CLUSTAL format seed alignment for MF_00152

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

END4_BUCAI      -----------MNYIGAHVSSSG--GLEKTVLRAIQIKATAFSFFTKNQRQWFSPPLIQK
END4_BUCAP      -----------MNYIGAHVSSSG--GLEKAVFRAFQIKATTFSFFTKNQRQWISLPLQKK
END4_SALTI      -----------MKYIGAHVSAAG--GLANAPARAAEIGATAFALFTKNQRQWRAAPLTPQ
END4_SALTY      -----------MKYIGAHVSAAG--GLANAPARAAEIGATAFALFTKNQRQWRAAPLTPQ
END4_ECOLI      -----------MKYIGAHVSAAG--GLANAAIRAAEIDATAFALFTKNQRQWRAAPLTTQ
END4_YERPE      -----------MKFVGAHVSAAG--GVDQAVIRAHELEATAFALFTKNQRQWRAAPLAED
END4_VIBCH      ---------MYEKLIGAHVSASG--GVELAPVRAHEIGANAFALFTKNQRQWAAKPLEAS
END4_CHLMU      ---MFVLPPPQEPLLGAHTSAAG--GLHNALYEGRDIGATTIQLFTANQRQWKRRSLTQN
END4_CHLTR      ---MFILPPPQEALLGAHTSAAG--GLHNALYEGRDIGATTVQLFTANQRQWKRRTLTQE
END4_CHLPN      ---MKVLPPPSIPLLGAHTSTAG--GLKNAIYEGRDIGASTVQIFTANQRQWQRRALKEE
END4_AQUAE      -----------MALFGAHVSSAG--SILKTFKRAKDIGAEVFQFFLRSPRAWYWKGVDKE
END4_BACHD      ----------MTLHLGSHVSMNGKKMLLGSSEEAISYGANTFMVYTGAPQNTRRKPIEEL
END4_BACSU      -----------MLRIGSHVSMSGKHMLLAASQEAVSYGANTFMIYTGAPQNTRRKKIEDL
END4_LISIN      -----------MLRLGSHVSMSGKKMLLGASEEAASYGSNTFMIYTGAPQNTRRKPIEEL
END4_LISMO      -----------MLRLGSHVSMSGKKMLLGASEEAASYGSNTFMIYTGAPQNTRRKPIEEL
END4_STAAM      ------------MLLGSHVSMSGKKMLEGSAIEAYEYGETTFMIYTGAPQNTRRKSIEDL
END4_UREPA      -------MDKYNLIIGSHVSLKAKDFFYGSVKEALSYGSNTFMVYTGAPQNTKRQPIKSF
END4_MYCGE      ----------MPKLLGSFISFKAPNYFVQSAQDAIAIDATALMVFLGPPHSAYRVPFNKM
END4_MYCPN      ----------MPKLLGSFISFKSPHYLVGSVRDAVSIKAQAFMIFLGAPHTALRVDPNRM
END4_THEMA      -----------MIKIGAHMPIS--KGFDRVPQDTVNIGGNSFQIFPHNARSWSAKLPSDE
END4_THEAC      MIDEAIRSISKKYTIGGHISVAG--GLHNGPARAAVFGFPTFQFFSKNQMRWSSPPLKDD
END4_THEVO      -MDDDLKSIASKYYIGGHISVSG--GLHLAPERASIFGFRTFQFFSKNQMRWNSTPISEE
END4_MYCLE      ------------MLIGSHVSSTD------PLAAAEVEGADVVQIFLGNPQSWKAPTLRSD
END4_MYCTU      ------------MLIGSHVSPTD------PLAAAEAEGADVVQIFLGNPQSWKAPKPRDD
END4_HALSA      ------------MRVGAHVSIAG--GVDNAVTNELDVGGNCGQIFTHSPQVWQDPNIGAD
END4_STRCO      MSTASSSSSLPRNPVGGHVPVAG-GLHSVGLSYARELKAEAVQVFVANPRGWATPAGNPK
                              .*.. .                       .:               

END4_BUCAI      KIDQFKAMCIKYSFQPQQILPHSSYLINLGHPID-ELLRKSRKSFIDEMIRCSQLGLIFL
END4_BUCAP      NIEDFKKACIKYNFSPEKILPHSSYLINLGHPID-FFLEKSRVAFIDEIVRCDQLGLRFL
END4_SALTI      VIDDFKIACEKYHFSAAQILPHDSYLINLGHPVS-EALEKSRDAFLDEMQRCEQLGLTLL
END4_SALTY      VIDDFKIACEKYHFSAAQILPHDSYLINLGHPVS-EALEKSRDAFLDEMQRCEQLGLTLL
END4_ECOLI      TIDEFKAACEKYHYTSAQILPHDSYLINLGHPVT-EALEKSRDAFIDEMQRCEQLGLSLL
END4_YERPE      VIEKFKLACEKYGYTSAQILPHDSYLINLGHPVT-EALEKSREAFIDELVRCQQLGLSLL
END4_VIBCH      SIRAFKANCKKWGFGSEAILPHDSYLINLGAPEP-EKLDKSRAAFVDEMLRCDQLGLTLL
END4_CHLMU      MIEQFQTALDETSLS--YIMSHAGYLNNPGAPNP-EILEKTRICMYQEIADCIALGISFV
END4_CHLTR      MVDQFRIALNETSLS--YIMSHAGYLNNPGAPNP-EILEKTRVCMHQEIADCISLGISFV
END4_CHLPN      VIEDFKAALKETDLS--YIMSHAGYLINPGAPDP-VILEKSRIGIYQEILDCITLGISFV
END4_AQUAE      TKQAFIEKLKDFKNP---VMVHAPYLLNLASPNE-ELREKSVKVFLEELKFCDEVGIHFY
END4_BACHD      NIEAGRAHMKENG--IDHIIVHAPYIINIGNSEKPATFKLGVDFLQSEIERTQALGADQI
END4_BACSU      NIEAGRAHMQENG--IDEIIVHAPYIINIGNTTNPSTFELGVDFLRSEIERTAAIGAKQI
END4_LISIN      NIEAGLEHMKAHD--MADIVVHAPYIINIGNSVKPETFELGVNFLQSEIERTRALGAKQI
END4_LISMO      NIEAGLEHMKAHD--MADIVVHAPYIINIGNSVKPETFELGVNFLQSEIERTRALGAKQI
END4_STAAM      NITKGHEVMEKYG--LSNIVVHAPYIINIANTTKPETFNLGVDFLQQEIERTQAIGAKDI
END4_UREPA      KIEEAHNLLKKHNINLDDLIVHAPYIINPCSSKK-NVRELAKEFLIQEIQRTESMGITKL
END4_MYCGE      QFSLGYELLKTKNINSNGLVVHAPYIINCAS-KDPLKQQNAISVLTNEIQLCNLAGAHYL
END4_MYCPN      QIDEGHTLMEQHNLSKSGMVVHAPYIINCAS-KDPVKQTFAIDVLTREVKLCHAVGAKLI
END4_THEMA      AATKFKREMKKHGIDWENAFCHSGYLINLASPKD-DIWQKSVELLKKEVEICRKLGIRYL
END4_THEAC      EAAAFKSEVRKYGI--ESTMIHASYLINLASADP-DLYKRSMEAFHDEIDRSDKLGSTFL
END4_THEVO      EALRFISEVSSHSI--SSTMVHASYLINLASSSN-ELHQKSFNAFVEEIQRAERIDATFL
END4_MYCLE      ADVLKATAL-P-------VYVHAPYLINVASANS-RVRIPSRKILQQTCDAAADIGAAAV
END4_MYCTU      AAALKAATL-P-------IYVHAPYLINLASANN-RVRIPSRKILQETCAAAADIGAAAV
END4_HALSA      EAAAFREGTAADL--DGPWVIHSSYLVNLCTPKD-DLRAKSIDSMQAEVDAAHTLGIPYV
END4_STRCO      QDEAFREACAAGSV---PAYVHAPYLINFGSHTG-ATVERSVESLRHSLRRGRAIGALGV
                                     *  *: *                :          .    

END4_BUCAI      NFHPGSHLNKITENACLLRVSDSINIA---LEKTQNVIAVIENTAGQGTNIGYCFEHLSE
END4_BUCAP      NFHPGSHLNKISEVTCLSRISESINIA---LEKTKNVVAVIENTAGQGTNIGYRFEHLYE
END4_SALTI      NFHPGSHLMQIAQEDCLARIAESINIA---LAQTEGVTAVIENTAGQGSNLGFEFEQLAA
END4_SALTY      NFHPGSHLMQIAQEDCLARIAESINIA---LAQTEGVTAVIENTAGQGSNLGFEFEQLAA
END4_ECOLI      NFHPGSHLMQISEEDCLARIAESINIA---LDKTQGVTAVIENTAGQGSNLGFKFEHLAA
END4_YERPE      NFHPGSHLLQIDEDQCLARIAESINIA---LDATEGVTAVIENTAGQGSNLGFKFEHLAA
END4_VIBCH      NFHPGSHLQQVSEEACLATIAESINLA---HRQVPNVIAVIENTAGQGSNLGWRFEHLAA
END4_CHLMU      NFHPGAALSD-SKESCLDRAITSFSQMAPLFETNPPLVVLLETTAGQGSLIGSSFEELAY
END4_CHLTR      NFHPGAALSD-SKESCLDRTIASFSQMAPLFENNPPLVVLLETTAGQGSLIGSSFEELAY
END4_CHLPN      NFHPGAALKS-SKEDCMNKIVSSFSQSAPLFDSSPPLVVLLETTAGQGTLIGSNFEELGY
END4_AQUAE      NFHPGTAKGI-SDEEGLRNVIKSLEEVFS-EYTPKFTTVLLENTAGERGDLGKNFKELKE
END4_BACHD      VLHPGAHVGA-GVDKGIEKIIEGLNEVLTE---NDGVQIALETMAGKGSECGRTFEEIAR
END4_BACSU      VLHPGAHVGA-GAEAGIKKIIEGLNEVIDP---NQNVQIALETMAGKGSECGRSFEELAQ
END4_LISIN      VLHPGAHVGE-GADKGIKQIIQGLNEALIH---DQDVQIALETMAGKGSECGRTFEELAQ
END4_LISMO      VLHPGAHVGE-GADKGIKQIIQGLNEALIH---DQDVQIALETMAGKGSECGRTFEELAQ
END4_STAAM      VLHPGAHVGA-GVDAGINKIIEGLNEVLTN---DNNVRIALETMAGKGTEIGRSFEELAR
END4_UREPA      VLHPGSRLEQ-NEDIALEQVYTMLNDIFSTI--NTNVIVCLETMAGKGSEIGVNIKQLKT
END4_MYCGE      VLHPGSAVAQ-TTNEALDNLVKVLNQVINK---TKTTVICLETMAGKGNEIGRDLTELKY
END4_MYCPN      VLHPGSAVEQ-TQTQALDHLIKVLNTVIAN---TKEVIICLETMAGKGNEIGRDLDQLKY
END4_THEMA      NIHPGSHLGT-GEEEGIDRIVRGLNEVLNN---TEGVVILLENVSQKGGNIGYKLEQLKK
END4_THEAC      TVHPGSNPDR---ADGIRRVRDALSTI----G-DHAVIILIENTAGQGNVIGTRLDEVAK
END4_THEVO      TFHPGSNGNK---DEGIRKIKEAIEKV----E-THKVKLLVENTAGQGNVIGSTIYEIGQ
END4_MYCLE      VVHGGYVADDNDLEDGFQRWRKALDQL------QTDVPVYLENTAGGDHAMARRFDTIAR
END4_MYCTU      IVHGGHVADDNDIDKGFQRWRKALDRL------ETEVPVYLENTAGGDHAMARRFDTIAR
END4_HALSA      NVHLGAHTGA-GVDDGLDNAASALDEL----DIPDDVTVLIESDAGSGTKLGGDFEHLHE
END4_STRCO      VVHTGSATGGRERPVALKQVREHMLPLLDELTHDDDPYLLLESTAGQGASLCSRTWDFGP
                 .* *           :      :                :*. :            .  

END4_BUCAI      IIKNIDDKSRVGVCIDTCHLFASGYDLRTKKDCENTFEKFNSLIGLKYLKGIHLNDSKKK
END4_BUCAP      IIKKIDDKSRIGVCIDTCHLFASGYDLRTKIDYESTFNKFFDLIEMKYLKGFHLNDSKKQ
END4_SALTI      IIDGVEDKSRVGVCIDTCHAFAAGYDLRTPEACEKTFAEFGKIVGFQYLRGMHLNDAKSA
END4_SALTY      IIDGVEDKSRVGVCIDTCHAFAAGYDLRTPEACEKTFAEFGKIVGFQYLRGMHLNDAKSA
END4_ECOLI      IIDGVEDKSRVGVCIDTCHAFAAGYDLRTPAECEKTFADFARTVGFKYLRGMHLNDAKST
END4_YERPE      IIERVEDKSRVGVCIDTCHAFAAGYDLRTEEDCEHTFAALGKIVGFQYLRGMHLNDAKSE
END4_VIBCH      IIDQVEDKERVGVCLDTCHTFAAGYDLRTKAACDETFAEFERVVGMHYLRAMHINDSKGK
END4_CHLMU      LIQGIKAHIPVGVCLDTCHIFAAGYDISSPEGWEQVLKHFDEVIGLSFLRAIHLNDSIFP
END4_CHLTR      LIQGIKAHIPIGVCLDTCHIFAAGYDISSVAGWEQVLKHFDAVIGLSFLRAIHLNDSVFA
END4_CHLPN      LVQNLKNQIPIGVCVDTCHIFAAGYDITSPQGWEDVLNEFDEYVGLSYLRAFHLNDSMFP
END4_AQUAE      IMNVFRG-IKLGVCLDTCHAFAYGYEINTKEGFENFKREIEKMVGLESVKAVHANDSKVP
END4_BACHD      IINGVTHNDRLSVCFDTCHTHDAGYNI--VEDFDGVLNEFDKIIGVERIKVLHINDSKNP
END4_BACSU      IIEGVTHNEQLSVCFDTCHTHDAGYNI--VEDFDGVLNEFDKIIGIDRIKVLHINDSKNV
END4_LISIN      IIDGVTHNELLSVTFDTCHTHDAGYDI--VNDFDGVLNEFDKIIGIDRLKVLHINDSKNE
END4_LISMO      IIDGVTHNELLSVTFDTCHTHDAGYDI--VNDFDGVLNQFDKIVGIDRLKVLHINDSKNE
END4_STAAM      IIDGVHNNERLSVCFDTCHTHDAGYNV--KEDFDGVLNEFDKIIGVDRIKVVHVNDSKND
END4_UREPA      IIDNVHSKKNIGVCLDTCHMNDSGLILD-YYNFNQYLKEFDAQIGINYIKVLHINDSKNP
END4_MYCGE      VIDRIVDKDRIGVCLDTCHFHDSGIDF---SDLTGVFNTITTKLGFEFLKVIHLNESKNN
END4_MYCPN      VINHIEQQERIGVCLDTCHFHDSGNDF---NNTAEIMETIDTKLGFEFLKVIHLNESKNV
END4_THEMA      IRDLVDQRDRVAITYDTCHGFDSGYDITKKEGVEALLNEIESLFGLERLKMIHLNDSKYP
END4_THEAC      IIDTSDK--KLGVCIDTCHAWASGYDL--RDSLEKFIESLDYTIGLDRIFAFHLNDAKRE
END4_THEVO      IIDGFDS--SVGVCIDTCHAWAAGYDI--TNKYDEFIDELDSAIGLDRIYAFHLNDAMKD
END4_MYCLE      LWDVIGE-TGIGFCLDTCHAWAAGEGL------IHVVDRIKAITG--RIDLVHCNDSKDE
END4_MYCTU      LWDVIGD-TGIGFCLDTCHTWAAGEAL------TDAVDRIKAITG--RIDLVHCNDSRDE
END4_HALSA      VLTRSDQ--DLDVCIDTAHAFAAGYDLSTEAAVNDTLAAFDDVVGLDHLQYVHLNDSKHA
END4_STRCO      YFEALDAHPKLGVCLDTCHIFAAGHDLTGPSGMHQTLDLLVDTVGEGRLRLIHANDSKDV
                          : .  **.*    *  .            :        :  .* *::   

END4_BUCAI      INSRVDRHESLGLGEIGTAAFTWIIKNENFSNIPIILETAN--------PMIWEEEIDWL
END4_BUCAP      FNSRVDRHENLGLGEIGKSVFKWIIKNKNFHNIPMILETIN--------PKLWEKEIDWL
END4_SALTI      FGSRVDRHHSLGEGNIGHDAFRWIMQDARFDGIPLILETIN--------PDIWAEEIAWL
END4_SALTY      FGSRVDRHHSLGEGNIGHDAFRWIMQDGRFDGIPLILETIN--------PDIWAEEIAWL
END4_ECOLI      FGSRVDRHHSLGEGNIGHDAFRWIMQDDRFDGIPLILETIN--------PDIWAEEIAWL
END4_YERPE      FNSRVDRHHSLGEGNIGKTVFSYIMRDSRFDNIPLILETVN--------MDIWAEEIAWL
END4_VIBCH      LASRVDRHHSLGMGEIGWECFEYIAQDARFNGIPLILETID--------PDIWATEIATL
END4_CHLMU      LGKNKDRHAPIGEGCIGSESFCFLMRDERTRKLPKYLETPGG-------PDLWTKEIRYL
END4_CHLTR      LGKNKDRHAPIGEGCIGSDSFCFLMQDERTRMLPKYLETPGG-------PDLWTKEIRYL
END4_CHLPN      LGANKDRHAPLGEGYIGKESFKFLMTDERTRKIPKYLETPGG-------PENWQKEIGEL
END4_AQUAE      LGGRKDRHEHIGKGYIGLEGFKNLLKDEYFSTLPYYIETPKE-------NNMDPVNLSVL
END4_BACHD      RGAAKDRHENIGFGHIGFKALHYIVHHPQLQDIPKILETPYVGEDKKNKKPPYKFEIDMI
END4_BACSU      KGARKDRHENIGFGEIGFDALQYVVHHEQLKDIPKILETPYVGEDKKNKKPPYRFEIEML
END4_LISIN      RGAHKDRHANIGFGHIGFDALHYIVHHPQLSNIPKILETPYVGEDKASKKAPYKWEIAML
END4_LISMO      RGAHKDRHANIGFGHIGFDALHYIVHHPQLADVPKILETPYVGGDKASKKAPYKWEIAML
END4_STAAM      RGAQKDRHENIGFGYIGFDALNYIVHHDSFKDIPKILETPYVGEDKKNKKPPYKLEIEML
END4_UREPA      CGANKDRHENLGYGTIGFANLINIIYHPLLNNIPKILETPWFNVNDE-LIPLYKHEIKMI
END4_MYCGE      CGSKKDRHANINAGMIGFENLMKFISHPQIKDLPIILETP---STSLNYPTIYREEISQI
END4_MYCPN      CGSKKDRHANLGEGMIGFDNLMRFIAQPQIKQIPIVLETP---SDKHNYPAVYGAEIERI
END4_THEMA      LGAAKDRHERIGSGFIGEEGFAVFFSFKEIQEVPWILETP---GGNEEHAEDIKKVFEII
END4_THEAC      MGSRIDRHELIGKGTID-GGLINLIRDDRLRAKPKIMETPFG-------EARFEDNLRYM
END4_THEVO      LGSNIDRHELIGRGKIG-EGLIKLISDVRLFGKPKIMETPYG-------EAKFEENLKYI
END4_MYCLE      AGSGRDRHANLGSGQID---AELLVAAVKVAGAPVICETAE---------EGRKDDIAFL
END4_MYCTU      AGSGRDRHANLGSGQID---PDLLVAAVKAAGAPVICETAD---------QGRKDDIAFL
END4_HALSA      CGTNKDEHAHIGEGHIGEAGMRAFINHDAIADVPLVLETPHE------DGRGFAWNIDRV
END4_STRCO      AGAHKDRHENIGAGHIGEDPFRALMTHPATDGVPLVIETPGG-------KEGHAADVARL
                     *.*  :. * *.      .         *   **                 .  :

END4_BUCAI      RSQKKL-----------
END4_BUCAP      RSLQ-------------
END4_SALTI      KAQQIAEAMA-------
END4_SALTY      KAQQIAEAMA-------
END4_ECOLI      KAQQTEKAVA-------
END4_YERPE      KSQAEIEPSL-------
END4_VIBCH      RKFSTQKEN--------
END4_CHLMU      QKVS-------------
END4_CHLTR      QKVC-------------
END4_CHLPN      LKFSKNRDS--------
END4_AQUAE      REIYQNNDL--------
END4_BACHD      RNGTFHEGLLEKIVAQ-
END4_BACSU      KEKQFDDTLLEKILQQ-
END4_LISIN      RNGEFDPDLLNKIQNS-
END4_LISMO      KNGEFDPDLLNKIQNS-
END4_STAAM      KQQQFDPELKNKVMQQ-
END4_UREPA      RDCKWY-DIKNKLLSKK
END4_MYCGE      R--SWFKTYQPDAN---
END4_MYCPN      R--AWFGAR--------
END4_THEMA      EKFGIEVD---------
END4_THEAC      SSKIGE-----------
END4_THEVO      RKKLGE-----------
END4_MYCLE      REKTSG-----------
END4_MYCTU      RERTGS-----------
END4_HALSA      RDLRA------------
END4_STRCO      KKLRDG-----------