGLLQPVDLHSAMNALKHE---------------------------
MUTL_SALTY      RLCPQLVKAPPGGLLQPVDLHSAMNALKHE---------------------------
MUTL_YERPE      RLCPQLVQSPPAGLLQPIDIKAALATLTHE---------------------------
MUTL_VIBCH      QLWQGNLPLQDPHFITLVDFSASITALHS----------------------------
MUTL_HAEIN      RLLTQTNRTAFTQLLKPVNWQPLLDEI------------------------------
MUTL_PASMU      QLLNQKQAIRLSELFIELNWQAYLEKM------------------------------
MUTL_BRUME      ATPGSGTCNHGRPTYIELKLTDIERLFGRR---------------------------
MUTL_RHILO      ATPGSGTCNHGRPTYIELKLADIERLFGRR---------------------------
MUTL_RHIME      ATPGSGQCNHGRPTYIELKLADIERLFGRS---------------------------
MUTL_CAUVC      ATPHSGQCNHGRPTYVELKLADIEKLFGRR---------------------------
MUTL_RICCN      NTPLSGQCNHGRPTYIELKLKDIERLFGR----------------------------
MUTL_RICPR      NMSFSAQCNNNRPTYIELKLKDIELLFRL----------------------------
MUTL_NEIMA      NTPRSNQCNHGRPTWVKLTLKELDALFLRGQ--------------------------
MUTL_NEIMB      NTPRSNQCNHGRPTWVKLTLKELDALFLRGQ--------------------------
MUTL_PSEAE      ITERSGQCNHGRPTWTQLGLDELDKLFLRGR--------------------------
MUTL_XYLFA      ATERSGQCNHGRPTWARFSLAEIDRWFLRGR--------------------------
MUTL_RALSO      ATERADQCNHGRPTWIQLTVADLDRLFLRGQ--------------------------
MUTL_LISIN      EASDPFTCPHGRPVIIQYSTYELEKMFKRVM--------------------------
MUTL_LISMO      EASDPFTCPHGRPVIIQYSTYELEKMFKRVM--------------------------
MUTL_BACSU      STSDPFTCPHGRPIIIHHSTYEMEKMFKRVM--------------------------
MUTL_BACHD      KSSDPFTCPHGRPIIVQITTYEMEKMFKRVM--------------------------
MUTL_STAAM      EAEDPFTCPHGRPIIINFSKYELEKLFKRVM--------------------------
MUTL_STAA8      EAEDPFTCPHGRPIIINFSKYELEKLFKRVM--------------------------
HEXB_STRPN      QCDNPYNCPHGRPVLVHFTKSDMEKMFRRIQENHTSLRELGKY--------------
MUTL_STRP1      QCQNPYNCPHGRPVLINFSKADMEKMFRRIQENHTSLRELGKY--------------
MUTL_LACLA      TCKNPYSCAHGRPTIVHFSGDDIQKMFRRIQETHRSKAASWKDFE------------
MUTL_CLOAB      FAEDPFNCPHGRPTIVRLTVTDFEKKFKRIQ--------------------------
MUTL_CLOPE      YINDPFHCPHGRPTIIKFTSYELDKKFKRIT--------------------------
MUTL_THEAQ      ACETPWVCPHGRPVLLHLKEEDLIRRFGRRSGARAKEEPHPHPPRETTREGS-----
MUTL_THET8      ACETPWACPHGRPVLLALKEEDLIRRFGRRSGARGGGEARPRPQEESFPEAPLPREP
MUTL_DEIRA      ECEQPWACPHGRPTVLRLSERDLAHAFGRR-GVRDVARGRDSVV-------------
MUTL_NOSS1      RTRNPRTCPHGRPIYLSLDESSLSRFFRRHWVIGKSHGI------------------
MUTL_SYNY3      QCDNPHTCPHGRPIYLALDESSLARFFRRNWLVNPKTSGS-----------------
MUTL_HALSA      ACENPYACPHGRPTIVEVDGDELAARFERDYPGHAGRRREDAGN-------------
MUTL_TREPA      ALPQS-RCPHGRPIWIVIGRDELFKRIKRT---------------------------
MUTL_BORBU      K-LEIKHCPHGRKIYYKISKFELEKKVDRA---------------------------