CLUSTAL format seed alignment for MF_00150

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

ARGC_PASMU        ---------MQKAIIIGASGYTGAELARLLIKHPEFEL--TGLYVSRQSQDANKCISDIY
ARGC_VIBVU        ---------MLKTTIIGASGYTGAELALMVEKHPELTL--AGLYVSANSTDAGKCISQLH
ARGC_ECOLI        ---------MLNTLIVGASGYAGAELVTYVNRHPHMNI--TALTVSAQSNDAGKLISDLH
ARGC_MORPR        ---------MLKTILVGATGYTGAELAHYITKHPELEL--AGLYVSEHSLDAGKPFSSLY
ARGC_BUCAP        ---------MLNVLIVGASGYSGAELVNYINRHMFSKI--KKIFVSENSSHIGKLFSELH
ARGC_SHEON        ---------MKNIAIIGASGYTGAQLTALVHAESELSI--QGLYVSENSLDKGRALADLY
LYSY_AERPE        ------MARAVRAGILGASGMTGGELLRILASHPGVE-----VEWATSREYAGKPVHTAH
LYSY_SACS2        ------MKDKVRVAVVGGSGYTGGELLRILVTHPKTE-----ISVITSREYAGKPVSLIH
LYSY_PYRAE        ----------MKVCIIGASGFVGGELLRILLQHSGVE-----VVCATSRRFKGEYVYRVH
LYSY_DEIRA        -----MSTEKKTVAIVGGSGYAGGEFLRLALGHPHLE-----VTQVTSERSAKLPVSMVH
LYSY_THET2        -------MDKKTLSIVGASGYAGGEFLRLALSHPYLE-----VKQVTSRRFAGEPVHFVH
V6KID2_STRNV      -----------------------------------ME-----IAAVTSSRLAGRRVDGGH
LYSY_PYRHO        ---------MIKVAIVGGSGYIGGELIRLLAMHPEVE-----IVAVTSREYAGKKVHKVH
ARGC_ARCFU        ----------MKVGIIGASGYTGSELLRILANHPEAE-----VIAASSRRYEGQKIWKVH
ARGC_METMA        ------MNTMIKAGIIGASGYTGGELLRLLVSHPDVS-----LELATSRSLAGKPVASTH
ARGC_METJA        ---------MKEVAIIGATGYTGAELLRLLANHEKVN-----VTYITSRKEAGKHVFKVH
ARGC_METTH        ---------MISVGIIGASGYTGGELLRLLENHREVE-----VVSATSRQYSGVPVSRVH
ARGC_METKA        ---------MVVVGIVGASGYTGGELLRLLARHPEVEE----VRYATSRRLEGKPVWKVH
ARGC_PSESM        ---------MVKVGIVGGTGYTGVELLRLLAQHPQAE-----VVVITSRSEAGLPVADMY
ARGC_NITEU        ---------MINAGIVGGTGYTGVELLRILVQHPKVK-----LKVITSRQEAGTGVDELF
ARGC_BORPE        --MAQASNSRIKVGIVGGTGYTGVELLRLLSQHPHVE-----LTAITSRKEDGLPVADMY
ARGC_NEIMB        ------MSKKIKVGIVGATGYTGVELLRLLAAHPDVE-----VAAVTSRSEAGTAVADYF
ARGC_BACHD        ----------MKVGIVGATGYGGLELIRLLSQHPNVE-----EIICYSSSQEGLPLDDMY
ARGC_BACSU        ----------MKIGIVGATGYGGTELVRILSHHPHAE-----ECILYSSSGEGNVYSEGY
ARGC_BACAN        ----------MKVAIIGATGYGGIELIRLLEQHPYFS-----IASLHSFSQVGECITNVY
ARGC_OCEIH        ---------MKKAAIIGGTGYGAIELIRLLDSHPYIE-----LAKIISQSQHGELLDETY
ARGC_STAES        ----------MHISIVGITGYTGLELLRLALNHPHVT-----VSSIHATKEVGVQISDIF
ARGC_STRMU        ----------MKVSIVGITGYSGLELVRILNGHQKVE-----LVSVHATKEIGTKLSDIY
ARGC_LACLA        ---------MKKVAIVGIRGYSGLELFRIFYYHPEVE-----VTKIYATSHYGEKLSEHF
ARGC2_LACPL       ----------MQVALVGVTGYSGMVLYRLLKQHPEID-----RIQLYGHVGATTVALKTV
ARGC_LISMO        ----------MKVSIIGATGYGGLELIRLLHQHSSVD-----IATLHSFSAQAETLATFY
ARGC_STAAW        ---------MIKVGIVGGSGYGAIELIRLLQTHPHVT-----IAHIYSHSKVDEPLKLTF
ARGC_CAMJE        --------MKIKVGILGASGYAGNELVRILLNHPKVE-----ISYLGSSSSVGQNYQDLY
ARGC_CLOAB        ---------MIQAGIIGATGYAGEVLTWLLNNHPNVN-----LVFLASHSHGNSSFNSTY
ARGC_NOSEL        ----MGNFGRVPVGIVGASGYGGVQLVRLLMDHPEIE-----LVYLGGESSVGKSFASLY
ARGC_SYNY3        ----MGN-EKARVGIIGASGYGGIQLVRLLLEHPQVE-----LTYLAGHSSAGKPYSDLY
ARGC_GLOVI        ------MAEKLRVGIVGASGYGGVQLVRLLLDHPRVE-----IAYLGANQNAGTPFGELY
ARGC_THENN        ---------MIRVGIVGATGYTGIELFRLLKKHPSAK-----IVYMSSRTYAGKKMMEVY
ARGC_CALS4        ---------MIKVGIFGATGYTGVELMRLLSKHEKVK-----IEYISSQSYAGKSIADVY
ARGC_STRCL        --------MTVRVAVAGASGYAGGEVVRLLLGHPA-----ESWVALTAFSQAGQAVG--H
ARGC_STRCO        --------MAVRAAVAGASGYAGGELLRLLLTHPE-----VEIGALTGNSNAGQRLGALQ
ARGC_MYCTU        -MQNRQVANATKVAVAGASGYAGGEILRLLLGHPAYADGRLRIGALTAATSAGSTLGEHH
ARGC_CORGL        --------MTIKVAIAGASGYAGGEILRLLLGHPAYASGELEIGALTAASTAGSTLGELM
ARGC_BIFLO        -------MAKYTVAVAGATGYAGGEALRILAAHPD-----FDITCVAGHSSVGESMAKHM
ARGC_RHOCB        --------MTQKIAILGASGYTGAELARIIATHPE-----MEITALSGDRKAGMRMGEVF
ARGC_LEPIN        ---------MAEISILGAGGLTGKELLLLFSRQKEHE-----VVHITSDKLAGKTISEVF
ARGC_RHOBA        -----MSSSNLRVALVGSTGYTALEVARLLLTHPGAD-----LVVATSRQDEGKPLSEIH
ARGC_AQUAE        ------MEQTLRVSVFGATGYTGIELLRSLLTHPHFE-----VKNLISQSYKGKKVREVL
ARGC_CHLTE        MNHIPMQNKKVTVSVIGASGYSGAELVKLLMKHPGIV-----IEELYAHTQAGKRFTELY
ARGC_XANC8        -----MTVQPTTIGIVGARGHTGAELIKLIAAHPQLQ-----LVFVSSRELAGQRVAEHS
ARGC_XANAC        -----MTVQPKTIGIVGARGHTGSELIKLVAAHPQLH-----LSFVSSRELAGQRVAEHN
D2U8N1_XANAP      -----MSTSVYSICIVGARGHTGAELIRLIAAHPQLC-----LAFVSSRELDGQRVDVHH
ARGC_XYLFT        -----MSTATFTLGIVGARGYTGAALITLLTAHPAIE-----LIFVSSREYHGQPVAAHN
Q0ASS8_MARMM      -------MSARRVGLVGARGHTGRELLRLIGERDDLD-----LVFASSREWAGRPVAEMA
C7R8V4_KANKD      --MSHSNSQPISVALIGARGYVGEELIRLLNQHPVFE-----LALAVSRSKQGQAVNGYS
ARG56_YEAST       -<PEGVNTNPGRVALIGARGYTGKNLVSLINGHPYLE-----VAHVSSRELKGQKLQDYT
ARGC1_LACPL       ----------MKVGILGGSGYAGAELYRLLLNHPNFN-----VTFISSEKYAGKPVEKML
                                                                              

ARGC_PASMU        PQLKHLVDLPLQPLPEQLT--QLAQQADLVFLATAHEVSHDLAPIFLQNQC--------K
ARGC_VIBVU        GKLAGVIEMPVLPLTDPL---GVAQDSDVIFLATAHEVSHDLAPLFLQQGC--------Q
ARGC_ECOLI        PQLKGIVDLPLQPMSDIS---EFSPGVDVVFLATAHEVSHDLAPQFLEAGC--------V
ARGC_MORPR        GHLLGVVDQTIEPLAVSNIK-NICDDVDIVVLATAHEVSHDIAAEFLAQDT--------V
ARGC_BUCAP        QEFKNIIDLPFEAINYDTL---IEKDIDAVFLATDHHVSYSLVPFFLSLNC--------V
ARGC_SHEON        PVYSH-IELTLSPLTEEAKA-NIVAEADAVVLATEHSVSLHLAAWFYSQGL--------A
LYSY_AERPE        PHLRGFYT-GLKYTSIDKI---DIGEVDVVFNALPHGVGASIVAEAYENGV--------R
LYSY_SACS2        PNLRGLISLNFTNFSIDKI---S-DKADAIFLALPHGVSLNYAPKLLDLGL--------T
LYSY_PYRAE        PNLRGFTQLKFVEPSIDAA---L--KADVVFLALPHGESVKWVPKLYESGV--------A
LYSY_DEIRA        PNLRGATNLKFRK----AA---ELEEADIIVLALPHNSAAKRITEFEAKGK--------V
LYSY_THET2        PNLRGRTNLKFIP----PE---KLEPADILVLALPHGVFAREFDRYSALAP--------I
V6KID2_STRNV      PNLRGRTDLAYVS----PE---DLPECDVLFFTGSTVADREGRAALTARGK--------I
LYSY_PYRHO        PNLRG-LNLRFTS----DY---NF-DADVIFLAVPHGVSMKLINEFLGSAK--------I
ARGC_ARCFU        RFLKG-FYDLEFCSPELSN---FGD-CDLVFTAVPHGEAMKYVPQLLDSGI--------K
ARGC_METMA        RHLEG-FLDLKYENPGLEE---IRERCDLVFLAVPHGTGMNYVPELLDGST--------K
ARGC_METJA        PHLKGIEKYKNLCFTGDID---K-VDAYLVFTATPHGASMDIVPDFIERGM--------K
ARGC_METTH        PHLQDTDLKFEDVGAGEID-------ADLVFTATPHGASMKIVPQLIERGI--------R
ARGC_METKA        PNLRRDYPDLEFSDPDPVE---IGEDCDVVFTAVPHTAAMELVPDLLEGGA--------V
ARGC_PSESM        PN-LRGHYDGLAFSVPDVK---TLGACDVVFFATPHGVAHALAGELLAAGT--------K
ARGC_NITEU        SS-LRGQI-ALKFSDPAKV---DFSKCDVVFFATPNGIAMQQAKALLDSGI--------K
ARGC_BORPE        PN-LRGRV-KLAFSAPEKA---SLTDCDVVFFATPHGVAMAQAAELLAAGT--------R
ARGC_NEIMB        PS-LRGVY-GLAFQTPDEA---GLEQCDIVFFATPNGIAMKDAPRLIEQGV--------R
ARGC_BACHD        PH-LSGNVRWTLKAIDPEA---IRADVDTVFLATPPGVSGELTPDLVKLGL--------K
ARGC_BACSU        PH-LTGLADQQLKPIDMNT---IKHEIDIMFLAAPPGVSSELTPKLADAGI--------T
ARGC_BACAN        PH-FQNVLVHTLQEIDVEE---IEKEAEIVFLATPAGVSAELTPKLLAVGL--------K
ARGC_OCEIH        PH-LATYVTQPMQELHIQQ---LIEEIDIVFLATPAGVAKEIAASFLDSSI--------Q
ARGC_STAES        PH-LKGIFDKEIQVFDSEF---IMTHSDLVFFATPSGVAKDLSKNFVKNNF--------P
ARGC_STRMU        SY-LKGICDLEIQSFDSQK---IMATADLVFFATPSGVAKELAKDFIAADF--------P
ARGC_LACLA        PQ-LEGLTDLTISEFNEEE---IMAECDAVFFATSAGVSQKLALTFIDNNF--------P
ARGC2_LACPL       AA-MYQKETAVIRPFDATA---IMRDNAIVFFATSAGITRQLALPFIAAHF--------P
ARGC_LISMO        PH-LKDLAVSPLEKINPTE---IIEKSDTVFIATPSGIAKDIALPYVDAGL--------N
ARGC_STAAW        PH-LQHIM-QHFEALTVD-----NNDCDVIFFATPAPVSKTCIPPLVEKGI--------H
ARGC_CAMJE        ---PNTPLNLCFE-NKNLD---ELE-LDLLFLATPHKFSAKLLNENLLKKM--------K
ARGC_CLOAB        GNFTNVIENLCIDDNEVED---NLDNIDILFTALPSGKTFSIVKKAVEEKV--------K
ARGC_NOSEL        PH-LAHAVKLSIEEVDPEV---IARRCEVVFLSMPNGLACQIVPTLLEKGC--------K
ARGC_SYNY3        PH-LTHRVNLTIEPIDLEA---IASRCDAVFLGLPNGLACDMAPALLAKGC--------K
ARGC_GLOVI        PQ-LAHRIDRVCEAVELDR---IVEACSVVFLATPNGIAHTLAPGLLAGGL--------R
ARGC_THENN        PS-T--LEEAVLEDFDSRK---ISESCDVVFTALPAGVSYRLAMEL--QNV--------K
ARGC_CALS4        PS-LTGFYDISLDDVEVEK---AVSKCDVVFTALPAGYASKIAREAVKKGV--------K
ARGC_STRCL        PHLGPVAGRVFEPISAQAP----LAGHDVVFLALPPAQSAAL-AEEAGARV--------V
ARGC_STRCO        PHLLPLADRVLEATTPEV-----LGGHDVVFLALPHGQSAAV-AEQLGPDV--------L
ARGC_MYCTU        PHLTPLAHRVVEPTEAAV-----LGGHDAVFLALPHGHSAVL-AQQLSPET--------L
ARGC_CORGL        PHIPQLADRVIQDTTAET-----LAGHDVVFLGLPHGFSAEI-ALQLGPDV--------T
ARGC_BIFLO        PHIPQLANLVVEDTAPEV-----LNGHDVIILALPHGASGKL-ASQLDPNA--------V
ARGC_RHOCB        PHLRHIGLPDLVKIEEID-----FSGIDLAFCALPHATSQAV-IAELPRDL--------K
ARGC_LEPIN        PE-VSFPKNLVFKKHEDIV---PLKS--LVVLAVPNEVSVESAPKFLDAGH--------K
ARGC_RHOBA        PM-LAGRCDVTLQPLDADV---IAKSADVAMCCLPHGASAESVKQLAEAGM--------R
ARGC_AQUAE        PF-FSNTYISEIEFLEEPV---EDYE--LAFLCLPHEVSYEIVPKLLSQGK--------K
ARGC_CHLTE        PS------IPCDKTFQTYA---GQTNSDVYLLALPHGEALQLVPGIVAAGK--------K
ARGC_XANC8        DGYEGELRYESLDADAVAAK-----AADVVILALPNGKAEPFVAAIDANRP------QTL
ARGC_XANAC        DAYQGQLRYENLDADAVAVK-----AADVVILALPNGKAAPFVAAIDAATP------QTL
D2U8N1_XANAP      DAYQGELRYENLDPEAVAAK-----RADVVVLALPNGKAAPYVAALEAAQQADATAVDPV
ARGC_XYLFT        PTYCGDLRFETLDPAAVAAK-----RADVVILALPNGNAAPYVHAIDATAP------PTL
Q0ASS8_MARMM      PEITNGLDFEALSPDDVAAR-----KVDAVILALPNGAAAPFVAAIADDCV---------
C7R8V4_KANKD      N---NTLYYQDATPAQVAEG-----NYDLIFLALPNGLAQSYVTEIDRLSS------QSV
ARG56_YEAST       KSEIIYESLQIQDIRKLEEQN----AVDFWVMALPNKVCEPFVETIQSVHG------KSK
ARGC1_LACPL       KGFAHNGHSHNLRFNHLDD---LPFDLDFVFSALPTGVLPKYVEKILEKTS--------L
                                                .                             

ARGC_PASMU        VFDLSGAFRVNNAAFYRTFYGF--EHQHPELLTQAVYGLAEWN------------AHQIK
ARGC_VIBVU        VFDLSGAFRVKGDDFYTQFYGF--AHQHSEWLDKAAYGLAEWN------------EEAIK
ARGC_ECOLI        VFDLSGAFRVNDATFYEKYYGF--THQYPELLEQAAYGLAEWC------------GNKLK
ARGC_MORPR        VFDLSGAFRVNDPAFYENYYGF--KHNFDKELQSAVYGLAEWA------------SADIA
ARGC_BUCAP        VFDLSGAYRVKNTDTYLKYYGF--SHQHQDILKRSVYGLAEWN------------KQEIK
ARGC_SHEON        VFDLSGAYRFSDVAQYPKWYGF--EHEYPEVLAKAVYGLAEWN------------AKDVA
LYSY_AERPE        VVDLSADYRLRDQSLYPKLYGFK--HPRPDLLEEAIYALPEIY------------GEKLR
LYSY_SACS2        VVDLSADFRLKNPELYKIWYNYE--HPYPDLLDKAVYGLPELH------------YEELK
LYSY_PYRAE        VFDLSADFRLKDPNAYVEWYKWPQPHPYPDLLQKAVYGQPELH------------RSELV
LYSY_DEIRA        IVDLSADFRLKDPEVYERFYGEP--HPAPEQLGQWVYGNPELH------------REDLR
LYSY_THET2        LIDLSADFRLKDPELYRRYYGE---HPRPDLLGCFVYAVPELY------------REALK
V6KID2_STRNV      VYDLSPDLRLADPAVYRRHYGE---HPAPELLGTAVVGLPELY------------RTRLR
LYSY_PYRHO        I-DLSADFRVRK-ELYEKYYGK---HERPELIEDFVYGLPEIH------------RKEIK
ARGC_ARCFU        VVDISADYRL-DKETYERVYGK--KHEGY---VEAVYGLTELH------------REEIK
ARGC_METMA        VIDLSADYRL-DIPVFEKIYGI--KHSDP---RNAVYGLVELH------------PEAAR
ARGC_METJA        VIDLSGDYRFEDLSLYEKYYKI--KHKGL-PDVKIAYGLPELH------------REEIK
ARGC_METTH        VVDLSGDYRFDDTETYEEWYGI--KHE---SPLEAVYGLPEIH------------REEIA
ARGC_METKA        VIDLSADFRFDDVDVYEEWYGV--EHAAPELNDEAVYGLPELH------------RDEIR
ARGC_PSESM        VIDLSADFRLQDPVEWAKWYGQ--PHGAPELLQDAVYGLPEVN------------REQIR
ARGC_NITEU        VIDLAADFRIKDVAEWEKWYGM--THAAPELVAEAVYGLPEVN------------REKIR
ARGC_BORPE        VIDLAADFRLQDTAVFERWYKI--PHTCPDILADSVYGLVELN------------REAIS
ARGC_NEIMB        VIDLSADFRIRDIPTWEHWYGM--THAAPDLVSQAVYGLSELN------------REAVA
ARGC_BACHD        VIDLSGDLRINEPDVYEAWYKR--QAAPVGTIRGAVYGLTEWQ------------RDEIA
ARGC_BACSU        VIDLSGDLRIKEPAEYEKWYKR--TAAPKAVIQEAVYGLAELN------------QLQIQ
ARGC_BACAN        VIDLSGDFRMKDPFIYEQWYKR--AAAKEGVLREAVYGLSEWK------------RSEIQ
ARGC_OCEIH        CIDLSGDLRLSSS-DYEMWYQK--KPASEALLEKTAYGLTEVF------------QEKIK
ARGC_STAES        VIDLSGDHRLSP-DVYLKWYKK--SPCTVDIQKRFTYGLSEVM------------N-ISH
ARGC_STRMU        VIDISGDHRLPA-AIYEKWYKK--AAAEQASLDKFTYALAELT------------D-VKG
ARGC_LACLA        VIDLSGDFRLADLEIYNKWYKN--TNLKNEYLLSGQYNLADIG------------Q-AKA
ARGC2_LACPL       VIDLSGDFRLHDPEQYQRWYQR--DPASATALAQASYGLADMP------------A-PLS
ARGC_LISMO        VIDLSGDFRLKDRQLYEKWYGK--SAAPTEYIGKAEYGLAEFR------------E-KKE
ARGC_STAAW        VIDLSGAFRIKNREIYEAYYKE--TAAAQDDLNHAIYSISEWQ------------SFDNN
ARGC_CAMJE        IIDLSADFRLKNPKDYELWYKF--THPNQELLQNAVYGLCELY------------KEEIK
ARGC_CLOAB        VIDLGADYRLKSAEVYKEWYNI--NHECKKLLKDAVYGLSEIY------------REKIK
ARGC_NOSEL        VLDLSADYRFRNLTTYTTWYGV--ERSDRTTADTAIYGLPELY------------RDRIS
ARGC_SYNY3        VLDLSADYRFRNLNTYTEWYKK--DRQDQATNNQAVYGLPELY------------RDAIR
ARGC_GLOVI        VFDLSADYRFVNLETYQSWYGG--DRHDAAVAREAVYGLPELY------------RERIR
ARGC_THENN        IIDLGADFRFDDPNTYAEWYGN--K-LEDYNSTERVYGLPELY------------RDSIK
ARGC_CALS4        VIDLGADFRFDDYSTYKEWYGG--E-YDGYDGIKRAYGLPEIY------------RDSIK
ARGC_STRCL        DRNMGADFRLRDAGVWERFYGS--PWRGC-----WPYGLPES----------PGAREALA
ARGC_STRCO        VVDMGADFRLKDAGDWERFYGS--PHAGT-----WPYGLPEL----------PGARAALE
ARGC_MYCTU        IIDCGADFRLTDAAVWERFYGS--SHAGS-----WPYGLPEL----------PGARDQLR
ARGC_CORGL        VIDCAADFRLQNAADWEKFYGS--EHQGT-----WPYGIPEM----------PGHREALR
ARGC_BIFLO        VVDLGADHRLEEQAAWDEFYGG--DFYEH-----WTYGMPELITGKAADGSYTRQRAALP
ARGC_RHOCB        VVDLSADFRLRDAAEYEKWYGK--PHAAMDLQAEAVYGLTEF------------YREELK
ARGC_LEPIN        VIDLSGVYRLHNQEILEKYYKL--KHTRFNYINRAVFGIPEIF------------RDQLK
ARGC_RHOBA        VIDFSADFRLSSLETYQHWYGV--KHPWPERIGDVVYGMPEFF------------ADEIR
ARGC_AQUAE        VVDLSGAYRIKSPKAYEEFYGF--KHEREDILQRAVYGLPEVF------------REEIK
ARGC_CHLTE        VIDLSGDFRLKNTAEHKRFYGG-----DKSAEDVLQYGMPELF------------RDEIA
ARGC_XANC8        LIDLSADYRF---------------------DPAWYYGLPELT------------RHTYA
ARGC_XANAC        VIDLSADYRF---------------------DPAWYYGLPELT------------RGSYA
D2U8N1_XANAP      IVDLSADYRF---------------------DPSWYYGLPELT------------RTRYA
ARGC_XYLFT        IIDLSADTRF---------------------DPDWYYGLPELT------------RHTYT
Q0ASS8_MARMM      IVDLSADYRF---------------------DEAWTYGLPEIYG-----------RDSLI
C7R8V4_KANKD      IVDLSADYRF---------------------DKSWYYSLPELS--------------QTT
ARG56_YEAST       IIDLSADHRFVS-------------------ESDWAYGLPELND-----------RAKIA
ARGC1_LACPL       IFNVSGDFRFKDATTLQQYYPE--TLAIESDQILSSYYIPEFS-------------DFDK
                    : .   *.                              :                   

ARGC_PASMU        QTDLVAVAGCYPTVSQLSLKPLIAHNL-LDLTQLPVINAVSGVSGAGRKAT---LTSSFC
ARGC_VIBVU        ASQLVAVAGCYTTAAQLAIKPLLISQL-VDTNQWPVINATSGVSGAGRKAS---MTNSFC
ARGC_ECOLI        EANLIAVPGCYPTAAQLALKPLIDADL-LDLNQWPVINATSGVSGAGRKAA---ISNSFC
ARGC_MORPR        EANLIAVPGCYPTASLSALKPLAKHGL-ISTDQKPIINAVSGVSGAGRKAS---LASAFC
ARGC_BUCAP        KAELIAVPGCYATCIQLALKPLIKENF-LNDEFIPIINAISGVSGAGRKAN---ITNSFC
ARGC_SHEON        ATKMIAVPGCYPTASLTALKPLKN----LLTSAYPVINAVSGVTGAGRKAQ---LHTSFC
LYSY_AERPE        GARLAAVPGCNATAAILAAAPLVASKI-IDMDVGIIVDVKAASSEAGSKPS-RHSIHPLR
LYSY_SACS2        NAKLIASPGCNATATILALAPIVATKI-TD-EKKFISDVKVGSSEGGAKPS-EGSHHPER
LYSY_PYRAE        GAKLVAVPGCMATASILMLAPLAKHGL-LG-ETPPVIDAKIGSSGAGAEGS-VVDLHSFR
LYSY_DEIRA        GATRIACAGCFATSVILALYPLLRLGA-LA-PKDIIATGLVGSSAAGASAS-ESSHHPER
LYSY_THET2        GADWIAGAGCNATATLLGLYPLLKAGV-LK-PTPIFVTLLISTSAAGAEAS-PASHHPER
V6KID2_STRNV      TADLVSVPGCMATASILALRPLSEAGL-LE-PA-VTVDGRVGSSGSGASAG-EMNLHAER
LYSY_PYRHO        KAELVANPGCNATAVILALYPFKDL------TKEVLVDLKVSSSAGGRREN-LPSIHPER
ARGC_ARCFU        KANLVANPGCYPTGTILAASPLAKLEL----IERVVFDCKSGITGAGESPS-AFTHYPNL
ARGC_METMA        E-YFVANPGCFPTGAILSAAPLAAAGL----IDIAVFDSKTGISGAGISPT-ETSHYPNL
ARGC_METJA        EAQLVANPGCFPTGAILAVAPLVKENI-I--EERIIFDSKTGVSGAGIKPT-ETTHFPNV
ARGC_METTH        SADLVANPGCFPTGAILACLPLVYEKI----ADTFIIDSKTGVSGAGVKPT-ALTHYPHC
ARGC_METKA        RTDLIANPGCYPTGAILAAAPLVEEGL----VDVVIFDSKSGTSGAGAKPS-EVTHHPEC
ARGC_PSESM        NARLIAVPGCYPTATQLGFLPLLEAG--IADNTRLIADCKSGVSGAGRGLN-IGSLYSEA
ARGC_NITEU        DARLIANPGCYPTAVQLGFIPLIEAG--AVDADHLIADTKSGVSGAGRKAE-IHTLYAEA
ARGC_BORPE        KARVIGNPGCYPTTVLLGLAPLIEGGKQLVDVQTLIADCKSGVSGAGRKAE-VGSLFSEA
ARGC_NEIMB        QARLVANPGCYPTCVSLPLVPLLRQCR-LKPGMPLIADCKSGVSGAGRKGN-VGSLLCEA
ARGC_BACHD        AAQIIANPGCYPTAVLLGLAPLVQQK--WIDPKRIIIDAKSGTSGAGRNPS-QITHFSEM
ARGC_BACSU        QAKLIANPGCFPTAVLLGLAPLAQKK--LLDESFVIVDAKTGVSGAGRKAS-MGTHFSEL
ARGC_BACAN        KANLIANPGCFATAALLAILPLVRSG--IIEEDSIIIDAKSGVSGAGKTPT-TMTHFPEL
ARGC_OCEIH        QANIISNPGCFPTAALLGLIPMLENN--IIESKGIMIDGKTGISGAGKNSS-AKTHFSTT
ARGC_STAES        RNRFIANPGCYATATELALYPLISNH--LIRVDSIIVDAKSGLTGAGKKLN-QSSHYVNV
ARGC_STRMU        K-KFIANPGCYATATELALLPLVKEK--LIDVNSIIVDAKSGLTGAGKVLS-ESSHFVNV
ARGC_LACLA        N--YIANPGCYATATLLALYPLVKNK--MIDLDSIIVDAKSGLSGAGKGLS-DASHFVNV
ARGC2_LACPL       T--YIANPGCYATATLLGLAPLAQQQ--LVEPTSIVVDAKSGLSGAGKRAT-AASHYVAV
ARGC_LISMO        T-TFIANPGCYATATLLGLAPLATNK--LIDPTSIIVDAKSGISGAGKVPS-ASTHFTET
ARGC_STAAW        GTKLISNPGCFPTATLLALHPLISEK--IVDLSSIIIDAKTGVSGAGRSLS-QRVHFSEM
ARGC_CAMJE        KASLVANPGCYTTCSILSLYPLFKEK--IIDFSSVIIDAKSGVSGAGRSAK-VENLFCEV
ARGC_CLOAB        TSNLIANPGCYPTASSLALIPLLKNN--LIDTSSIIIDAKSGVSGAGRKAS-TNNLFIEC
ARGC_NOSEL        EAQLVGCPGSYPTASLLALSPLLKQG--LIVPETAIVDAKSGTSGGGREAK-TYLLLAEA
ARGC_SYNY3        DAQLIGCPGCYPTASLLALSPLLKQG--FIVPETAIIDAKSGTSGGGREAK-VNMLLAEA
ARGC_GLOVI        TARLVGCPGCYPTASLLAAAPLLKQG--LIDPRSLIIDAKSGVSGAGRALK-TGSLFAEA
ARGC_THENN        NARIVGNPGCYPTSVILALTPALKSG--IVEVDTIVVDSKSGVSGAGRKET-LDYTFSEV
ARGC_CALS4        EADVVGNPGCYPTSVILGLVPLLKEK--VID-GNIIIDSKSGISGAGHSPS-QKNIYAEC
ARGC_STRCL        GARRIAVPGCYPTAVTLALFPAVGAGL--VDRE-VVTAVS-GTSGAGRALK-PHLLGAEV
ARGC_STRCO        GSKRIAVPGCYPTAVSLALFPAYAASL--AEPEAVIVAAS-GTSGAGKAAK-PHLLGSEV
ARGC_MYCTU        GTRRIAVPGCYPTAALLALFPALAADL--IEPAVTVVAVS-GTSGAGRAAT-TDLLGAEV
ARGC_CORGL        GAKRVAVPGCFPTGATLALLPAVQAGL--IEPDVSVVSIT-GVSGAGKKAS-VALLGSET
ARGC_BIFLO        GTKRIAGPGCNVTATTLALQPGIAEGL--VESQDIVADLVVGYSGAGKNLKRTNLLAAEA
ARGC_RHOCB        TARLCAGTGCNAAAGQYAIRPLIEAGV--IDLDEIVIDLKAGVSGAGRSLK-ENLLHAEL
ARGC_LEPIN        NADFVSNPGCFSTSVILPIFLLGQLR--KNLRPRIIVDSKSGVSGAGGRTEDSGYSYTSV
ARGC_RHOBA        SADIVANPGCYPTSAIMPLAPLVKAG--LIETDDIIVDSKSGVSGAG-RSPKLGTLYCET
ARGC_AQUAE        NSDLVANPGCYPTATLLAIYPFLKER--VGI-ESVIVHALSGVSGAG-RKPKQQFHFPEM
ARGC_CHLTE        GSTAISNPGCYATSIILGLAPLFLGGMAGLDVESVNVTAVSGISGAGRSAK-LELSFSEM
ARGC_XANC8        GQRRISNPGCYATAMQLAITPLREQLA-----GPPQCFGVSGYSGAGTTPS-DKNNPALL
ARGC_XANAC        GQRRISNPGCYATAMQLTIAPLLDQLA-----GPPQCFGVSGYSGAGTTPS-DKNNPELL
D2U8N1_XANAP      GQRRISNPGCYATAMQLAVAPLCEQLA-----GPPQCFGVSGYSGAGTTPS-DKNDPALL
ARGC_XYLFT        GQKRISNPGCYATAMQLAIAPLRDQLA-----GPPQCFGVSGYSGAGTTPS-DKNNQALL
Q0ASS8_MARMM      GARRIANPGCYATAGQLAIAPLRGQLD-----GDVHVFGVSGYSGAGTTPS-RKNDPEAL
C7R8V4_KANKD      DQIRISNPGCYATAMQLSLAPLTPVID-----GAAHCFGVSGYSGAGTNPS-DKNNLELL
ARG56_YEAST       NAAKIANPGCYATGSQLTISPLTKYIN-----GLPTVFGVSGYSGAGTKPS-PKNDPKFL
ARGC1_LACPL       NANIINLPGCMALASIYAAYPLVKNKL---INPNIFVDVKTGSSGAGKSTK---ETAADR
                         .*.                               . : .*             

ARGC_PASMU        EVSLNAYGVFN-HRHQPEIATHLGTE------------VIFTPHLGNFKRGILATITAKL
ARGC_VIBVU        EVSLQPYGIFN-HRHQPEIVHHLGCD------------VIFTPHLGNFKRGILATITMKL
ARGC_ECOLI        EVSLQPYGVFT-HRHQPEIATHLGAD------------VIFTPHLGNFPRGILETITCRL
ARGC_MORPR        EVSHAPYGVFN-HRHQPEISTHLGHE------------VIFTPHLGSFKRGILATINVKL
ARGC_BUCAP        EVSLHPYNVFT-HRHTPEIIEHLGIP------------VIFIPHLGSFSRGILASITCKL
ARGC_SHEON        EVSLTPYGVLG-HRHQPEIATQLGQE------------VIFTPHLGNFKRGILATITVQL
LYSY_AERPE        EGSARPYTPWG-HRHAAEAVQVLRDL------VGRGIRLSLVPHAVSMTRGVLASAHALL
LYSY_SACS2        QNAIRPYEAEG-HRHAAEAEQELSRI------AKANISVSIVPHAVSSIRGALASAHTWL
LYSY_PYRAE        TYVVRPYEPVH-HRHIAEIEQELSLL------AGKRVKVAFTPHAVDMVRGIFATGHVFV
LYSY_DEIRA        AGSLRVYKPVG-HRHTAEAQQELP----------GKFPLHLTAISTPRVRGILTTIQAWV
LYSY_THET2        AGSIRVYKPTG-HRHTAEVVENLP----------GRPEVHLTAIATDRVRGILMTAQCFV
V6KID2_STRNV      SGVLRVFAPLN-HRHQAEIAQAT------------GLDVMMTATGVDAVRGVQVLCHASL
LYSY_PYRHO        SNVVRVYKPYH-HRHEAEVLQET------------GVRAMFTVHSVDIVRGLLATIYFTF
ARGC_ARCFU        HESIVPYKITE-HRHYYEMVQELGRF------QSDIK-ISFTPQVYPGSRGILTNAHVFL
ARGC_METMA        AENIVPYKLTA-HRHRAEIVQELTRL------DGNLRNISFTPHVIPTIRGISTTAHLFT
ARGC_METJA        NENINPYKITT-HRHTPEIEKELKKL-------GKAK-VSFTPHLAPITRGILTTAHTFL
ARGC_METTH        SDNVIPYNVTG-HRHTPEIRQELSRL-------NPVR-LSFTPHLVPVTRGILTTAHTFL
ARGC_METKA        AEDLTPYNPTD-HRHLPEIRQELGKL-------GDVE-VHFTPHLAPLVRGIETTAHGLG
ARGC_PSESM        NESFKAYAVKG-HRHLPEITQGLRRAA-----RG-DIGLTFVPHLVPMIRGIHSTLYATV
ARGC_NITEU        SDNFKSYAVPG-HRHLPEIRQGLSERS-----NG-PIGLTFVPHLTPMIRGIHATLYARL
ARGC_BORPE        SDNFKAYGVAG-HRHQPEIVAQLEKLA-----GG-KVGLTFVPHLVPMIRGMFSTLYARI
ARGC_NEIMB        GDNFKAYGIAG-HRHLPEIRQTIAGLQ-----DGIAEGFVFTPHLAPMIRGMHATVYLHL
ARGC_BACHD        NENFKIYQVNQ-HKHTPEIEQQLRNW------DESVGNVTFSTHLVPMVRGIMATIYAEA
ARGC_BACSU        NDNFKIYKVNE-HQHTPEIEQALNEW------QPGLGPITFSAHLVPMTRGIMATMYTRL
ARGC_BACAN        YDNLRIYKVNE-HQHIPEIEQMLAEW------NRETKPITFSTHLIPISRGIMVTLYAKV
ARGC_OCEIH        NENVTPYKIGT-HQHIPEIEKYLSQHV-----EESSVRVTLTTHLIPMTRGLMCTMYAPL
ARGC_STAES        NNNYVTYKLNK-HQHIPEIVQTLQFF------NKSLQNIQFSTSLIPVNRGIVATIYTRL
ARGC_STRMU        HDNYVTYKLNR-HQHIPEIVQELKRF------DNNLEHIQFSTSLLPVNRGIMATCYVTL
ARGC_LACLA        VDNMSMYKINS-HQHIPEIAQQLKIW------NSNFQALQFSTSLIPVSRGIFVSSYAKV
ARGC2_LACPL       NDNLSLYKLNQ-HQHIPEMMQQLQQW------WSAISAIEFTTTLIPVTRGIMTTIYAKA
ARGC_LISMO        NENMTLYKMNS-HQHIPEIMQQLTKW------DESIPAIQFSTSLIPITRGIFTTIYVKP
ARGC_STAAW        NENLSAYAIGN-HKHKPEIEQYLSII------AGQDVSVIFTPHLVPMTRGILSTIYVKL
ARGC_CAMJE        NENIKAYNLAL-HRHTPEIEEHLSYA------AKEKITLQFTPHLVPMQRGILISAYANL
ARGC_CLOAB        NDSIKAYGVAS-HRHTPEIEQTLTNE------AKEKITLTFTPHLVPMNRGILSVCYSNL
ARGC_NOSEL        DNSLAPYSVVR-HRHTPEIEQICSDL------AGHEVTVQFTPHLVPIVRGILATVYATL
ARGC_SYNY3        EGSLGAYGVAK-HRHTPEIEQIASDL------AGTELRVQFTPHLIPMVRGILATVYATL
ARGC_GLOVI        DSSVAAYSVAR-HRHIPEIEQVCSDL------AGMRVQVQFTPHLIPMARGMLVTLYAQL
ARGC_THENN        NENLRPYNVAK-HRHVPEMEQELKKI------AGKDVKVIFTPHLVPMTRGILSTIYVKT
ARGC_CALS4        NESIRAYNVAN-HRHVPEMVQELSKA------SGEKVSVVFAPHLTPMTRGILSTMYCKL
ARGC_STRCL        MGSVSPYAVGGTHRHTPEIAQNSTAVTD-----GEPVSVSFTPLLAPMPRGILATCSARL
ARGC_STRCO        MGSMSPYGVGGGHRHTPEMIQNLGAVA------GEPVTVSFTPTLAPMPRGILATCTAKA
ARGC_MYCTU        IGSARAYNIAGVHRHTPEIAQGLRAVT------DRDVSVSFTPVLIPASRGILATCTART
ARGC_CORGL        MGSLKAYNTSGKHRHTPEIAQNLGEVS------DKPVKVSFTPVLAPLPRGILTTATAPL
ARGC_BIFLO        LQSALPYSVGGKHRHIPEILQNFAHAAGKSAAEASEFTLGFTPILAPMSRGILATVSARM
ARGC_RHOCB        AGGTMPYSAGGKHRHLGEFDQEFSKVA------GRPVRVQFTPHLMPFNRGILATVYVRG
ARGC_LEPIN        YENFRAYKILS-HQHEPEIREYVYSKS-----GLSDPEVIFTPHLLPVYRGILSTIVLEF
ARGC_RHOBA        NESISAYAVGT-HRHAPEIADLVERIA-----GAP-IEVMFTPHLTPMDRGILSTIYVKP
ARGC_AQUAE        TENFFNYAVEK-HRHTPEMEDVIRRVY-----GRE-VKVRFTPTVVPTSRGMISTVYLKS
ARGC_CHLTE        SGNMRAYKVGK-HQHTPEIMQTLGTSV-----TDPSFRFVFTPMIAPYVRGIYSVLNVRL
ARGC_XANC8        ADNLMPYALTN-HMHEREVSAQLGVP------------VEFMPHVAPHFRGITMTVNLWL
ARGC_XANAC        SNNLMPYALTN-HMHEREVSAQLGVP------------VEFMPHVAPHFRGITMTVNLWL
D2U8N1_XANAP      RDNLMPYALTD-HLHEREVSAQLGLP------------VEFMPHVAAHFRGITMTVNLWL
ARGC_XYLFT        RDNLMPYALTD-HLHEREVSAQLGIP------------VEFMPHVAPHFRGITLTANLWL
Q0ASS8_MARMM      ADNLMPYALSG-HLHEQEMARHAGET------------VRFTPHVAAFFRGIVATTHLTL
C7R8V4_KANKD      KDNLIPYQLSE-HLHEKEVSHHLDTD------------VKFTPHVASFFRGISMTTHISL
ARG56_YEAST       NNNLIPYALSD-HIHEREISARIGHN------------VAFMPHVGQWFQGISLTVSIPI
ARGC1_LACPL       FGNFRLYRAFN-HRHLPEIAMALGSSV---------GKVGFAAYSLDISRGIYASVYSQI
                        :     * *  *                      :        :*         

ARGC_PASMU        KT-----GVSDEQIRVAYQHAYADKPLVRVYEQGLPSIKAV------EFTPYCDIGFVTK
ARGC_VIBVU        QD-----GVTKEQVAHAFAQAYDRKPAVRLKGDVIPRIQDV------EFTPFCDLGWRVQ
ARGC_ECOLI        KS-----GVTQAQVAQVLQQAYAHKPLVRLYDKGVPALKNV------VGLPFCDIGFAVQ
ARGC_MORPR        AA-----GVTPEQVTAAYQEAYQDQPMVRLLPSGWPSIKAV------EKTAYCDLAWQQQ
ARGC_BUCAP        KC-----NFTFQDIYNLYNTVYKEKPLIRVYEKNFPSIKAV------VKLPFCDIGFIIQ
ARGC_SHEON        KP-----GTTTADVAAAYS-VYDQAPLVTVKQNQFPKVDDV------VLTPNCHLGWKFD
LYSY_AERPE        RD----N-IGFSEAVRAYASFYKDSQIVRVKPMAPGLPVDPPDVKNVIGSMFAEVGFAVE
LYSY_SACS2        TN----E-LEEIEIWKKIAEFYRGKRFIRIIRGNIHPYPDP---KFVIGSNFADIGFAVE
LYSY_PYRAE        EK----M-PTEADMWKMYRSMYGDSKFIRIVKDRLGISRYP-NVKYVLGSNFVDIGFELD
LYSY_DEIRA        PD----G-WSDKDVWSAYREVYGQEPFIRIVKVAKGIHRYP-DPMLLDGTNFCDIGFEMD
LYSY_THET2        QD----G-WSERDVWQAYREAYAGEPFIRLVKQKKGVHRYP-DPRFVQGTNYADIGFELE
V6KID2_STRNV      SE----D-VTEQDLRRLYRAAYQAEPHVRVIAQKRGNYRLP-EPKILLGSNYCDVGFAID
LYSY_PYRHO        EG-------NEKDLLKRML-IYKDEPFIRLVVDKGGLQRYP-DPKYVLGSNFVDLGLAYD
ARGC_ARCFU        RG----E-LTREELYRIYEEFYEDSFFVRIQ------ESV--SLSQVRGSNFCDISIHPG
ARGC_METMA        KE----P-LSTEDVRGIYEEFYRDKPFVRLP------GGVP-SLTAVRGSNFCDIGFEAD
ARGC_METJA        AK----D-VDREEIIKIYEKFYGSEVFVRIFS-----EEIP-KLTWVRGTNFCDIGGFEI
ARGC_METTH        LE----D-LEQGEIADIFMGFYDGEPFVRVV------EGIP-GLSAVRGSNFCQIGCFEV
ARGC_METKA        DV----E-IEPKELRELYVEYYDGEPFIRVCEV----GEAP-RLWAVRGTNYCDVGVFAV
ARGC_PSESM        TD------R-SVDLQALFEKRYADEPFVDVMPAGSHPETRS-----VRGANVCRIAVHRP
ARGC_NITEU        T-------R-DVDLQTLYENRYANEPFVDVLPAGSHPETRS-----VRGSNFCRIAVHRP
ARGC_BORPE        LP----QAR-DTDFQALFEARYADEPFVDVMPAGSLPETRS-----VRASNNLRISVQRP
ARGC_NEIMB        SD--------GSDPETVLRDYYRDSPFVDILPTGSAPETRS-----VRGANLCRISIQQA
ARGC_BACHD        N-----QAISEKELREHFAYVYETSPFVHVYSEGRYPATKE-----VFGSNRCHIGVTYD
ARGC_BACSU        T-----CDLTADDLHDLYSEFYQDSYFVRVRPKGQYPQTKE-----VYGSNFCDIAVTLD
ARGC_BACAN        K-----REMEIEQLQQLYEEAYEQSAFIRIRMQGEFPSPKE-----VRGSNYCDMGIAYD
ARGC_OCEIH        Q-----QDIDTADVIDLYKHYYEQSSFIRIRKQGEYPSTKD-----VTGSNYCDIGAYVD
ARGC_STAES        E-----NGVKINQIESTYKDVYKNKPFIR--IKDGLPQLNE-----VIGTNYTDIGFVYN
ARGC_STRMU        K-----KPLSNEAVSKIYQDLYADKPFVR--LQQDLPELHN-----VIGSNFCDIGFAYN
ARGC_LACLA        A-----ADFDFETIKNAYEQVYATKNFVR--IRRQMPHLSD-----VIGTNFCDIGLAYN
ARGC2_LACPL       K-----SALTTTQVRAAFTATYHEQPFVQV-LPTGMPTLKD-----VVGSNNCALGVDYN
ARGC_LISMO        K-----NPITQKELHKLYESTYDNAPFVRIQPENVYPTVKQ-----VTASNYCDIGLAYN
ARGC_STAAW        S-----SEYTTESLHKLMTSYYANQPFVRIRDIGTFPTTKE-----VLGSNYCDIGIYVD
ARGC_CAMJE        K-----EDLQEQDIRDIYTKYYQNNKFIRLLPPQSLPQTRW-----VKSSNFADINFSVD
ARGC_CLOAB        K-----KEIELNEVYDIYKKFYKNEPFIRII--DTLPETRW-----VKGSNYCDIAIRID
ARGC_NOSEL        RD----PGLVGDDLTTIYTAFYRNSPWVKVCESGIYPQTKW-----AAGSNLCYIGVEVD
ARGC_SYNY3        RD----PGLVRDDLITIYSAFYRASPFVKILPHGVYPQTKW-----AWGTNLCYIGIEVD
ARGC_GLOVI        RD----PGLVSEDMLTIYEAFYRQAPAVRVLGSGIYPQTKW-----ASGTNTCFIGLEVD
ARGC_THENN        N-----ASL--EKIHRIYQEFYAGEPFVHVLPLGVFPSTKW-----CYGSNHVFIGMQLE
ARGC_CALS4        R-----ENLNQEEIYEVFAEFYKNEYFVKVLKPGAYPSTKN-----VYGSNFCHIGFEVD
ARGC_STRCL        TP-----GTDARQVRAVYEKTYADEPFVSLLPEGVWPSTGA-----VLGSNQVQVQVAVD
ARGC_STRCO        KP-----GVTAESVRAAYEKALADEPFVHLLPEGQWPATAS-----VYGSNAVQVQVAHD
ARGC_MYCTU        RS-----PLS--QLRAAYEKAYHAEPFIYLMPEGQLPRTGA-----VIGSNAAHIAVAVD
ARGC_CORGL        KE-----GVTAEQARAVYEEFYAQETFVHVLPEGAQPQTQA-----VLGSNMCHVQVEID
ARGC_BIFLO        TDKA--KTLSDEEIRAVWSKAYEGQDFMVLLPEGTLPATGN-----IIGSNAAHLQVVTD
ARGC_RHOCB        TP---------EDIHAALASRYENEVFLEVLPFGQLASTRS-----VAGSNFVHLGVIGD
ARGC_LEPIN        DS------EPEQDLISILENSSLNEPFIRILKTPEEVEL-------KKVQHTNFLDISLR
ARGC_RHOBA        VGKAGSVEDAVRAMMSLLRDTYSDQPCVHVVDHLPAT---------KYVAGTNHVQISVR
ARGC_AQUAE        EK---------LNVKELFKEVYEDEIFVKVVDEPPQTKW-------VLGTNYCFIYPHYD
ARGC_CHLTE        AS-----PVAMEPVRELYAGFYANAPFVRLRDGVTEVSHVA-------YTNFCDISLAFE
ARGC_XANC8        QQ-----PLTREQIHARYLERYAHEPLIEIVDEAPWVSRIAG------TQGVQIGGFTMA
ARGC_XANAC        QQ-----PLTREQIQARYTQRYADEPLIEIVDEAPWVSRIAG------KHGVQIGGVTLA
D2U8N1_XANAP      QQ-----PMTLDAVQRRYRERYAGEALIEVLDTAPWVSRIAG------RHGVQIGGFTLA
ARGC_XYLFT        QR-----PLTREHIKTLYATRYANDPLIDIIDPPPWVNQIAA------RHTVQIGAFTMA
Q0ASS8_MARMM      KT-----AMSADAVRALYEQAYAGEALIRVIADIPEVRDGAR------QPGAVVGGFAVG
C7R8V4_KANKD      QQ-----PMTLEEVIEKFKKLYQHHPLIEVRETIPLVKDIQG------KVGAIVGGFKLD
ARG56_YEAST       KKG----SLSIDEIRKLYRNFYEDEKLVHVIDDIPLVKDIEG------THGVVIGGFKLN
ARGC1_LACPL       KK-----GVTEVDVKKAYFKTYKSCKFVANLTGKQSVPMLK------STNGTNFAEVKAT
                                             :                                

ARGC_PASMU        --NGHIIIIGAEDNLLKGAAAQAVQCANIRYGLTETLGLL-----------
ARGC_VIBVU        --GQHIIVISAIDNLLKGASSQAMQCLNIHYGFSPLTALL-----------
ARGC_ECOLI        --GEHLIIVATEDNLLKGAAAQAVQCANIRFGYAETQSLI-----------
ARGC_MORPR        --GQDLIVVSAIDNLLKGAAAQAMQCINIRFGFAMTTSLV-----------
ARGC_BUCAP        --DKYIVIIAAEDNLLKGAAAQAIQCFNIRFGFSEIESII-----------
ARGC_SHEON        ESSGYLVVASAIDNLMKGAASQALQCIKIHFNL------------------
LYSY_AERPE        EESGRITGFAAIDNLVRGAAGQAVYAMNAMLGFDEWEGLRSPPLRP-----
LYSY_SACS2        KRISRLTTFSAIDNLMKGAAGQAVQAFNISMGFNEDDGLKLVPLRPA----
LYSY_PYRAE        QRLNRLVTFSAIDNLVRGAAGQAVQAFNVAMGFPEDEGLRYIPLAPV----
LYSY_DEIRA        VDTGRVVLMSAIDNLVKGTAGHAIQSLNVAQGWDERAGLGFLGLHPT----
LYSY_THET2        EDTGRLVVMTAIDNLVKGTAGHALQALNVRMGWPETLGLDFPGLHP-----
V6KID2_STRNV      PGSRRVLLCGALDNLVKGGAGNAVQCLNIRMGLDESLGLDFPGLHPI----
LYSY_PYRHO        EENSRVIVFSALDNLIKGGAGQAVQNMNIMFGLDETLGLGYYPLYPV----
ARGC_ARCFU        ED--RVVVVSAIDNLVKGASGQAVQNMNLMMGFDETLGLRTPPLFP-----
ARGC_METMA        KENNRVVVLSAIDNLVKGASGQAIQNMNLMFGLVETRGLWTPATAP-----
ARGC_METJA        DEHGRLVVISAIDNLVKGASGQAIQNMNIMFGFDEKEGLFDVGLNP-----
ARGC_METTH        DDNQRAVIVSAIDNLVKGASGQAIQNMNIMFGFREVEGLDFPGMYP-----
ARGC_METKA        GD-GRVVVASAIDNLTKGASGQAIQNMNVRFGFEETAGLEEPGYHP-----
ARGC_PSESM        QDGDLVVVLSVIDNLVKGASGQAVQNMNILFGLDERAGLSHAGMMP-----
ARGC_NITEU        GNGDTAVILSVTDNLVKGAAGQAVQNMNIMYGLPETTGIRHVPLLP-----
ARGC_BORPE        GGGDQLVILVVQDNLVKGASGQAVQNMNLMFGLPESAGLDQVAILP-----
ARGC_NEIMB        AQSDVWVVLSVIDNLVKGAAGQAVQNMNIMFGLEETHGLDAIPLLP-----
ARGC_BACHD        ERTNRITVVSVIDNLVKGAAGQAIQNYNVMNGYEETLGLEGSPLYP-----
ARGC_BACSU        ERTNRVTIVSVIDNLMKGAAGQAVQNFNLMNGWNEETGLTITPIYP-----
ARGC_BACAN        ERTGRVTIVSVIDNMMKGAAGQAIQNANIVAGLEETTGLQHMPLYL-----
ARGC_OCEIH        KRTNQLIISSAIDNLVKGAAGQAIQNINVMNGWDEKTGLSFLPVYP-----
ARGC_STAES        ETTGVLTISSVIDNLIKGAAGQAIQNMNLMFNFDETDGLILAPLYI-----
ARGC_STRMU        PVTNVLTVISVIDNLVKGAAGQAVQNLNLMMGWDETEGFPMTPSYL-----
ARGC_LACLA        PVTNVLSVVSVIDNLMKGAAGQAVQNFNQLFGYDESLGLKFMPSL------
ARGC2_LACPL       PVTNTIVVVSVIDNLMKGAAGQAVQNFNRYFDFAVTAGLPTLPVFP-----
ARGC_LISMO        EKTNVITIVSVIDNLVKGAAGQAIQNLNIMANFAESDGLRFIPVYP-----
ARGC_STAAW        ETTQTAILVSVIDNLVKGASGQAIQNLNILYDFEVTTGLNQSPVYP-----
ARGC_CAMJE        QRTKRVIVLGAIDNLIKGAAGQAVQNMNLMFDFDEDEGLKFFANL------
ARGC_CLOAB        KRTNKIIVLSAIDNLMKGAASQAVQNMNIMYGLAEKTGIDLTPMFP-----
ARGC_NOSEL        PRTGRVIGMSVIDNLIKGQAGQAIQCLNIMMGWDETLGLPKMGFYP-----
ARGC_SYNY3        PRTGRVIVLSAIDNLVKGQAGQAVQCLNLMMGWEESLGLPQLAFYP-----
ARGC_GLOVI        QRTERVVVLSALDNLVKGQSGQAIQAMNLTQGWEEMLGLPAIGFYP-----
ARGC_THENN        ERTGTLILMSAIDNLVKGASGQAIQNMNIMFDLKETEGLESLPIYP-----
ARGC_CALS4        KATGTLVVMTAIDNLVKGASGQAIQNMNIMFEIEEKAGLDIVPVYP-----
ARGC_STRCL        PAADRLVVVSAIDNLTKGTAGGALQSMNLALGLPETTGLPRTGLAP-----
ARGC_STRCO        AAAGRIIAISAIDNLAKGTAGGAVQSMNLALGLDETTGLTTIGVAP-----
ARGC_MYCTU        EDAQTFVAIAAIDNLVKGTAGAAVQSMNLALGWPETDGLSVVGVAP-----
ARGC_CORGL        EEAGKVLVTSAIDNLTKGTAGAAVQCMNLSVGFDEAAGLPQVGVAP-----
ARGC_BIFLO        RKAGRIYAFAAIDNLNRGTAGQAVQSLNIALGLPEDAGLTKIGVAP-----
ARGC_RHOCB        RLPGRAVVTVALDNLTKGSSGQAIQNANLMLGLPETLGLMLAPVFP-----
ARGC_LEPIN        KRENTLVVVSALDNLVKGAAGQALQNINLMTGAKETLGLLP----------
ARGC_RHOBA        PSGKRAVIVCAIDNLTKGASGAAVQNMNVMFGLPETAGLLM----------
ARGC_AQUAE        ERTGYYVIISAIDNLGKGASLQAVQNANLMFGLAEDDGLLQLPVFP-----
ARGC_CHLTE        SD-GSLVIITAIDNLVKGAAGQAVQNMNLMLGFGETTALL-----------
ARGC_XANC8        PGNKRVVVVATLDNLLKGAATQAMQNLNLALGWDELTAIG-----------
ARGC_XANAC        PGNKRVVVVATLDNLLKGAATQAMQNLNLALGWDELMAIR-----------
D2U8N1_XANAP      PGNKRLVLVATLDNLLKGAATQAMQNLNLALGLDELTSIPV----------
ARGC_XYLFT        PGNKRVVIVATLDNLLKGAATQALQNLNRALGLDELTAIPYQPNPVPSPIP
Q0ASS8_MARMM      ADGHRLVVVSALDNLLKGAAVQAMQNLTLALGLPEGSYRPSPL--------
C7R8V4_KANKD      KSGCHLVVCCALDNLLKGAAVQALQNANQAFNLNSLEAINYD---------
ARG56_YEAST       DAEDRVVVCATIDNLLKGAATQCLQNINLAMGYGEYAGIPENKIIGV----
ARGC1_LACPL       VHEGQCIAVVSLDNLLKGAAGQAVQAANKYYQLVEDTGLDTLAGMWP----
                              **: :* :  .:   .