CLUSTAL format seed alignment for MF_00151

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

COAD_STRA3      -------MTKKALFTGSFDPVTNGHLDIIERASYLFDHVYIGLFYNLEK--QGYFSIECR
COAD_STRA5      -------MTKKALFTGSFDPVTNGHLDIIERASYLFDHVYIGLFYNLEK--QGYFSIECR
COAD_STRMU      ------MSDRIGLFAGSFDPVTNGHVDIIRRASGLFDKLYVGLFYNKDK--TGLFEPARR
COAD_STRP1      ------MLTKIGLYTGSFDPVTNGHLDIVKRASGLFDQIYVGIFDNPTK--KSYFKLEVR
COAD_STRPN      ------MSDKIGLFTGSFDPMTNGHLDIIERASRLFDKLYVGIFFNPHK--QGFLPLENR
COAD_STRR6      ------MSDKIGLFTGSFDPMTNGHLDIIERASRLFDKLYVGIFFNPHK--QGFLPIENR
COAD_LACLA      ------MTEKIGLFTGTFDPLTNGHLDVIKRASQHFDQLYVGIFKNDQK--NPLFPTDKR
COAD_BACHD      -------MTSIAVCPGSFDPVTLGHLDIIQRGANVFDEVIVAVLHNRNK--VPLFSVEER
COAD_BACSU      -------MASIAVCPGSFDPVTYGHLDIIKRGAHIFEQVYVCVLNNSSK--KPLFSVEER
COAD_OCEIH      -------MGKLAICPGSFDPITNGHLDIIQRGANVFEEVIVTVFNNQSK--SPLFSVTER
COAD_LISIN      ------MGNKIAVIPGTFDPITNGHLDIIERAAKIFDVLYVSVLNNSSK--KPLFTVEER
COAD_LISMO      ------MGDKIAVIPGTFDPITNGHLDIIERAAKIFDVLYVSVLNNSSK--KPLFTIEER
COAD_STAAM      ------MEHTIAVIPGSFDPITYGHLDIIERSTDRFDEIHVCVLKNSKK--EGTFSLEER
COAD_STAES      ------MSKTRAVIPGSFDPITYGHLDIIERSADRFDEIHVCVLKNSSK--GGTFDSEER
COAD_NOSS1      ---------MIAIYPGSFDPITLGHLDIIQRGSRLFDLVIVAVLRNPSK--VPLFSVQER
COAD_SYNY3      ---------MIAIYPGSFDPITLGHLDIIERGSGLFEQIIVAVLCNPSK--QPLFSVEKR
COAD_SYNE7      ---------MNAIYPGSFDPITFGHLDIIERGCRLFDQVYVAVLRNPNK--QPMFSVQER
COAD_THEEB      ---------MLAVYPGSFDPITLGHLDIIERGARLFSEVIVAIAHNPQK--KALFSVGQR
COAD_CALS4      --------MRVAIYPGSFDPVTYGHIDIIKRGANLFDKLIVAVLLNPAK--RPLFSIQER
COAD_LEPIN      -------MKHLAIYPGSFDPLTKGHLDILQRSLGLFDKVIIAIAVNSNK--STLFSIEER
COAD_COREF      ---------MKAVCPGSFDPITLGHLDIITRAAAQFEEVTVLVTANPNKN-SGLFTVEER
COAD_CORGL      ---------MKAVCPGSFDPITLGHLDIVTRAAAQFSEVTILVTANPNKN-SGLFTVAER
COAD_MYCLE      --------MSSVVCPGSFDPVTLGHIDVFERAAAQFDEVVVAILINPVK--KGMFDLDER
COAD_MYCTU      --------MTGAVCPGSFDPVTLGHVDIFERAAAQFDEVVVAILVNPAK--TGMFDLDER
COAD_STRCO      --------MRRAVCPGSFDPITNGHLDIIARASSLYDEVYVAVMINQAK--KGLFEIEER
COAD_DEIRA      ---------MNAVFPGSFDPVTSGHMDVLTRASHMFEQVTVTVMHNARKQGRHLFTLDER
COAD_BIFLO      --------MTIAVCPGSYDPVTAGHLDVIERSARFFDEVHVVVAVNAAK--TPMFSEATR
COAD_AQUAE      -------MGKRVVYPGTFDPPHYGHLDIVKRSARIFDEVVVAVAKKPRK--FLLFDAEER
COAD_CLOAB      --------MKVAVYPGSFDPITNGHLDIISRASKVFDKVIVGVLINPEK--KGMFSVDER
COAD_CLOPE      --------MRVGVYPGSFDPITKGHLDLIERAASKFDKVIVAVLININK--KGMFSIEER
COAD_FUSNN      --------MKIGVYAGSFDPITKGHQDIIERALKIVDKLIVVVMNNPTK--NYWFNLDER
COAD_THEMA      ---------MKAVYPGSFDPITLGHVDIIKRALSIFDELVVLVTENPRK--KCMFTLEER
COAD_BUCAI      -------MNKTAIYPGTFDPITYGHLDIITRATKIFDSITIAISNNFTK--KPIFNLKER
COAD_BUCAP      -------MKKIAIYPGTFDPITYGHLDVITRATKIFDNIIIAISNNVHK--KTIFNLKER
COAD_HELPY      -------MQKIGIYPGTFDPVTNGHIDIIHRSSELFEKLIVAVAHSSAK--NPMFSLDER
COAD_HELPJ      -------MQKIGIYPGTFDPVTNGHIDIIHRSSELFEKLIVAVAHSSAK--NPMFSLDER
COAD_CAMJE      ---------MTCLYPGTFDPITNGHLDVIKRALKIFDEVIVAIAKSEHK--KPCYDLEKR
COAD_XANAC      ---MSVANSRTAVYPGTFDPITNGHIDLVNRAAPLFERVVVGVAYSPSK--GPALSLERR
COAD_XANCP      ---MSVANSRTAVYPGTFDPITNGHIDLVNRAAPLFERVVVGVAYSPSK--GPALPLERR
COAD_XYLFA      ---MSVVNRRIAVYPGTFDPITNGHIDLVSRAAPLFESIVVGVAQSPSK--GPSLPLQQR
COAD_ALLVD      --------MRTVVYPGTFDPITNGHVDLIHRAARLFDRVVVAVAADTGK--TPVFSTEER
COAD_RALSO      --------MVIAVYPGTFDPFTRGHEDLVRRASNIFDELVVGVAQSPNK--RPFFALEER
COAD_ECOLI      -------MQKRAIYPGTFDPITNGHIDIVTRATQMFDHVILAIAASPSK--KPMFTLEER
COAD_ECOL6      -------MQKRAIYPGTFDPITNGHIDIVTRATQMFDHVILAIAASPSK--KPMFTLEER
COAD_SALTI      -------MQKRAIYPGTFDPITNGHLDIVTRATQMFDHVILAIAASPGK--KPMFTLNER
COAD_SALTY      -------MQKRAIYPGTFDPITNGHLDIVTRATQMFDHVILAIAASPSK--KPMFTLDER
COAD_KLEPN      -------MSTKAIYPGTFDPITNGHIDIVTRAASMFDKVVLAIAASPSK--KPMFSLDER
COAD_SERMA      -------MTSKAIYPGTFDPMTNGHLDLVTRASLMFDHVILAIAASPSK--KPLFSLDER
COAD_YERPE      -------MITKAIYPGTFDPITNGHLDLVTRASAMFSHVILAIADSSSK--KPMFTLDER
COAD_PROMI      -------MKNKAIYPGTFDPITYGHIDILTRAAGMFDTVLLAIAASARK--NPMFSLEER
COAD_PHODP      -------MTTRVIYPGTFDPITNGHLDLIERAAAMFDTVIVGVAYNPTK--KPLFDLNER
COAD_SHEON      -------MHTRAIYPGTFDPITNGHADLIERAAKLFKHVIIGIAANPSK--QPRFTLEER
COAD_VIBCH      ---MSQKRLSRVIYPGTFDPITNGHLDLIERAAQMFDEVIIAVAASPSK--NTLFTLEER
COAD_VIBVU      ---MSKKALSRVVYPGTFDPITNGHLDLIERAAKMFDEVIIAVAASPSK--NTMFTLEER
COAD_PSEAE      --------MNRVLYPGTFDPITKGHGDLIERASRLFDHVIIAVAASPKK--NPLFSLEQR
COAD_HAEIN      --------MTSVIYPGTFDPITNGHLDIIERSAVIFPRVLVAVANSPSK--KPLFSLEER
COAD_PASMU      --------MITVIYPGTFDPITNGHLDIIQRTARLFPNVLVAVASNPNK--KPLFDLATR
COAD_AGRFC      --------MTIAFYPGSFDPMTNGHLDVLIQALNVASKVIVAVGIHPGK--APLFSFDER
COAD_RHIME      --------MTTAFYPGSFDPITNGHLDVLVQALNVAAKVIVAIGVHPGK--APLFSFDER
COAD_BRUME      --------MTIAIYAGSFDPVTNGHIDVLKGALRLADQVIVAIGMHPGK--KPLFSFDER
COAD_RHILO      ------MIERTALYAGSFDPLTNGHLDVLKASLAVADIVYAAIGIHPGK--KPLFSFEER
COAD_BARBK      --------MTIAFYAGSFDPITNGHLDVLRGSLLLADKVVVAIGVQAQK--QSLFSFEER
COAD_CAUVC      --------MRVGLYPGTFDPVTNGHLDIIGRAVKLVDKLVIGVAINIGK--GPLFSLEER
COAD_ZYMMO      MDALSPKKQPIALYPGTFDPVTLGHLDIIRRGARIFDHLIIAVAENPGK--SPLFSSEER
COAD_CHLTE      -------MSKKAIYPGTFDPFTNGHLDVLERALNIFEHVDVVLAENSQK--QTLFSVEER
COAD_TREPA      ---------MKAIFAGSFDPPTFGHLDLVLRARSLFAEVHVLVAVNVQK--RYLLSECER
COAD_BORBU      --------MRVAVFPGSFDPITWGHIDLIKRSLAIFDKVIVLVAKNKSK--KYFLSDIER
COAD_NEIMA      ---MLPNTPRRAVYAGSFDPPTLGHLWMIRQAQSMFDELIVAIGINPDK--RSTYTVAER
COAD_MYCCT      --------MKIAIYPGSFNPFHKGHLNILKKAILLFDKVYVVVSKNVNK--SLDPDLQSR
COAD_MYCPU      ----MSMNKKIAIFPGSFDPFHNGHKHILNKALALFDLVYLVITINPDK--ITKTSFDQR
COAD_MYCPE      --MSLNQKKKACIFPGTFEVFHDGHLNILKRALKLFDFVYIVVAIN-NT--KTSSDLEKR
                            . .*:::    **  :.         :   :     .          *

COAD_STRA3      KKMLEEAIR--QFK---NVSVLVAQDRLAVDLAREVGAKYFVRGLRNSQDFDYEANLEFF
COAD_STRA5      KKMLEEAIR--QFK---NVSVLVAQDRLAVDLAREVGAKYFVRGLRNSQDFDYEANLEFF
COAD_STRMU      QIMLKEALG--DLK---NVEVVAARDSLAVDIARQHQVTHLVRGLRNAQDLEYEANLAFF
COAD_STRP1      KAMLTQALA--DFT---NVIVVTSHERLAIDVAKELRVTHLIRGLRNATDFEYEENLEYF
COAD_STRPN      KRGLEKAVK--HLG---NVKVVSSHDKLVVDVAKRLGATCLVRGLRNASDLQYEASFDYY
COAD_STRR6      KRGLEKALG--HLE---NVEVVASHDELVVDVAKRLGATCLVRGLRNASDLQYEASFDYY
COAD_LACLA      VEMLEEALT--SLSVTHKVKVIKHERDLTVNIAKKLGVTALVRSLRNSQDLEYEKNMFYF
COAD_BACHD      LELLKKA-----TEHIPNVT-IDSFNGLLIDYVKQKQAKAIIRGLRAVSDFEYEMQAASI
COAD_BACSU      CELLREV-----TKDIPNIT-VETSQGLLIDYAKRKNAKAILRGLRAVSDFEYEMQGTSV
COAD_OCEIH      IELLEDS-----IKHIPNVS-VDSSSRLLMDYAREKKAHAVIRGLRAVSDFEYEMQITSM
COAD_LISIN      MEMIKQV-----TAHLPNVH-VESASGLTVDYAAKRGATAIVRGLRAVSDFEYEMQIASM
COAD_LISMO      MEMIRQV-----TAHLPNVQ-VESASGLTVDYAATRGATAIVRGLRAVSDFEYEMQIASM
COAD_STAAM      MDLIEQS-----VKHLPNVK-VHQFSGLLVDYCEQVGAKTIIRGLRAVSDFEYELRLTSM
COAD_STAES      MTLIEES-----VKHLPNIQ-VHHFNGLLVDFCDQVGAKTIIRGLRAVSDFEYELRLTSM
COAD_NOSS1      LEQIRRT-----TKHLPNVE-ADGFDGLTVNYAQQRQAQVLLRGLRAISDFEVELQMAHT
COAD_SYNY3      LEQIRHC-----TQHLTNVT-VDSFNGLTVDYAKQKQATVLLRGLRVLSDFEKELQMAHT
COAD_SYNE7      LEQIAKA-----IAHLPNAQ-VDSFEGLTVNYARQRQAGAILRGLRVLSDFELELQMANT
COAD_THEEB      IKQVQAA-----TSHLKNVR-VDTFDGLTVEYARSQRARVLLRGLRVLSDFEYELQMSHT
COAD_CALS4      IELLKEV-----TKDIPNVE-VDYFDGLLVEYAKKVNASAIIKGLRMVSDFEYEFQMALV
COAD_LEPIN      LGFIREV-----TKGMKGLE-IDTFQGLTVDYCNKVGANSIIRGLRAVTDFDYEYAISLM
COAD_COREF      MDLIRRS-----TAHLSNVK-VDTWATLLVDYTTAHGIGALVKGLRSSLDYEYELPMAQM
COAD_CORGL      MDLIRES-----TAHLDNVK-VDTWASLLVDYTTEHGIGALVKGLRSSLDYEYELPMAQM
COAD_MYCLE      IAMINES-----TMHLPNLR-VEAGEGLVVALVRSRGMTAIVKGLRTGVDFEYELQMAQM
COAD_MYCTU      IAMVKES-----TTHLPNLR-VQVGHGLVVDFVRSCGMTAIVKGLRTGTDFEYELQMAQM
COAD_STRCO      IDLIRRV-----TAEYGNVR-VESFHGLLVDFCKQREIPAIVKGLRAVSDFDYELQMAQM
COAD_DEIRA      LEILREA-----TAGLPNVR-VDSFSGLLVDYVAQQGRSVIVRGLRAVSDYEYELQIAHL
COAD_BIFLO      VDVIRRALD---KAGCKNVT-VSSTDGLITDYCKKVGATVIIKGLRQNGDYEAELGMALV
COAD_AQUAE      VKMFEKM-----VEDIPNVE-VKMFDCLLVDFMKREGINVIVRGVRLFTDFEYELQIALT
COAD_CLOAB      VDLIKRV-----IKPFNNVS-VQSFSGLLVNFMENNDSNVMIRGLRSVGDFEYELQTSLM
COAD_CLOPE      VNLIEKC-----VAKYNNVE-VKSFNGLLIDFVRKEKADVIIKGLRSVTDFEYEFQMALM
COAD_FUSNN      KNLISKI-----FEGSDSIK-VDEHAGLLVDFMAKNSCNILIKGLRDVKDFSEEMTYSFA
COAD_THEMA      KKLIEEV-----LSDLDGVK-VDVHHGLLVDYLKKHGIKVLVRGLRAVTDYEYELQMALA
COAD_BUCAI      IELTRKV-----TLHLKNVKKILGFNDLLANLAKKEKANILIRGVRTIFDFDYEIKLAAI
COAD_BUCAP      IKLTKLA-----TFHLKNIKKVIGFNGLLANLAKREKSNILIRGVRTIFDFDYEIKLAAI
COAD_HELPY      LKMIQLA-----TKSFKNVE-CVAFEGLLANLAKEYHCKVLVRGLRVVSDFEYELQMGYA
COAD_HELPJ      LKMMQLA-----TKSFKNVE-CVAFEGLLADLAKEYHCKVLVRGLRVVSDFEYELQMGYA
COAD_CAMJE      KELALLA-----TQNLKNVK-IIAFDNLLVDLAKELKVNTIIRGLRAVSDFEYELQIGYA
COAD_XANAC      VALAQEA-----LAAHANVE-VRGFDTLLAHFVREMGAGVLLRGLRAVSDFEYEFQMASM
COAD_XANCP      VELAQEA-----LAAHANVE-VRGFDTLLAHFVRDMGAGVLLRGLRAVSDFEYEFQMASM
COAD_XYLFA      VALAREA-----LCQHENVQ-VIGFDTLLAHFVRHVGAGVLLRGLRAVSDFEYEFQMASM
COAD_ALLVD      VELVRGS-----VAGDPNVE-ILPFEGLLVNFARTLGVSVIMRGLRAVSDFEYEFQLAGM
COAD_RALSO      IHIAREV-----LGHYPNVR-VEGFSGLLKDFVRKNNARVIVRGLRAVSDFEYEFQMAGM
COAD_ECOLI      VALAQQA-----TAHLGNVE-VVGFSDLMANFARNQHATVLIRGLRAVADFEYEMQLAHM
COAD_ECOL6      VELAQQA-----TAHLGNVE-VVGFSDLMANFARNQHATVLIRGLRAVADFEYEMQLAHM
COAD_SALTI      VALAQKA-----TAHLGNVE-VVGFSDLMANFARDRQANILIRGLRAVADFEYEMQLAHM
COAD_SALTY      VALAQKA-----TAHLGNVE-VVGFSDLMANFARDRQANILIRGLRAVADFEYEMQLAHM
COAD_KLEPN      IALAEQA-----TAHLVNVE-VIGFSDLMANFARAQQANILIRGLRAVADFEYEMQLAHM
COAD_SERMA      VALATQV-----TSHLDNVE-VLGFSELMAHFAAHQNANILVRGLRAVSDFEYELQLANM
COAD_YERPE      VALAKKV-----TAPLKNVE-VLGFSELMAEFAKKHNANILVRGLRSVSDFEYEWQLANM
COAD_PROMI      VALAKEV-----TQHLPNVE-VVGFCELMANFAKKQQATILIRGVRSVSDFEYEWQLANM
COAD_PHODP      VALAQSV-----TQHLPNVE-IVGFSGLLVNFAKEHNANVLVRGLRAVSDFEYEFQLANM
COAD_SHEON      VELVNRV-----TAHLDNVE-VVGFSGLLVDFAKEQRASVLVRGLRAVSDFEYEFQLANM
COAD_VIBCH      VEFARQV-----TSHLDNVS-AKGFSGLLVDFAKAEKANVLIRGLRTTVDFEYEFGLTNM
COAD_VIBVU      VDFARQV-----TRHLDNVT-AQGFSGLMVDFARAVDANVLIRGLRTTVDFEYEFGLTNM
COAD_PSEAE      VALAQEV-----TKHLPNVE-VVGFSTLLAHFVKEQKANVFLRGLRAVSDFEYEFQLANM
COAD_HAEIN      VELVRQS-----VVHLSNVE-VFGFSDLLANVIKQHNISAIIRGVRTTTDFEYELQLAAL
COAD_PASMU      VELVKQA-----VAHLPNVT-VVGFLDLLADVVKERNITAIIRGVRSASDFDYELQLAHL
COAD_AGRFC      AALISRALSETLPGEAARVE-VVSFDNLVVDAARQHGAHLLLRGLRDGTDLDYEMQMAGM
COAD_RHIME      ADLIRAALEETLPERAADIS-VVSFDNLVVDAAREHGARLLVRGLRDGTDLDYEMQMAGM
COAD_BRUME      VALIEASAKAVLHKDAARVS-VIAFDGLVIDAARKHGAQLMVRGLRDGTDLDYEMQMAGM
COAD_RHILO      VQLIEDATKAEFGRDGARIK-VVAFDGLVIDAARKQGASIMIRGLRDGTDLDYEMQMAGM
COAD_BARBK      VDLITQVGRDLLNVGPDRLQ-VISFNNLLIDTAREIGASFLVRGLRDGTDFDYEMQMAGM
COAD_CAUVC      VEILERETAHLKK--IAEIE-VRPFDSLLMHFARDVNAQMIVRGLRAVADFEYEFQMTAM
COAD_ZYMMO      ASMIRHEISRLENPTKSRIE-VIIYNSLLMDCVESQGASVILRGLRAVADFEYEYQMAGM
COAD_CHLTE      FDMVREV-----VRDLPNVSVDVLREGLLADYARQAGASAIVRGVRQVKDFEYEFQMSLL
COAD_TREPA      VDLMRQV-----LGDRPGVYVFPWR-SLVVTYARDVGARVLVRGVRNATDFCQEFDLAWV
COAD_BORBU      FSLTKDVIS---SLNFSNVL-VDRYSGFIVDYALINSIKFIVRGIRAFNDFDIEFERYLV
COAD_NEIMA      QDMLCDI-----TKMFPNVRTDVFENRFLVHYAREVDAGFIVRGIRSASDYEYERSMRHI
COAD_MYCCT      VENIKNLI---KDF--SNVEIIINENKLTTTIAKELNACFIIRGLRSQADFEYEIKYYDG
COAD_MYCPU      KTLLENEI---LDFDKSRVQVLVNKDSLTAEIAKKLGAKFIIRSARNDIDYQYELVLAAG
COAD_MYCPE      YQKVEEKI---DSLSIKNVEVIKW-DSKISDFAKIKTIYFIIRGIRDVNDFKFEKYIADI
                                                        .::. *   *   *      

COAD_STRA3      NKQLAD-DIETVYLSTSPSLSPISSSRIRELIYFKA---SVKPFVPKSVVREVEKMSEE-
COAD_STRA5      NKQLAD-DIETVYLSTSPSLSPISSSRIRELIHFKA---SVKPFVPKSVVREVEKMSEE-
COAD_STRMU      NSQLAK-EIETVFLLTALDYRYFSSSRIRELIHFGA---DISPYVPQGVVKEVGKKCENK
COAD_STRP1      NHLLAP-NIETVYLISRNKWQALSSSRVRELIHFQS---SLEGLVPQSVIAQVEKMNEKT
COAD_STRPN      NHQLSS-DIETIYLHSRPEHLYISSSGVRELLKFGQ---DIACYVPESILEEIRNEKKD-
COAD_STRR6      NHQLSS-DIETIYLHSRPEHLYISSSGVRELLKFGQ---DIACYVPESILEEIRNEKKD-
COAD_LACLA      NMEMT--GIETIFFLAKPELEPLNSTRMRELHAFGQ---DVSAWVPENVSRELRKLDEKK
COAD_BACHD      NKKLGP-DVETFFMMTSNQYSYLSSSIVKEVAKYEA---DVSDIVPPVVAEALKAKFSSS
COAD_BACSU      NRVLDE-SIETFFMMTNNQYSFLSSSIVKEVARYNG---SVSEFVPPEVELALQQKFRQG
COAD_OCEIH      NRKLNE-DIETLFMMTNNQYSFLSSSMVKEIAKYDG---NISGLVPEPVEKALKAKFNYL
COAD_LISIN      NRTLNA-DIETFFVMTNTKYSFLSSSMVKEVAQYQG---DIRELVPEVVNKAVKAKFNK-
COAD_LISMO      NRTLNA-DIETFFVMTNTKYSFLSSSMVKEVAQYQG---DISELVPEIVNKAVQAKFK--
COAD_STAAM      NKKLNN-EIETLYMMSSTNYSFISSSIVKEVAAYRA---DISEFVPPYVEKALKKKFK--
COAD_STAES      NKKLNS-NIETMYMMTSANYSFISSSIVKEVAAYQA---DISPFVPPHVERALKKKFNV-
COAD_NOSS1      NKTLST-QIETVFLATSNEYSFLSSSVVKEIARFGG---SVDHLVPPHIALDIYKCYNHN
COAD_SYNY3      NQTLWD-GVETVFLATAKEYSFLSSSIVKEIAKFGG---SVDHLVPPSILADICSSYPSP
COAD_SYNE7      NKTLAS-DLETVFLTTSTEYSFLSSSLVKEVARFGG---NVEHFVPSHVAAALYDQFHPV
COAD_THEEB      NKSLWP-EIETVFLTTSNEYSFLSSSLVKEIARFGG---NVRHLVPANVAKDLEACFTQT
COAD_CALS4      NKKLNP-SVETIFLMTSPKYGYLSSSLVKEIAQFGG---CLSEFVPDIVAERLMEKFKKS
COAD_LEPIN      NKKLAP-NVETVFLMSSGEYSFISSTIVKEVARHGR---DVSNQVPEIVSKALLKKLSQ-
COAD_COREF      NRRLSG--VDTFFLLTDEKYGYVSSTLCKEVARYGG---DVSGLLPEVVVDAVKQKYTQQ
COAD_CORGL      NRRLTG--VDTFFLLTDEKYGYVSSTLCKEVARFGG---DVSGLLPEVVAKAVTEKYSNQ
COAD_MYCLE      NKHIAG--VDTFFVATAPRYSFVSSSLVKEVAMLGG---DVSELLPESVNRRFREKMSGT
COAD_MYCTU      NKHIAG--VDTFFVATAPRYSFVSSSLAKEVAMLGG---DVSELLPEPVNRRLRDRLNTE
COAD_STRCO      NNGLSG--VETLFIPTNPTYSFLSSSLVKEVATWGG---DVAHLVPPLVLEALTERLRNR
COAD_DEIRA      NRQIGE--VETVFIMAATHWSFVSSSMVKEIASYGG---KIHEMVPPASEAALRRKFAEV
COAD_BIFLO      NRKLAG--IETLFLPADPILEHISSSIVKDVARHGG---DVTGMVPDCVVPMLADALAEE
COAD_AQUAE      NYKLAG--VETVFMMPSQEYIHISSTIVRDVASYCG---DLDNMVHPYVKQKLREKFNCG
COAD_CLOAB      NKKLNP-NVETVFMMTSLEFSFLSSTAIKQVAVFGG---CIKELVPDEIIDDVLRKAKEF
COAD_CLOPE      NRELAN-EVETVFMVTSPNYSYISSSAIKQVASFNG---EIKNFVPKEIVEDLEERIISL
COAD_FUSNN      NKKLSNGEVDTIFIPTSEKYTYVSSTFVKELAFYNQ---SLTGYVDDKVIVDILNRAKEY
COAD_THEMA      NKKLYS-DLETVFLIASEKFSFISSSLVKEVALYGG---DVTEWVPPEVARALNEKLKEG
COAD_BUCAI      NKQIYP-DLDSIFLLSSKEVSFISSSFVKEIAKYKG---DIKPYLPKEAHSALLRKLNND
COAD_BUCAP      NKQIYP-DLDSIFFLSSKEVSFISSSFVKEIAKYQG---NIKPYLPKEIHFALIKKFKDI
COAD_HELPY      NKSLNH-ELETLYFMPTLQNAFISSSIVRSIIAHKG---DASHLVPKEIYPLISKA----
COAD_HELPJ      NKSLNH-ELETLYFMPTLQNAFISSSIVRSIIAHKG---DASHLVPKEIYPFISKV----
COAD_CAMJE      NHALWE-DMETIYLMPSLKHAFISSSIVRSIVAHGG---DVSSLVPKEILPFLKDQSCM-
COAD_XANAC      NRHLIP-EVETLFLTPAEQYSFISSSLVREIARLGG---DVSGFVPASVVEALRQVRQSR
COAD_XANCP      NRHLIP-EVETLFLTPAEQYSFISSSLVREIARLGG---DVSGFVPASVVDALRQVRESR
COAD_XYLFA      NRHLIP-EVETLFLTPAEQHSFISSSLVREIARLGG---DVSGFAPAAVVAALRQNL---
COAD_ALLVD      NRRMAP-DIETLFLTPAEQYAYISSSLVREIARLRG---DVSTFVTPTVQAALRARFG--
COAD_RALSO      NRYLLP-DVETMFLTPSDQYQFISGTFVREIAQLGG---DVSKFVFPSVERWLVEKVGRR
COAD_ECOLI      NRHLMP-ELESVFLMPSKEWSFISSSLVKEVARHQG---DVTHFLPENVHQALMAKLA--
COAD_ECOL6      NRHLMP-ELESVFLMPSKEWSFISSSLVKEVARHQG---DVTHFLPENVHQALMAKLA--
COAD_SALTI      NRHLMP-QLESVFLMPSKEWSFISSSLVKEVARHQG---DVTHFLPDNVHQALMDKLK--
COAD_SALTY      NRHLMP-QLESVFLMPSKEWSFISSSLVKEVARHQG---DVTHFLPDNVHQALMDKLK--
COAD_KLEPN      NRHLMP-TLESVFLMPCKEWSFISSSLVKEVARHQG---DVSHFLPANVHQALLNKLK--
COAD_SERMA      NRHLMP-TLESVFLMPSEEWSFISSSLVKEVARHGG---DIAPFLPDVVTQALMAKLAAA
COAD_YERPE      NRHLMP-KLESVFLIPSEKWSFISSSLVKEVARHGG---DITPFLPKPVTKALLAKLA--
COAD_PROMI      NRHFAP-DLDSVFLLPSQNLSFVSSSLIKDVARHDG---DVSTFLPEVVATAMLQKLGKR
COAD_PHODP      NRRLMP-ELETVFLTPAEENSFISSTIVKEVALHKG---DVSQFVPNQISQALNKKLFA-
COAD_SHEON      NRRLSP-DLESVFLTPAEENSFISSTLVKEVALHGG---DVSQFVHPEVASALAAKLKLA
COAD_VIBCH      YRRLMP-GLESVFLTPAEEHAFISSTLVREVAIHGG---NVDEFVPAIVANALHQKKKI-
COAD_VIBVU      YRRLLP-GLESVFLTPSEEHAFISSTIVREVAIHGG---DVTQFVPTVVAEALHQKKKV-
COAD_PSEAE      NRQLAP-DVESMFLTPSEKYSFISSTLVREIAALGG---DISKFVHPAVADALAERFKR-
COAD_HAEIN      NRLLTK-GVDSLFFPPAEKWAFVSSTIVREIYLHGG---DVAELVPVPVFNALKAR----
COAD_PASMU      NRLLTN-GVESLFFPPSERWSYVSSTMIREIHLHHG---DVSQLVPEVVFHALQNLKK--
COAD_AGRFC      NRQMAP-DIQTVFLPAGTSSRPITATLVRQIAAMGG---NVDAFVPKAVLEALNAKLKR-
COAD_RHIME      NRQMAP-DIQTLFLPAGTASRPITATLVRQIAAMGG---DVSAFVPGAVHQALQAKRK--
COAD_BRUME      NGTMAP-ELQTVFLPADPAVRTITATLVRQIASMGG---DIKPFVPVAVAAALNTKFKS-
COAD_RHILO      NETMAP-ELQTVFLPASPSVRTITATLVRQIASMGG---DIRPFVPAAVAGALTAKFAK-
COAD_BARBK      NGIMAP-ELQTVFLPASISGRVITSTLVHQIAAMGG---DVTHFVPQNVAQALRLKFKF-
COAD_CAUVC      NQQLDR-EIETVFLMADPRHQAIASRLVKEIATLGG---DIGKFVPPGVAQQLLAKVGKG
COAD_ZYMMO      NQQINN-KIETVFLMADSVLQPVASRLVKEIAFYNG---NITPFVPPYVVQKLQEAVTRK
COAD_CHLTE      NRHLYP-EVTTVFLMPNVKYTYVASTIIREVSMLGG---DVSKFVHPYVLDQLSRKRAER
COAD_TREPA      HRALDA-GLETVFLAAKPCYAALRSSMVREVASFGG---DVSTFVPRVVARLLQEKFTQA
COAD_BORBU      NNKLNF-EIDTIFLPSSAEHLYVRSDFVKELMLKKDV--DLSNFVPELVFNRLKSKFIDK
COAD_NEIMA      NSDLAP-EISTVFLMPPREIAEVSSTMVKGLVGPEGWTETIHRYVPQAVYEKILAEHQHE
COAD_MYCCT      FKSLDP-NIEVVYFISDYDKRSLSSTILREIEFYKK------------------------
COAD_MYCPU      NKKINN-EVETILIFPDYDKIEINSTLIRHQKFIEN---LKK------------------
COAD_MYCPE      YKQEWD-KLEVVYFFSEKKLENISSRKIINLNKGKN---DYEN-----------------
                        :  . . .      . .                                   

COAD_STRA3      --------------------------------
COAD_STRA5      --------------------------------
COAD_STRMU      QKI-----------------------------
COAD_STRP1      --------------------------------
COAD_STRPN      --------------------------------
COAD_STRR6      --------------------------------
COAD_LACLA      --------------------------------
COAD_BACHD      PRNK----------------------------
COAD_BACSU      --------------------------------
COAD_OCEIH      --------------------------------
COAD_LISIN      --------------------------------
COAD_LISMO      --------------------------------
COAD_STAAM      --------------------------------
COAD_STAES      --------------------------------
COAD_NOSS1      YPTANPTTMEITPPHQNMATVAPQEILQEQET
COAD_SYNY3      --------------------------------
COAD_SYNE7      VERDRLT-------------------------
COAD_THEEB      PIPSQRPLE-----------------------
COAD_CALS4      --------------------------------
COAD_LEPIN      --------------------------------
COAD_COREF      --------------------------------
COAD_CORGL      H-------------------------------
COAD_MYCLE      S-------------------------------
COAD_MYCTU      RT------------------------------
COAD_STRCO      --------------------------------
COAD_DEIRA      YDKRDDA-------------------------
COAD_BIFLO      RQRKD---------------------------
COAD_AQUAE      S-------------------------------
COAD_CLOAB      N-------------------------------
COAD_CLOPE      RGEG----------------------------
COAD_FUSNN      RG------------------------------
COAD_THEMA      KR------------------------------
COAD_BUCAI      SIK-----------------------------
COAD_BUCAP      PQK-----------------------------
COAD_HELPY      --------------------------------
COAD_HELPJ      --------------------------------
COAD_CAMJE      --------------------------------
COAD_XANAC      AQA-----------------------------
COAD_XANCP      AQV-----------------------------
COAD_XYLFA      --------------------------------
COAD_ALLVD      --------------------------------
COAD_RALSO      HAESDKTA------------------------
COAD_ECOLI      --------------------------------
COAD_ECOL6      --------------------------------
COAD_SALTI      --------------------------------
COAD_SALTY      --------------------------------
COAD_KLEPN      --------------------------------
COAD_SERMA      --------------------------------
COAD_YERPE      --------------------------------
COAD_PROMI      --------------------------------
COAD_PHODP      --------------------------------
COAD_SHEON      KA------------------------------
COAD_VIBCH      --------------------------------
COAD_VIBVU      --------------------------------
COAD_PSEAE      --------------------------------
COAD_HAEIN      --------------------------------
COAD_PASMU      --------------------------------
COAD_AGRFC      --------------------------------
COAD_RHIME      --------------------------------
COAD_BRUME      --------------------------------
COAD_RHILO      --------------------------------
COAD_BARBK      --------------------------------
COAD_CAUVC      --------------------------------
COAD_ZYMMO      KSFQD---------------------------
COAD_CHLTE      RAH-----------------------------
COAD_TREPA      --------------------------------
COAD_BORBU      --------------------------------
COAD_NEIMA      N-------------------------------
COAD_MYCCT      --------------------------------
COAD_MYCPU      --------------------------------
COAD_MYCPE      --------------------------------