CLUSTAL format seed alignment for MF_00154

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

CYOE_XYLFT       -------------------------------------------MAARLRDYWDLTKPKVV
CYOE_ALCBS       ---------------------------M--------------SERTHWRDYLALTKPGVV
CYOE_METCA       -----------------MTTN--SSGKP--------------AGGISWRTYLALCKLKVV
CYOE_NITOC       -----------------MTTI--TLIR---------------GALTNWREYLVLCKPRIV
CYOE_ALKEH       -----------------MQDV--VTPAG--------------GVWVHWRDYLTLTKPRVV
CYOE_COXBU       -----------------MRTRTEIVSTT--------------QTSATWRDYFQLCKPRVV
CYOE_LEGPL       -----------------MRTE----YAD--------------RLPVDWRDYVELCKPRVV
CYOE_HAHCH       -----------------MK----NTAST--------------TAAAGWRDYYELCKPRVV
CYOE_MARHV       -----------------MKALPIQNPTH--------------ASTISWRDYLELTKPRVV
CYOE_PSEU5       -----------------MAT---LLSER--------------GAQASWRDYLELTKPKVV
CYOE_SACD2       -----------------MTEQ--ASISN--------------HDVAGWRDYLELTKPNVV
CYOE_SHEON       -----------------MAKPLSISS-------------QPS-VNVAWRDYFEMTKPKVV
CYOE_SHEAM       -----------------MAKSLSITP-------------VSGLSRLPWRAYLEMTKPKVV
CYOE_COLP3       -----------------MPSVINTGHHHF----------SISNIFANWRAYYDITKPKVV
CYOE_IDILO       --------------------MQSVATNN-----------ITKTRNAHWRDYLELTKPRVV
CYOE2_PSEA6      -----------------MSKSVGVAPHN-----------IVNKSGLHWRDYYEMTKPKVV
CYOE_PHOPR       -----------------MAKSQALGNAPLTSTVAENATTRSTSKPNIWRDYLTMTKPKVV
CYOE1_VIBPA      -----------------MSKEIALTL---------------DSRKRLGSTYLKLTKPKVV
CYOE_VIBVY       -----------------MSKTLSVDK---------------SQLRSPWSTYWTLTKPKVV
CYOE2_PSEHT      -----------------MALTIDKKAIQPINTL-----PLITRSYNLLQDYLAISKFKVV
CYOE_PSYIN       -----------------MANSITHNTATVSASLNED--SLTESRLPTINDYLELCKIKVV
CYOE_VESOH       --------------------------------------------MPLISDLLALCKLKVV
COXX_METPP       --------------MSETLATPPAALHT---------------WLSRWRQFSALTKPRVV
COXX_LEPCP       ------------------MNAPSSAAGH---------------VSSHWRQYVALTKPRVV
COXX_POLSJ       --------------MNPSNPAASAPHSR---------------APSRFAQFYALTKPRVV
COXX_BORA1       -----------------MTSIAAPQPG-------------------LLRQYLVLTKPRVT
COXX_JANMA       -----------------MTTLTAS-PN-------------------RIAQYWALTKPRVT
COXX_PARXL       ----------------MDSTTLSQTPG------------------SRVSQYIALTKPRVT
COXX_RALSO       ----------------MASTSTSTQPSG---------------WRHTASQYAALTKPRVT
COXX_POLAQ       ----------------MSTSNSSIPAS-----------------MPRWRQYWVLTKPRVT
COXX_AROAE       -------------MSVLNTRTLTLDRHA---------------AARRLHAFYVLTKPRVN
COXX_THIDA       --------------------MESLMIQG---------------AACRCQQFLALCKLRVV
COXX_NITEC       ------------------MSTNPLVWQQ---------------ATVRIQQFYRLTKPRVV
COXX_NITMU       ------------------MATTSIAWQQ---------------TASRVQQFYRLTKPRVV
COXX1_CHRVO      --------------------MSAVGLPL---------------WRQHAHALWQLSKPRVV
COXX_DECAR       -----------------MQTIATPSLPL----------------GQRLAAFSHLCKPRVN
COXX_ACICJ       --------MSDTILRTSATAVPDTALLDQSL------------LGATAGDWLALLKPRVL
COXX_GRABC       --------MSDSAFVNGGREVSSLPLSAQMP------------GMASAADWVTLLKPRVM
COXX_GLUOX       --------MSDTATPLAPSGVFSVPGKD---------------GDPSLREWLALLKPRVI
COXX_GLUDA       --------MSGAATTEGAVTRFDAALVG---------------TEA--RDWFALLKPRVI
COXX_RHIL3       --------MTVIDNHGVLAKDG--ELSE-----------------ASARDYFELLKPRVM
COXX_AGRFC       --------MTVIDDRDMMGAESS-ELSE-----------------AGARDYFELLKPRVM
COXX_SINMW       --------MTVIDNHEAVGMEGAPRLSE-----------------ASARDYFELLKPRVM
COXX2_RHILO      --------MALVD--ETSIDEAGFRMSE-----------------ATAGDFFALLKPRVM
COXX_CHESB       --------MALVE--REHMKEDAGRLSE-----------------ATAGDFIALLKPRVM
COXX1_RHILO      ---------MSTR--EGRLKDTSIRLSE-----------------ATAADFFALLKPRVM
COXX_OCHA4       -----------ME--KNAGTDDALALSE-----------------ATARDYLVLLKPRVM
COXX_BART1       --------MSVSG--ELSVANGKSTPPK-----------------SSISDYIALLKPRVM
COXX_BARBK       --------MSISG--KLLTEDNQLISPV-----------------ATVYDYIALLKPRVM
COXX_NITHX       --------MPVVDQNAIELP-PRISEA-------------------SVADYFALLKPRVM
COXX_RHOPB       --------MSVVESHDIEFAAPRISEA-------------------SVADYIALLKPRVM
COXX_AZOC5       -----------MNENAGRSLAPQASEGL-----------------GTPRDYISLLKPRVM
COXX_BEII9       --------------MTFISQAPSVSISS-----------------AGPSDYFALLKPRVM
COXX_METS4       -------MTSLTNSLNPARSLAPASN-------------------GDVADFFALLKPRVM
COXX_METRJ       -------MTSLTNTIGPDVPGPALTTAG-----------------GDVPDYFALLKPRVM
COXX_PARL1       --------MSDTAISNQRDTAAFPEGGM-----------------GSARDFFELLKPRVM
COXX_DINSH       --------MSDAS----FDRSMPLSG-E-----------------GSFGDYFALLKPRVM
COXX_RHOS5       --------MTDI-------RITEVPR-E-----------------AGFGDYFALLKPRVM
COXX_ROSDO       --------MADVG----YTSSPAAKEYE-----------------AQLGDYFALLKPRVM
COXX_RUEST       --------MTDAS----INASMTREE-E-----------------ASLGDYFALLKPRVM
COXX_PARDP       --------MADI-------NAYEGPA-E-----------------AGFGDYVALLKPRVM
COXX_JANSC       --------MSDFT----AQTTTEPREYD-----------------AGFGDYFALLKPRVM
COXX_CAUSK       ---------MARSTVLTPEDEATPAVRH-----------------ARWQDYFQLMKPRVM
COXX_HYPNA       ---------------MTELTAATPTKRP-----------------ATATDYVNLMKPRIM
COXX_MARMM       ---------MDTIVTPSDHRAEGEAVST-----------------ASPRDYFDLMKPRVM
COXX_ERYLH       -----------------MTTAASPAALP-----------------ADWRDFFALTKPRVM
COXX_NOVAD       ------------------MDSAKPLALP-----------------ADWRDFFALTKPRVM
COXX_SPHAL       ----------MAGVIMAQSLTHDAMTLP-----------------ADWRDLLALTKPRVM
COXX_SPHWW       ---------------MASKAHPVATTAA-----------------ADWRDFLALTKPRVL
COXX_NEOSM       -----------------MFQVVSKTDWL------------------TVRAYFALLKPRVV
COXX_ANAMM       -----------MTATFIKTSRGKSPASL-----------------SSVGDYVQLLKPRIM
COXX_ANAPZ       ---------------MVLMMGVPQHFAL-----------------STARDYWQLLKPRIM
COXX_EHRRW       ---------------MGIQSSTMKLPLI-----------------HEISDYWHLLKPKIM
COXX_WOLTR       ------------------MHANTLLNVE-----------------STVLDFWRLLKPRIM
COXX_RICPR       -----------MSSLVTQINFNKINNSQ-----------------STVKDYILLMKPRVM
COXX_RICBR       -----------MNSLTKSINLDKVSYPQ-----------------STVKDYILLMKPRVM
COXX_ORITB       -----MLNSHSTQSTPVKNFQNKFLVLT-----------------STPKDFLLLMKPSVM
COXX_PELUB       ------------MINSKLKNRNLNQVNV-----------------FNFSELFKLMKPRVM
COXX_LEPIC       -----------------------------------------MASSTFFSDWNQMLKPRVT
COXX_LEPBP       ----------------------------------------------MFRLWNQLTKPRVT
COXX_PROMT       ---------MVSSTSELITQPVNREE------------VVPSRKRIKLPAWLEVVKPRLI
COXX_PROMA       ---------MVSSTSQIISTSPSRDD------------VVPSRKKVTLPPWLEVAKPRLI
COXX_SYNSC       ---------MAEITA---TVRPTREE------------VVPSRKRVKLPAWLEVAKPRLI
COXX_PROMP       ---------MKSNLENLNFQTSIREQ------------VVPSRKKVKLPAWLEVAKPRLI
COXX_SYNR3       -----------MAEVPIAVPVSIRDE------------VVPSRKRVKLPPWLEIAKPRLI
COXX_FRASN       ---------MAAPAAGAEPSSDP----------LVVPRGRLARATDRARSYIALMKLRVV
COXX_ACIC1       -------------MTALAPSSTP----------LPAGR---RGAVDIVKGLIALTKPRII
COXX_NOCSJ       -------------MTYVGQSASA----------AQQSVAERASVKDVLAAYVGLTKPRVI
COXX_CUTAK       MPFSISKDTVSNQTTHVATAPASQRPDPVETKVEQEQGRPRLSSRDVVHAYVALTKPRII
COXX_THEFY       --MTLLGRPAATDTCAAADSPTG-------------GVSRSASLGTYIRAYIALSKPRVI
COXX_ARTS2       ------------MSTTDTPLNASRLP-------------GKIGIARKAKAYLALTKPRVI
COXX_RENSM       ---------MRLTQAPATTAAAGNPP-------------HKLGFAAKTKAYIALTKPRVM
COXX_CLAMS       --------------MNVAVQSRVDR--------------ETIGVARKTKAYVALTKPRVI
COXX_LEIXX       --------------MDVAVESRVEPV-------------GRIGVSRKVKAYISLTKPRVV
COXX_TROWT       ----------------MGMQGRS--------------------FARQIRAYVSLTKPRVV
COXX_KINRD       ------MTVADPRLTDAPAHSRTSLLG--------RRRGGRPPRFPRAAAYVALTKPRIV
COXX_STRGG       ------MTAVESRPAGVALTPSP---------------GAHRPSGARVKAFVALTKPRII
COXX_CORDI       -------------------------------------MNMLEETLETIKAYVALTKPRVI
COXX_CORJK       ----------------------------------------MKTFAETAKAYLALTKPRVI
COXX_MYCLE       ---------------MRSRGVKYVS----------VRARLA---RSRVLAYLALTKPRVI
COXX_MYCGI       ---------------MRIREGHLIN----------DSAEGPIGLRTRLMGYIGLTKPRVI
COXX_NOCFA       ---------------MLADRFTGSG----------LPSRLM----RRVLAYIALTKPRVI
COXX_RHOJR       -----------------------------------MLGRVT----GKVLAYIALTKPRVI
COXX1_SACEN      ---------------MTAAPAAANN--------AAPAPKTPRR--GVLAAYLALTKPRVI
COXX2_SACEN      ---------------MTKEFHAVGERSVVTTAVDAPQARHARRPAELLKAYAGLIKPRVI
COXX_SALTO       -------------MSMITERPVSDPAGQSVSATGDGAVGSRRDMRAVVAAYVALTKPRIV
COXX_SYNY3       -------------MVTSTKIHRQHDS-----------------MGAVCKSYYQLTKPRII
COXX_SYNP2       --------------MLGTSLSPHHEN-----------------FWAVIKSYYQLTKPRII
COXX_MICAN       --------------MTGTQALRHHDN-----------------FLQVAKSYYQLTKPRII
COXX_TRIV2       -------------MIETNVSRRHHES-----------------FLQVIQSYYQLTKPRII
COXX_TRIEI       -----------MQQVISHSLPRRHNN-----------------ILQVFKSYYQLTKPRII
COXX_THEEB       -------------MTFLARLSSSTGD-----------------LSTKLVDYVQLTKPRLI
COXX_ACAM1       -----------MQKTIWAEVPWLHPG-----------------FAQTCIDFYQLTKPRLI
COXX_SYNJA       ---------------MTGIPFGHHQS-----------------LAQVLRSYSQLVKPKII
COXX_SYNE7       -----------MTLSSDSRLRFPLEE-----------------VGAQLLAYWQLTKPRII
COXX_GLOVI       -----------MQETLLSRAERSVPR-----------------LSAALNDYYQLTKPRIQ
COXX_DEIRA       -------------MTSTPLSNSLPPT-----------------QHATWRDYLALTKPKVI
COXX_SYMTH       ----------------MFAQARDRLQ-----------------SGQVVRDYVALTKPRIV
COXX_SULTO       -----------------------------MKITRIYVRLMAISLSRKLIDYIKLSKPRVI
COXX_SULAC       ---------------------------------------MSVTLSRKLIDYVKLAKPKVV
COXX_METS5       ---------------------------------------MATSISARLIYYAKLSKPRII
COXX_SACS2       -----------------------------------------MSLQQKIKAYLKLGKLGVV
COXX2_PICTO      --------------------------------------------MSMTSQIMKITKLEIT
COXX1_MAGSA      ---------------------------------------------MTFRQYIELLKPRIA
COXX2_MAGSA      -------------------------------------------MTANLKVLASVFKLRIG
COXX1_CENSY      ---------------------------------------------MGAREILEVSKPRIV
COXX_THEAC       -------------------------------------------MTSKAMLYFSYTKPKVW
COXX_THEVO       -------------------------------------------MVSRVRLYFGYTKPKVW
COXX1_PICTO      -------------------------------------MNKAYMYMNKLRAYFIYSKPQVW
COXX2_CENSY      --------------------------------------MQREKAQSRVAVYYELSKPKIW
COXX_DESAP       --------------MGDRLTGLHAPTTEAGAASADHTAVVRPGFRDTAKAYVEVTKPISV
COXX_PYRNV       -----------------------------------------------MNPYIVLLKPRVI
COXX_PYRAR       -----------------------------------------------MNPYLILLKPRVI
COXX2_PYRAE      -----------------------------------------------MSPYISLLKPRVI
COXX1_PYRCJ      -----------------------------------------------MKAYLTLLKPRVI
COXX2_PYRCJ      -----------------------------------------------MKPYLVLLKPRVI
COXX_CALMQ       ----------------------------------------------MINEYLKLMKPHVI
COXX_KORCO       --------------------------------------MQVEVFKVKLSDLLCLTKPKQT
COXX_ARCFU       --------------------------------------------MEKLKALIEVTKPKQT
COXX_AERPE       --------------------------------MVSSTAGYRSSALGKLKAFISLTKPRQL
COXX_HYPBU       --------------------------------------MQLSRVRSVLLDVFALAKVKQT
COXX_THEPD       -------------------------------------------MAPSAKDLLELFKVKQT
COXX_FLAPJ       ----------------------------------MSAINTLPPIKSIFNDFKEITKAGLA
COXX_FLAJ1       ----------------------------------MNAAKNTLSIKSIFLDFKEITKAGLA
COXX_GRAFK       ----------------------------------MSNTRVHNPSASILSDFKEITKMRLA
COXX_CYTH3       -------------------------------------------MASQFQAYFKLTKFRLT
COXX_GEOMG       ----------------------------------------------MIAEASRLLRPRLA
COXX_GEOSL       ----------------------------------------------MTRQDLVLFRPRLA
COXX_DESAG       ----------------------------------------------MLRAASSLFRFRVA
COXX_DESVV       ------------------------------------------MGRCTIADVAMLIRWRVS
COXX_SOLUE       -----------------------------------------------MRDYIELTKPRIT
COXX_KORVE       -----------------------------MSSVTQPLAVPRPGVASLLRDYSELTKARVT
COXX_SALRD       ----------------------------------------------MLWDYLILAKPEIS
COXX_OPITP       -------------------------------------MSTTPASNAKFSDYLELTKPRLS
COXX_ANADE       ------------------------------MTVATAQARTAPQPLAYLKDLVLLSKPRLS
COXX_ANADF       ------------------------------MTIATASARARPSSLQYAKDLLLLAKPRLS
COXX_MYXXD       ---------------------------------MNARAESLPT---VASDLISLTKPRLS
COXX_SORC5       ----------------------------------------------MVVATMLGGMWVAS
COXX_GEOUR       ------------------------------------------------------------
COXX_AQUAE       ------------------------------------MSERVEAGQNVIKEYLVLTKPGIV
CYOE_ECOLI       ---------------------------------------------MMFKQYLQVTKPGII
CYOE_PHOLL       ----------------------------------------------MIKQYLQVTKPGII
COXX_METFK       -----------------------------------------------MKQYLLITKPGII
CYOE_PSE14       ---------------------------------------------MSLKHFIQITKPGII
CYOE_CHRSD       ----------------------------------------------MLKPFVSITKPGII
CYOE2_SHEWM      -----------------------------------------------------MIKPGII
CYOE1_PSEA6      ---------------------------------------------MKVKRYINITKPGII
CYOE2_SHELP      ----------------------------------MIRHSTSTQVAAPLGAYLQVTKPGII
CYOE1_PSEHT      ----------------------------------------------MFRRYLSVTKPGII
CYOE_MARMS       ----------------------------------------------MFKRYLQVTKPGII
CYOE2_PSEA7      ---------------------------------------------MKLKRYLLVAKPGII
COXX2_CHRVO      ---------------------------------------------MKFKRYLQVTKPGII
CYOE_ACIAD       ----------------------------------------------MLKKYLFLTKPGIL
CYOE2_VIBPA      ----------------------------------------------MLKSYLSITKPGII
COXX_PARUW       ----------------------------------------------MINYYLLLTKPGII
CYOE_BLOFL       ---------------------------------------------MTIQYYFDLIKPGIV
CYOE_BLOPB       ----------------------------------------------MIKYYLYLTKPGIV
CYOE_BAUCH       ----------------------------------------------MIRLYLQATKPGIV
CYOE_WIGBR       ----------------------------------------------MIIKFIQIIKPGII
CYOE_BUCCC       -----------------------------------------------------MIKPGII
CYOE_BUCAI       ----------------------------------------------MFKNYIEITKPGII
CYOE_BUCAP       ----------------------------------------------MLKDYLEITKPRII
CYOE_BUCBP       -----------------------------------------MYYVNVILYLLEVLKPKII
CYOE_FRATH       ---------------------------------------------MYFKRYLQLAKPGII
COXX1_BACVZ      --------------------MNSNAAQTEQPMKHN-------GNRMTVKDFIILAKPGII
COXX1_BACSU      -----------------MENTRDSAAISETKYIKA-------SNRVTIYDFIKLAKPGII
COXX_BACLD       --------------------MAETRITADTAMNG------QIEETTAWKDFLALIKVGIV
COXX_BACP2       --------------------MANSKTAAEAAIHG------QIEKTTAWKDFLALIKMGIV
COXX_GEOTN       --------------------MADLKAVQEADVRQRP----QASIKLFWKELSAVVKIGIV
COXX2_BACCN      ------------------MNHATSELHDESAVTD-------VPETTRVQDLLALVKMGIV
COXX_BACPE       ------------------MNKSNTAIDPTNVIEAGPDSSVADVQQKSWKDYLVLAKQGIV
COXX_LISIN       --------------------------MNQIEKTGE-----LTSSRFTVRDFTELVKIGIV
COXX1_LYSSC      --------------------MSNGRTLAATRNTGP-----ETTS--VVKDFLALIKIGIV
COXX_OCEIH       ---------------MNKVEMTYSELIGNTSISNK------QKVVMFTSEIKALIKIGIV
COXX_STAS1       -------------------------MNKEQTLAHN-------SSRVTFKELQQIIKMGLV
COXX1_BACCN      -------------------------MGRKKEVTNA----QRQ----RPEILAQTIKTGII
COXX2_LYSSC      --------------------MEQNLNSEQKPQSSA----KPRGKSSRSTILAQTVKTGII
COXX_BACSK       ---------------------MRTEKIDKSIHNAS----LATPKQAFSQVLSETLKTGII
COXX_EXIS2       --------------------MAKVNGETLDIMIEQ-------SDQPTFKDYVTLAKMGIV
COXX_BDEBA       ----------------------------------------------MLRIYADLTKFGIV
COXX_RHOBA       --------------------------------------------------MIELTKPRIV
                                                                             

CYOE_XYLFT       ALIVFTALVGMFLAIPGMPSVVQI------QSGALGFLGIWLAAAAAAAINQLLDAKIDA
CYOE_ALCBS       MLLMVTAVAGMFLATEP-AGMVPL------ATFIPAFVGLSLAMMASAAINQIMDQKIDA
CYOE_METCA       GHIVFTAIIGMFLAVPG---VPPL------DTAFWASLGIGFAAASAAALNHFLDRHADA
CYOE_NITOC       SLIVFTAIVGMFLSVPD---LAPW------RVFLFGTLGIGLGAASAAAINHLIDEKADA
CYOE_ALKEH       VLMVFTAIVGMFLASPG---QVPW------VALTVGSLGIALAAGSAAALNHLADQRIDA
CYOE_COXBU       LLMLLTAIVGMCLASPG---IVSW------RVFLFGNLGIALAASSAAAINHLLEHHLDK
CYOE_LEGPL       LLMLLTVIVGMYLAAPG---WVSL------RLIAFTLLGIGLCAGSAAAINHLVDRHIDS
CYOE_HAHCH       ALMMLTAVVGMLLASDQ---GMPW------NALILGNLGIALLASSAAAINHIVDQKIDA
CYOE_MARHV       ALMILTSVIGMLLAAPG---VPEW------SVLLFGNLGIALLAGAAAVVNHVVDQKIDT
CYOE_PSEU5       LLMLITSLVGMFLATRA---GVPW------TVLLFGNLGIALCAGGAAAVNHVVDRQIDS
CYOE_SACD2       ALMLLTSLIGMLLAVPG---MVPI------DILILGNLGIALCAGSAAAVNHLVDRKVDL
CYOE_SHEON       ALMLLTVLVGMCLAMPT---ILPV------QPLIAGLLGIAMMAGSAAALNHLIDRRIDG
CYOE_SHEAM       TLMLLTVLVGMCLALPG---AVPL------QPLIAGMLGIAMMAGAAAAMNHLIDRRIDG
CYOE_COLP3       ALLVLTALVGMSLSVPG---ALPW------QRLIPAMLGIGLLSSAAAAINHIVDEKIDT
CYOE_IDILO       ALLLLTAVVGMCLATEE---LVSL------KVLVPALTGIGLMSAAAAAINHLVDRHIDA
CYOE2_PSEA6      MLLLLTALVGMCLASET---WISW------KILLAGLTGIGFLSSAAAVINHVVDRKIDA
CYOE_PHOPR       AMLLLTALVGMCLAVPG---IPPA------KAVILGLIGIGFQSAAAAAFNHVLDRRLDT
CYOE1_VIBPA      ALMLVTAIVGMSLAPVT---DFPW------IQASIGLIGIGLMAGSAAAFNHLIDRRIDA
CYOE_VIBVY       ALMLLTSVVGMSLAPHE---HFTW------HQALIALVGIALMAGSAAAFNHLIDRRIDA
CYOE2_PSEHT      AMLVLTAWVGLALAPDV---GRGM------GVQFISLLGIGLLSAAAAVINHVVDSEIDS
CYOE_PSYIN       ALLVLTALVGLALAPDM---GRGY------FVQLLSLFGIGLLSSSAAVINHIVDSKIDA
CYOE_VESOH       ALILFTAVVGMFLAVPA-PYLPNG------LLVLSASIGISMVAASAAVFNHVVDEQIDA
COXX_METPP       QLIVFCAAIGMLLAVPGWPSLPAW------GVALAASIGIWLVASAAAAFNCLVEQTIDS
COXX_LEPCP       QLIVFCAAIGMLLAVPGAPGLADL------GKALWATLGIWLVASAAAAFNCLIEQQIDS
COXX_POLSJ       QLIVFCALIGMVLAVPHVPTWPEV------KLALIACAGIWLVAGAAAAFNCIVEQRIDA
COXX_BORA1       QLAVFCAVIGMFLAVPGLPDLK---------RVLFGTIGIWLLAAAAFAINCLIEQEIDA
COXX_JANMA       QLAVFCAVIGMFLATPELPSWK---------IVVAATIGIWLLAGAAFAINCLVEREIDS
COXX_PARXL       QLAVFCAVIGMFLSTPGMVPWT---------PLIGGTVGIWLLAGAAFAINCLVEQKIDA
COXX_RALSO       QLAVFCAVIGMFLATPGMVPWP---------VLIGGAVGIWLFAGAAFAINCLVERKIDA
COXX_POLAQ       QLAVFCAVIGMFLATPGMVPYP---------VLFGGIAGIWLLAGAAFAVNCLIEQAVDA
COXX_AROAE       TLIVFCAVIGMFLAVPDGLPDP--------KSVVAATLGIAFVAGAAAAMNCLIEAHIDA
COXX_THIDA       SLIVFTAVIGMFLAVP-AWPSW--------TTIWAGTLGIGLVASAAAAFNCLIEQKIDA
COXX_NITEC       SLIVFTAVIGMFLSVPGAVPL---------DKLLLGTIGISLVAGAAAALNCLVEYKFDA
COXX_NITMU       SLIVFTAVIGMFLSVPGVVPL---------DTLIFATVGIAFVAGAAAAVNCLVEQKIDA
COXX1_CHRVO      ALIVFCAVIGMFLASPGVPDAA---------VVVPATLGIALVAGAAAMVNCLVERGVDV
COXX_DECAR       SLIVFTAMIGMCLATPDFPPLL---------RFGVASLGIALVSFAAAALNCLVERTVDA
COXX_ACICJ       YLVVYTGAAGLLVAP----GGINP------ILGFTAILCIAMAAGAAGAINMWYDRDIDA
COXX_GRABC       SLVVFTGLIGMLVAP----GSLHP------VLGAIAILCIAVATGASGAINMWYDRDIDA
COXX_GLUOX       SLVVFTGAAGMAVAP----RWPSI------PIGLITILCICIGAGAAGAINMWYDRDIDA
COXX_GLUDA       SLVVFTGAAGLAMAP----GPINP------LIAAVSILCICMASGAAGAINMWYDRDIDA
COXX_RHIL3       SLVVFTAFAGLVLAP----GHIHP------VLGTIAILCIAVGAGASGALNMWYDADIDA
COXX_AGRFC       SLVVFTAFAGLVLAP----GEINP------ILGLIAILCIAVGAGASGALNMWYDADIDA
COXX_SINMW       SLVVFTAFAGLILAP----GHINP------FIGFTAILCIAIGAGASGALNMWYDADIDA
COXX2_RHILO      SLVVFTAFVGLVAAP----VTINP------LLAVIAILSIAIGAGASGALNMWYDADIDA
COXX_CHESB       SLVVFTAFVGMVLAP----ANPHP------FLALISILAIAVGAGASGALNMWYDADIDA
COXX1_RHILO      ALAVFTAFVGLMVAP----GAVNP------VIAVIAIAAIAIGAGAAGALNMWYDADIDA
COXX_OCHA4       SLVVFTGLVGLVVAP----GHMNP------VLAAISILCVAVGAGASGALNMWYDADIDA
COXX_BART1       SLVVFTALVGLMVSP----VPINP------WYGFLAIICIAVGGGGAGALNMWYDADIDA
COXX_BARBK       SLVVFTALVGLVVSP----VVVDP------LYGFVAILCIAIGGGGAGALNMWYEADIDA
COXX_NITHX       SLVIFTALVGLMIAP----GHVHP------VLGFTAILCIAVGAGASGALNMALEGDIDV
COXX_RHOPB       SLVIFTALVGLLLAP----GYIHP------VLAFTSILCIAVGAGASGALNMWYEDDIDA
COXX_AZOC5       SLVIFTALVGLVRAP----DHVHP------VIAFTAILCIAVGAGAAGALNMWWDADIDA
COXX_BEII9       SLVIFTALAGMLIAP----DPVHP------IVGFASLLAIAVGAGASGALNMWYDADIDA
COXX_METS4       ALVIFTALVGMTVTK----SHVNP------VIAAVSLLMIAVGAGASGCLNMWWDADVDA
COXX_METRJ       VLVIFTALVGMVVSQ----GHVQP------AIGAISLLAIAVGAGASGCLNMWWDADIDA
COXX_PARL1       SLVIFTALVGIAVAP----GGIHP------VIAFTALLCIAVGAGASGALNMWYDADIDA
COXX_DINSH       SLVVFTALVGLLVAP----VSLHP------MVGFCAILFIAVGAGASGALNMWWDADIDV
COXX_RHOS5       SLVVFTALVGLLVAP----ATVHP------MIALTGILFIALGAGASGALNMWWDADIDR
COXX_ROSDO       SLVVFTALVGLQAAP----VSVHP------VIGFASILFVAIGAGASGALNMWWDADIDA
COXX_RUEST       SLVVFTAFVGLMAAP----IGVHP------VIGFCAILFIAIGGGASGALNMWWDADIDQ
COXX_PARDP       SLVVFTAFVGLWIAP----QPVNP------FVAFCAVLFIALGGGASGALNMWYDADIDA
COXX_JANSC       SLVVFTALVGILVAP----GGVSP------MIGFTAILFIALGAGASGALNMWYDADIDA
COXX_CAUSK       SLVVFTALTGLLAAR----TPIHP------LLGAVAVLCIAIGAGASGALNMWYDADIDA
COXX_HYPNA       MLVVFTAVAGLAAASGMTGITMHP------AMAAIAVLAVALGSGAAGAINMWYDADIDA
COXX_MARMM       TLVVFTAFAGLIAAP----VDADP------FLAFMSILCLAVGAGAAGALNMAYDADIDA
COXX_ERYLH       TLVIFTGICGLLAAP----GAINP------ILGFTAILCIAMGAGGSAALNQWWEADIDA
COXX_NOVAD       TLVIFTGLCGLLAAP----GTIHP------VIAFTAILCIAVGAGGAAALNQWWEADIDA
COXX_SPHAL       SLVVFTALCGLLAAP----GDVHP------VLGFSSILAIALGAGASGALNQWYEAGLDA
COXX_SPHWW       TLVVFTGWCGLLAAP----QSIHP------VLGFTAVLCIALGAGAAGALNQWYEADLDA
COXX_NEOSM       SLVTFTAVTGAVLAY-FSGYHAPF------FSVFTAIFCIAVGSGAAGALNMYYDRDIDA
COXX_ANAMM       CLVVFTAITGMLIAP----GTIHP------LIGLVSTVCVALGAGAAGAFNMWYDSDIDA
COXX_ANAPZ       YLVVFTASTGMIMAP----GTIHP------LIGLVSALCIAMGSGAAGALNMWFDSDIDA
COXX_EHRRW       YLVVLTGVTGIIIAP----GNIHP------LIAVISTLCIALGSGAAGAINMWYDSDIDA
COXX_WOLTR       YLVVFTAVAGMVAAP----GSIHP------FLALISLICIALGSGSAGAINMWYDRDIDL
COXX_RICPR       SLVIFTGFVGMWLAP----DSIHP------LIAGIAVICIALGAGSAGAMNMWYDRDIDI
COXX_RICBR       SLVVFTGFSGMWLAP----NSLHP------FISVIALICIAIGAGSAGAINMWYDRDIDA
COXX_ORITB       LLAIFTAITGLFIAP----NKIRP------LLSLIAILCISTGAGAAGAINMWYDADIDR
COXX_PELUB       SLVIFTCAVGLLMAP----STVST------KDAMIAILLVSIGAGAAGALNMWYESDLDA
COXX_LEPIC       SLVLATIIPGLYLASEQSPSGF---------LIAITLFGTFLMSSASFIFNQVIEKDRDA
COXX_LEPBP       VLVLATVLPGMYLGTTGYPSLT---------VISITLFGTYLMSSASFILNQYIERERDA
COXX_PROMT       PLLLATTVGGMALSEEWPLPSP---------RLACTLGGGALAAAAAGALNCLWEQDLDK
COXX_PROMA       PLLLATTLGGMALSEGWPLPSP---------RLACTLGGGALAAAAAGALNCLWEQDLDG
COXX_SYNSC       PLLLATTLGGMALSEGWPLSSP---------RLVCTLGGGALASAAAGVLNCLWEQDLDG
COXX_PROMP       PLLLATTLGGMALTEEWPLSSP---------KLICTLGGGALAAAAAGALNCLWEMDLDK
COXX_SYNR3       PLLLATTLGGMALSESWPLPLP---------RLACTLGGGALAAAAAGVLNCLWEEQLDG
COXX_FRASN       ELLLVSTVPVMLLAERGMPSWW---------LIAVTLLAGTLSAGSANTINCYVDRDIDQ
COXX_ACIC1       ELLLVTTVPTMMLAARGWPSSR---------LVVVTVLAGALAAGSANTLNCFIDRDIDQ
COXX_NOCSJ       ELLLLTTVPVMFFADRGIPELW---------LVVATVVGGAFSAGSASVFNCVYDRDIDE
COXX_CUTAK       ELLLVTTLPVMFLASHGVPKLG---------LVIATMVGGLFAAASANVFNCVIDVDIDQ
COXX_THEFY       ELLLITTIPVMFVAAQGVPPLG---------IAVATLVFGTMSAASANAINCYIDRDIDR
COXX_ARTS2       ELLLVSTLPTMIYAERGFPSFG---------LILATLVGGAFAAGSAGAFNCYIDRDIDK
COXX_RENSM       ELLLVTTLPTMIFAARGLPNIW---------LILATMIGGAFAAGSAGAFNCYIDRDIDK
COXX_CLAMS       ELLLVTTAPVMILAQGGWPNPW---------LILGVLVGGTLSAGSANAFNCYIDRDIDR
COXX_LEIXX       ELLLVTTVPTMILAARGIPNLW---------LVLATVVGGYMSAGSAGAFNCYIDRDIDR
COXX_TROWT       ELLLLTTVPTMILAQRGVPNPL---------SVLSVLLGGAMSAGAAGAFNCYIDRDIDS
COXX_KINRD       ELLLITTIPVMLFAAGGLPSGW---------LILTTFVGGALAAGCANTLNCYFDRDIDA
COXX_STRGG       ELLLITTVPVMFLAAQGVPDLW---------LVLTTTIGGYLSAGGANALNMYIDRDIDA
COXX_CORDI       ELLLVATIPAMLQAERGENNIG---------LILLTLLGGWMGAAAANTFNMVADSDIDQ
COXX_CORJK       ELLLVATIPAMLQAARGEVNFG---------LILLTLIGGWMGAGAANTFNNVVDHDIDQ
COXX_MYCLE       ELLLVTAIPAMLLADRGSANPL---------LILNTLLGGISAAAGANTFNCVADADIDK
COXX_MYCGI       ELLLVTTIPAMLLADRGTVDPL---------LIINTLVGGLLAAAGANTLNCVADADIDK
COXX_NOCFA       ELLLVATIPTMLLADRGHIDIR---------LILATLFGGWMGAASANTLNCVADADIDK
COXX_RHOJR       ELLLVATIPAMLLADRGNVDIA---------LILSTLFGGWMGAASANSLNCVVDADIDK
COXX1_SACEN      ELLLVTTVPAMFLAQRGIPSPW---------LVLVTLAGGAMSAGSANALNCVADSDIDA
COXX2_SACEN      ELLLVTTIPAMLLAARGIPSPW---------LVIATLVGGTMAAGSANALNCVADADIDQ
COXX_SALTO       ELLLVTTVPAMMLAHGGLPSLW---------LMAVVLVGGSLAAGAASVLNCYIDRDIDQ
COXX_SYNY3       PLLLITTAASMWIASEGRVDLP---------KLLITLLGGTLAAASAQTLNCIYDQDIDY
COXX_SYNP2       PLLLITTAASMWIASHGHIDPV---------KLLITLLGGTLAAASAQTLNCIYDQDIDF
COXX_MICAN       PLLLITTAAAMEIASKGQVSPL---------LLFLTLLGGTLAAAAAQTLNCIYDRDIDH
COXX_TRIV2       PLLLITTAGSMWIAAQGQVDPV---------LLLVTMAGGTLAAASAQTINCIYDRDIDY
COXX_TRIEI       LLLLITTAAGMWLGAKGEVSLF---------LLFVTLTGGALASGAANAINCIYDSDIDY
COXX_THEEB       LLFLITTAAAMEVAGQGRVSPQ---------LLLITLGSGTCAAAAANTINCLYDRDIDA
COXX_ACAM1       LLFLITTAAAMWVASSGQVGPR---------LFLTTLLAGACAAGSANTINCIYDRDIDY
COXX_SYNJA       ALLLMTTAGAMWMA--GNTDPF---------KFGVTLLGGGMAAAAANVINMVYDADIDR
COXX_SYNE7       LLLLITTAAGMGLAAQGPLDPR---------LAIATLIGGGLAAAAANTLNCLYDRDIDA
COXX_GLOVI       VLLLITTAGAMWIAGKGHVEPL---------LLLVTLLGGTLAASSANAFNCLIDRDIDL
COXX_DEIRA       SLLLWTTVTAMFMAARGWPGDTFWSG---LWLLIVVSVAGYMSAGSAGVFNMIIDRDIDL
COXX_SYMTH       ILLLITGFAAMWVAAGGPPPLG---------LTVVTMIGLALSCGAANAINMWYDRDIDA
COXX_SULTO       SLLDLAAIAGFVLGLPKAINI--TSI---IVSFLAVIIGGSLASGGGMIINGGLEIEKDK
COXX_SULAC       SLLDVVAIASYILAF--------KGN---WYNLIPVLIGGSIAAGGSMIINGGLEIEKDK
COXX_METS5       WLLDLAALSGAFLSG--------KLM---PLSILAVLVGGTFASAGSMIINEGIEIDKDK
COXX_SACS2       SLLDLAAIAGAFLAYKH------GIS---LLPIIPMLIGGTLASMGAMIINSGIEINRDK
COXX2_PICTO      ILIDIVAIAAFLAVPGS------TNH---IYDLLILIFAGTLASMSASIFNNIYDMDIDP
COXX1_MAGSA      LMIALTAITGYGAVATKV-------D---PVALLLLTLAMILGSAASAVFNHVWDRDIDR
COXX2_MAGSA      VFCALAAIAGALATPGAVP------D---FAPVMAVALAVLLSAAAAGAFNHYWERDIDP
COXX1_CENSY      LLLVITAVTTMYAGDALSAGEP-GPD---LWDYAHLMAAGALASAGSSALNHYYDRDIDP
COXX_THEAC       SLLVFVGAIGAVIAIPYFNL---HY----ISLIVLATIAVMLGSMGAEATTNYIDKDIDA
COXX_THEVO       SLLVFVGVIGAIVAINRFTL---TN----ILLILIATVSITLGSMGAEATTNYIDRDIDA
COXX1_PICTO      WLLVFIGLIGSILAINSFKS---YL----IILLLVALVANMTGSMGAEGLTNYIDRDMDS
COXX2_CENSY      YLLVFTAFGAAVAASGIYGI---EIS---IATWALMLFSVAAGSASANVLTNYHDRDIDA
COXX_DESAP       GLLAFTAAAMMVVAGATHPV---SG-----WLFVQALLAVVLACAGANAVSCYVDRDMDA
COXX_PYRNV       WLLILSSVVGYVYAAG-------TVD---WGRLAALTAAATLAVGGSAAFNHYWERDIDA
COXX_PYRAR       WLLILASLAGYLYSAR-------QPN---IAQAFSLLLVAFLSTGGAAAFNHYWERDIDA
COXX2_PYRAE      WLLILASVAGYIYGGG-------GVD----SRLFSLLAVAFLSTGGSAAFNHYWERDIDA
COXX1_PYRCJ      WLLILASAAGYVYAAG-------GVD---WGKLSSLLLAALLATGGSAAFNHYWERDIDA
COXX2_PYRCJ      WLLVLASVAGYVYAAP-------VVD---WGSLLALVVVGVLSSGGAAAFNHVFERDIDA
COXX_CALMQ       WLLVLSALVGYIAAAGP------LVN---PIKLIELTVVGFLSTGGSAAFNMYYERDIDS
COXX_KORCO       FLLLLTSIFTYVGAGGM------RLD---ALL-LLTAAM-LLSISGTTSVNMALDADIDA
COXX_ARCFU       FLLMITFLVSYIVARGG------ADF---NFV-IAAISM-FLAISGTTAINMWLDRDIDA
COXX_AERPE       ALLMLTMYGAYFAGGGS------LDP---RMLALLTIMG-FTSIGGVTAFNMYFDRDIDA
COXX_HYPBU       LLLLFTMYTAYIVGGGL------GKP---YERHLVVLTLGFITIAAVTALNMYFDRDIDA
COXX_THEPD       ALLLVTGVCAYLEGAGK------PDP---ATLVLASLSM-FLSIAGTTGFNMVLDADIDS
COXX_FLAPJ       ISVVFSSLAGYLLGIHEFNLETIYV-------LLMLAIGGYCMVGASNAYNQIIEKDLDT
COXX_FLAJ1       ISVLFSSIAGYLLGVNDEHPFKWSV-------LIVLAIGGYCMVGASNAYNQVIEKDIDS
COXX_GRAFK       ISVVFSSVAGYFLGADTIDFVT----------VTLLAIGGYLMVGASNAYNQIIERNLDA
COXX_CYTH3       STVAFSSGMGYILAER--GQVDWLN-------LVLFLIGGFSITVSANIINQIIERESDK
COXX_GEOMG       LLNGIAAVAGCLLAPEGAAMSLIVAS----------LAGVTLLAAGGSALNQVMERDLDL
COXX_GEOSL       LLNGIAAVAGHALVPDAAHATLWVA-----------LAGVAILAAGGSALNQVLERDLDR
COXX_DESAG       GMVALSCVFGYLLAAGAAGPDMVTS-----------AAGTFLLTCACSVFNQIQEKDLDA
COXX_DESVV       LMVAGATFFGAMLAVPHVTITHLLA-----------SLATFLLAGGCSAINQVQEADLDA
COXX_SOLUE       WLILMSTGIGYFFGLPQASNWLTFLKNIDLLRLLHTIIGTGLIASGTAALNQWYEREGDL
COXX_KORVE       TLIVMTAWTGAFFGAAKSGLPLV------SWTLFHALLGIGLVSGGTAAMNEVIERESDA
COXX_SALRD       SVVTLSAFAGFLIGSPTGLDGGT---------LLWTMLGTALCAGGVGTLNHVLERRYDA
COXX_OPITP       MLSVMTALVGYLAARPPWDPIQL----------ALLVLGTSAAAGGVAALNQWLEHDTDA
COXX_ANADE       GLVMITCAGGMWLAPGQIGAARAVL----------TVLATAVVVGAANALNCYLERDIDA
COXX_ANADF       GLVIVTSAGGLALAPGHVAPARAAL----------TVLATAAVVGAANALNCWMEREIDA
COXX_MYXXD       SLVLVTAAGGMWLAPGHMGAVNALV----------TLLATAGTVGAANALNCYWERHSDQ
COXX_SORC5       RYLRAGLAGDAAIERAAVPPAQLAL----------ALLGTVLVVSGANALNMYIERDTDL
COXX_GEOUR       ----------MVLAGRGMPGTK---------ECLICLTALLLAAAAAAMINGVLDAKLDA
COXX_AQUAE       SLVLITTLGGMYLGSRGELQPE---------LVFWTLLGTGLAAAGSAVLNMVIDKDIDK
CYOE_ECOLI       FGNLISVIGGFLLASKGS---------IDYPLFIYTLVGVSLVVASGCVFNNYIDRDIDR
CYOE_PHOLL       FGNLISVIGGFLLASKGV---------IDYPLFISTLLGVSLVVASGCVFNNYIDRDIDR
COXX_METFK       FGNLISVAGGFFLASRGD---------IDVALFLATAIGISLVIASGCVLNNYIDRDIDS
CYOE_PSE14       FGNVLSVAGGFFLASKGN---------IDFGVFLAAVIGTSLVVASGCVFNNCIDRDIDQ
CYOE_CHRSD       FGNLISVAGGFFLASQGS---------VDGGLFLATVIGIALVIASGCVFNNYIDRDIDR
CYOE2_SHEWM      MGNLISVTGGFLLAAKGS---------VDLTLMLMTILGLSLVVASGCGLNNCIDRDIDA
CYOE1_PSEA6      MGNLISVAGGFLLASRGE---------VDGLLMLMTVLGLSLVVASGCVLNNCIDTDIDA
CYOE2_SHELP      MGNLIAVVGGFLLAARGE---------VDAVLMLATLVGLSLVVASGCAINNYIDRDIDA
CYOE1_PSEHT      MGNLISVAGGFLLASRGD---------INPWLMVATLIGLSLVVASGCAINNVIDRDIDI
CYOE_MARMS       MGNLISVAGGFFLASRGE---------IDWILMLATVIGLSLVVASGCAINNYIDRDIDA
CYOE2_PSEA7      FGNLIAVAGGYFLAARGS---------VEPMLLLATVIGLSLVVASGCVLNNCIDRDIDR
COXX2_CHRVO      FGNLISAAGGFLLAAQGS---------VDWWLLAATVVGLSLVVASGCAINNCIDQDIDA
CYOE_ACIAD       FGNFITTLGGFFLAAQGH---------VDFLLLILTLLGTTFVVASGCVVNNVIDQDIDQ
CYOE2_VIBPA      FGNLISVAAGFFLAAKSEP--------ASLMLFLTTLAGVGLVIASGCVVNNIFDRDIDQ
COXX_PARUW       LGNLVTVMAGFLLASKGQ---------FQFGLFFSTILGLAFIMASGCVFNNYIDLEKDR
CYOE_BLOFL       LGNIISAISGFLLATHHEH------H-INYIILMYMILGTTLVIASSCVLNNIIDRDIDA
CYOE_BLOPB       LGNLMSSAGGFLIASRGA---------ISYSLFITMIVGTALVIASGCVLNNIIDRDIDA
CYOE_BAUCH       LSNLMSFIGGFLLASKGR---------INYLIFLVTLLGVLFIVTAGCVLNNIIDRDIDR
CYOE_WIGBR       FGNIISTIGGFLLASQGD---------INVNLFIFTISATAILIASASIFNNCIDKDIDI
CYOE_BUCCC       LGNIICLSGGFFLALNEK---------LSKIFFLKTVFGLILIISSSCILNNIIDRDIDK
CYOE_BUCAI       IGNSTLITGGFLFASR-HA------A-FNYVLFIYTILGASLVIASACVFNNLIDIDIDK
CYOE_BUCAP       IGNIILIIGSFLFSS--FP------F-FNVFLFFFTILGTSLVIASSCIFNNLIDIDIDT
CYOE_BUCBP       LGNLLSLYGGYGVAARGH---------IYSKLLFLDSLSLFLIVGSACVLNNVIDCDIDK
CYOE_FRATH       FGNLITLTGGFLLATHREI------GFEYLPLFVYVMIGVALMIAAGCVFNNIYDQDIDS
COXX1_BACVZ      ISNSLAALGGFWIAWIQSERTGGGP--GIFAAMAVAMIGTALVMASSTVFNNFFDRGMDA
COXX1_BACSU      ISNSIAAFGGFWIAFASAEKTLTGL--AFLMTMVTAMLGTAFVMASGTVYNNYFDRHMDA
COXX_BACLD       YSNLITTFTGMWLAFYFSNLSFL----GNLDIVLFTLAGSSLIIAGSCVINNFYDRDIDQ
COXX_BACP2       NSNFITTFTGMWLAFYFTGMSFL----GNLDIVLLTMIGSSLIIAGSCAINNAFDRDIDI
COXX_GEOTN       NSNLITTFAGMWLAFYFTGERFL----ENLHIVFFTLFGAALVIAGSCSINNFIDRDIDQ
COXX2_BACCN      NSNTLTVFTGFWLALHFNGLNAL----EHLDKMFFTIVGSALIMAGSCSLNNYIDRDIDH
COXX_BACPE       TSNLITTFAGIYLAIVYTGTVFT----MHLDTMIFALLGAALVMAGGCTLNNYIDRDIDH
COXX_LISIN       NSNTITAFTGMWLAFQLNGISFI----QNVDVIFFTIVGSALIVAASGAFNNVIDRDIDG
COXX1_LYSSC      NSNLVTTFTGMWLAFQFTSRHFL----QELDVILFTMLGAALIIGGSGAMNNFIDQDIDP
COXX_OCEIH       NSNLITTIAGFLLAISFTSSSFM----SNWGTFLLTIIGTALVIAGGCIVNNWYDVDIDP
COXX_STAS1       QGNLIPAFAGSWLAIVLANHSFL----SSIPQILMMLVGSTLIMGGACALNNYYDQDIDS
COXX1_BACCN      KSNLVPMFAGLTLALYKYKISPF----EKIPEILFAFIGSILIIGAAGAFNNLYDRDIDS
COXX2_LYSSC      KSNLIPMWAGLTLGMYKNKMTFI----DNIPEMIFSTVGSALVIGAAGAFNNVYDRDIDA
COXX_BACSK       KSNLLAMAAGLSLALYVTGIPIG----EKLPEILFAIFGSAFVIGAAGAFNNIYDRDIDA
COXX_EXIS2       RANLITVFAGYVVAASYLTDDVLLYLWQTKLTLLWTLLGSGLVIAGSCYLNNYIDRDIDY
COXX_BDEBA       VFSVLAGLAGYATGFQIENPFDWK-------IFLETLLGIYFLSSGSLALNQVQDWKIDQ
COXX_RHOBA       TMILVTTVASALIAGSATLTLI---------DWFWLMIGTALIAGSAGAANQVWECRIDR
                                                                   .   :   * 

CYOE_XYLFT       QMARTSWRPLVVG--KVRPVQVLVFAGVLITLSM-TILTLWV-------NLITAVLTFTS
CYOE_ALCBS       IMKRTEKRPLVAG--KLTPKAAITFAVLLATASM-IMLYFLV-------NPLTAWLTLFG
CYOE_METCA       EMARTQNRPLPSG--DIRPAQVVGFALVLGIVAM-AILIAFV-------NMLTAFLTFLS
CYOE_NITOC       VMNRTQGRPLPTG--KLSREQALAFAITLGLSSM-IILYFLV-------NPLTAWLTLAS
CYOE_ALKEH       IMARTRRRPLPSG--HLRPLQVLGFSSLLGVAGL-GMLALWI-------NPLTAALTFAS
CYOE_COXBU       LMRRTYRRPIVQG--KINRKNAAIFAAILCILSM-IILIAFV-------NLLTALLTFIT
CYOE_LEGPL       IMARTKKRPVAYG--RVSVKQALWFAVIIGLMGL-SLLILFV-------NQLTALLTFIT
CYOE_HAHCH       VMARTQKRPIVQG--RVDNVHALTFAFSLAVVGM-AILAWGV-------NPLTAWLTLAS
CYOE_MARHV       VMARTRKRPVATG--RIAPLDALLFATVLAALGM-VVLVWQV-------NELTAWLTLAS
CYOE_PSEU5       VMARTHKRPLAEG--RVSPAAALTFAFVLGVSGL-ALLLTFT-------NALAAWLTLAS
CYOE_SACD2       KMARTFNRPIAKG--RIDPTKAILFAAILGLAGM-AILMVWV-------NHLTAWLTLAS
CYOE_SHEON       LMARTYNRPLPKG--RISATRALIFAAALGSLGF-VILYVFT-------NPLTAWLTFAS
CYOE_SHEAM       LMARTYNRPLPKG--KVPVSHAATFAALLALLGF-ACLYWLV-------NPLTAWLTLAS
CYOE_COLP3       VMGRTHNRPLPAG--KISVTNAIVFATSIALLGF-IILYALV-------NPLTAFLTLAG
CYOE_IDILO       KMARTLRRPLPQG--NLSPAKVTTFAASIGVIGF-VTLYAWV-------NPLTAWLTFAS
CYOE2_PSEA6      QMARTSNRPMPKG--KVSPQRALVFAGVLTVVGY-LILELWV-------NRLTALLTLAS
CYOE_PHOPR       QMARTYNRPLAKG--RIETWKAVVFASTLMVMGF-VILLEL--------NALTAWLTMAS
CYOE1_VIBPA      RMARTHTRPLPSG--DTNPLSVAIFAVAIGVVGF-VLLYAWV-------NELTAWMTFLS
CYOE_VIBVY       KMARTYRRPLPKG--DVSPFNVLLFALLIGSLGF-LSLMLWV-------NSLTAYLTFAS
CYOE2_PSEHT      KMARTRHRPVAKG--RLSKAHALSFAAIIGVAGF-IMLMLWA-------NTLTAILTLFA
CYOE_PSYIN       KMVRTKNRPLVRK--AVSRRQALIFSAVIGTLGF-SLLVFAA-------NWLTAQMTLFA
CYOE_VESOH       QMSRTNQRPLPQG--RVSKNQALVWGVFLGFIGL-GILQLFV-------NIITVVLTFIS
COXX_METPP       KMKRTAWRPTAKG--ELSNTQTLSFAVLLCAAGM-AVLWVWV-------NALTMWLTFAT
COXX_LEPCP       RMKRTAWRPTARG--ELSRTQALIFSAVLCSAGM-AVLHEAV-------NPLTAWLTLGT
COXX_POLSJ       RMRRTAWRPTAKG--ELSNPLTLAFSAALCAAGS-VILYVWV-------NPLTMWLTFAT
COXX_BORA1       RMTRTARRGTARG--TISPAQVLSLSGLLGGAGM-LVLYHLV-------NPLTMWLTFAT
COXX_JANMA       RMARTARRPMARG--EITVPQTLVFSGLIGGAGM-WVLYNFV-------NPLTMWLTFAT
COXX_PARXL       KMRRTSWRPSARG--EITTAQILLFSAVLGGLGM-WTLYTFA-------NPLTMWLTLAT
COXX_RALSO       MMRRTAWRPSASG--ELGARQILLFSLVLGGAGM-WTLHVFA-------NDLTMWLTFAT
COXX_POLAQ       KMKRTSWRPSATG--EVTPFHIIIFSIILGSLGM-IILWNFC-------NPLTMWLTLAT
COXX_AROAE       RMARTRHRPLPRG--ELAPAETLLFAGVLGGTGL-TVLYHWV-------NPLTMWLTLAT
COXX_THIDA       VMARTRARPLPRG--ELTGTQTLVFAGVLGGSGL-LLLHTVV-------NPLTMWLTLAT
COXX_NITEC       IMARTKGRPLPQG--KVSVPETLFFLVMVGGLGL-FILHQWI-------NPLTMWLTLGT
COXX_NITMU       VMARTRGRPLPRG--TVTSPETFVFLALVGGAGL-LILHQLV-------NPLTMWLTLGT
COXX1_CHRVO      RMRRTAWRATATG--EVGARETLLVALAVGGMGL-ALLLACC-------NALTAWLTLGT
COXX_DECAR       KMARTSWRATARG--DISPLETVTLATALGAAGL-WLLHGFI-------NDLTMWLTLAT
COXX_ACICJ       VMRRTAGRPIPTG--RISPDGALAYGVALSALSV-LLMWLAT-------NLLAAGLLAAS
COXX_GRABC       VMRRTKNRPIPAG--RIEPGEALGYGIVLAVGSV-LVMWLAT-------NVVAAAVLAFA
COXX_GLUOX       IMKRTVVRPIPDG--RMPEQAALVYGVVLSVLSV-IVLWLAT-------NALAADILAFS
COXX_GLUDA       VMTRTARRPIPDG--RIRDDQALGFGIGLSVASV-LLMWLAA-------NALAAFILAFS
COXX_RHIL3       IMSRTANRPIPAG--RIAPSEALAFGLVLSGFSV-VILGLAV-------NWLSAGILAFT
COXX_AGRFC       VMTRTAKRPIPSG--RIAPREALAFGLTLSAFSV-VILGLAV-------NWFSAGLLAFT
COXX_SINMW       VMSRTAKRPIPAG--KILPQEALAFGLTLSAFSV-IILGLAV-------HWLAAGLLAFT
COXX2_RHILO      VMTRTASRPVPSG--RIQPHEALSFGLVLSVLSV-MTLGVLV-------NWLSATLLAFT
COXX_CHESB       VMARTAGRPVPAG--RIAPGEALGFGLFLSAFSV-GTLGLMA-------NWLAASLLAFT
COXX1_RHILO      LMSRTSKRPVPSG--RVTPGEALGFGLVLSALSV-MTLGVLV-------GWLAASLLAFT
COXX_OCHA4       VMKRTRNRPIPAG--IIAPNQVLAFGLTLSAFSV-VTLGLMV-------NWLSAALLAFT
COXX_BART1       VMERTKKRPIPMG--KISPPKAFIFGMVLSLLSV-LVMGSFI-------NWFAAFFLAFT
COXX_BARBK       LMKRTQKRPIPSG--KISRGKALIFSSILSVLSV-FLMGVLI-------NWFSALFLAFT
COXX_NITHX       LMSRTANRPIPRG--RITRGEAMGFGLTLSFFSV-MTLGALV-------NWYAGGLLAFT
COXX_RHOPB       KMTRTANRPIPRG--RVSKPEALTFGLVLSFFSV-VTLGILV-------NWFAAALLAFT
COXX_AZOC5       VMSRTQRRPIPAG--RVTPREALAFGLTLAAFSV-VVLGLLV-------NVLAGALLAFT
COXX_BEII9       VMKRTAKRPIPLG--RVMPNEALAFGLTLSFLSV-FTLGIVA-------NWLAAGFLAFT
COXX_METS4       VMSRTRTRPIPAG--KIRPDEALAFGMTLSVGSV-LMLGLAA-------NWLAAGLLAFT
COXX_METRJ       VMSRTATRPIPSG--RITSEEALGFGLFLSVASV-VVLGLAA-------NLLAAALLAFT
COXX_PARL1       RMARTANRPIPAG--RVTAREAAVFGSILSVFAV-MTMGVLV-------NWVAAALLAFT
COXX_DINSH       IMKRTAGRPVPAG--KVQPGEALALGLGLSGLSV-VMLALAT-------NLLAAGLLAFT
COXX_RHOS5       VMKRTRNRPVPAG--VVQPGEALGLGLALSGIAV-VMLGLAT-------NLFAAGLLAFT
COXX_ROSDO       VMRRTANRPIPAG--RVQPGEALNLGAALSGLSI-MMLALTA-------NFLAAGLLAFT
COXX_RUEST       VMKRTKGRPIPAG--KVDKGEALSLGLALSGLSV-IMLALAT-------NVFAGAFLAFT
COXX_PARDP       VMRRTAGRPVPSG--RVTSQEALAVGIALSGLSV-MMLGLAA-------NWFAAGFLAFT
COXX_JANSC       VMKRTAKRPVPAG--KVPAGEALTLGLWLSAISV-AMLGLAT-------NWVAAGLLAFT
COXX_CAUSK       KMRRTRGRPVPMG--LVKGEEAATLGVVLSLLSV-MLMGMAI-------NWLAAGLLAFT
COXX_HYPNA       IMSRTSTRPIPSG--AVPKEEALTMGLIMSGVSV-MLMWLAS-------NWLAAALLAFS
COXX_MARMM       TMQRTRKRPIPRG--VVSVSNAYGFGVVASILSV-LLMALAS-------NYLAAGLLAFS
COXX_ERYLH       GMKRTAKRPLPSG--RMQATDARDFGILISVASV-GIMGIAI-------NWLSAIILAAA
COXX_NOVAD       GMKRTAQRPLPAG--RMDRTSARDFGFALAGGSV-FVMGLGV-------GWLAAVILAFS
COXX_SPHAL       RMKRTAGRPLPAG--RLDPQTALQFGIGLAAFSL-FLMLFAS-------NWQATVLLAGS
COXX_SPHWW       MMARTANRPLPAG--RMDRQSALHFGVGLGIFSV-LLMGLAL-------NVLAAAILAVS
COXX_NEOSM       IMSRTSKRPIPQG--KISPEAALVFGLVLFALSV-LLMELAV-------NHLSAVLLSVA
COXX_ANAMM       IMDRTKGRPIPAG--KICREQAWECGMVLATLSV-FVMAIAV-------NYVSALLLAGS
COXX_ANAPZ       VMSRTKTRPIPSG--RISRAQALECGLALSLLSV-FIMSLTV-------NYVSAILLACS
COXX_EHRRW       LMTRTKTRPIPAG--KISRSSALEVGLVLSFISV-TIMMIAV-------NYISGILLAIS
COXX_WOLTR       LMKRTKARPIPSG--RVSAESALEFGVTIGVLSV-FIMAIAV-------NYISAILLAIG
COXX_RICPR       LMKRTQNRPIVRG--VIEPDEALSFGLITGFFAV-FFMALCV-------NILASFLLLFT
COXX_RICBR       LMKRTQKRPIVRG--AIEADEALSFGLIMAFFSV-FFMALCV-------NFLSALLLLFT
COXX_ORITB       IMKRTRNRPTVTG--KISPSTALTFGIILAFFSV-LVMAICV-------NYISSILLLIS
COXX_PELUB       LMTRTCLRPIPMG--KVNKNQALIFGTSLSFFSV-IALDYFA-------NTISAVLLLFT
COXX_LEPIC       KMKRTSNRPIPSG--RISVVQATLVGIAMMGSSFYVLA-VYV-------NLLTALCAFAA
COXX_LEPBP       VMYRTKQRPIPAG--EISPTFALLLGIVVAIVSFGILT-YFI-------NLLTAVCALAA
COXX_PROMT       RMKRTSNRALPSG--RLSQSSVFIGAVACTLVSSALLV-SGV-------NCLAAGLTLLG
COXX_PROMA       RMKRTSSRALPAG--KLSPSAVFTGAISCTLAAAALLV-SGV-------NCLAAGLSLLG
COXX_SYNSC       RMARTSGRALPSG--RLSPTSAFIGAIACTLAAAMLLV-SGV-------NCLAAGLSLLG
COXX_PROMP       RMKRTSDRALPSG--KLSFNTVFLGAVSCTLAAAMLLI-SGV-------NYLAAGLTLLG
COXX_SYNR3       QMQRTSGRALPSG--RLSGSQAFLIAVALACGASLLLV-AGV-------NCLAAGLSLLG
COXX_FRASN       LMGRTKRRPLVRE--VVEPAQALRFGIALGIISTLMFG-LLV-------NWTSAVLSVGA
COXX_ACIC1       VMRRTARRPLVRS--VIRPAEALAFGVALGVVATLLMG-FLV-------NWLSAILADAA
COXX_NOCSJ       QMRRTRRRALPRH--IVSPAAALVFGFVLGILSTVILY-VWV-------NPLSAALSVAA
COXX_CUTAK       KMRRTRRRPLPRH--QVPRRSALIYGIILWIIATIILG-FGA-------NWLSAALALIA
COXX_THEFY       AMRRTRRRPTAME--QVTPRGTMIYGITLAVLSTVGFV-VFV-------NWLAAALSVFA
COXX_ARTS2       LMHRTENRPLVTG--EVTPREALVFSWLLGAAAIAILW-FGA-------NPLSAWLGLGA
COXX_RENSM       IMHRTEDRPLVTG--AVTPREALVFSWALGILSIAILW-FGA-------NPLAGLLGIAA
COXX_CLAMS       VMKRTQRRPLVTG--ELTDREALVFAWIIGVASIIWLG-VIS-------NWLAAALSLAA
COXX_LEIXX       VMRRTKNRPLVTG--ELSDREALVFAWALGVASVLVLG-FFT-------NWLAAGLSVAA
COXX_TROWT       KMSRTRNRPLVTG--ALSPKASLIFAWMLCVISVLWFL-LFV-------NWLSALLSAIA
COXX_KINRD       LMKRTENRPLVTG--EVSPRQALVFATVLGIASTAIFV-AFV-------NVLSAALALGA
COXX_STRGG       LMDRTSQRPLVTG--MVTPRECLAFGIALAVISTVWFG-LLV-------NWLSAALALGA
COXX_CORDI       KMGRTRARPLVRN--KVSNRHASVFAWTLTVVSFLWLWVLCR-------SVLAGLFILLT
COXX_CORJK       LMRRTRRRPTARQ--TVSVGEARVFAWVLLIASVLWLGFLCH-------SWLAAGFIVLT
COXX_MYCLE       LMKRTSRRPLARA--AVPPRNALVLGLALTAGSFFWLW-WTT-------NLLSGLLALAT
COXX_MYCGI       KMKRTERRALARA--TVPRSHALIFGLTLSVASFFWLW-STT-------NMLSAHLAGAT
COXX_NOCFA       VMKRTAKRPLARD--AVPTRNAFVFGVVLGLASFAWLW-WQA-------NLLSGALVVAT
COXX_RHOJR       VMKRTARRPLARD--AVPTSHAFVFGMTLGVASFLWLW-WRA-------NLLAGCLVVLT
COXX1_SACEN      VMDRTKKRPLVSY--EVPRRSALVFGIVLGVVSFAVLA-LGA-------NLLAAVLSLAA
COXX2_SACEN      VMKRTRARPLVRH--TVSNRHALVFGIALGAGSFGWLW-ATT-------NLLSAVLAVAT
COXX_SALTO       VMRRTKRRPLPAH--TVAPRNALIFGLVLATVSVTLLA-VFT-------NALAAGLTLAA
COXX_SYNY3       EMLRTRARPIPAG--KVQPRHALIFALALGVLSF-ALLATFV-------NVLSGCLALSG
COXX_SYNP2       SMQRTRKRPIPSG--RVQPRHALIFALILGSLSF-SLLMVFV-------NLLSACLALSG
COXX_MICAN       TMLRTRARPIPSG--RVQPLHALIFALVLASLSL-ALFVFFV-------NTLSGFLAMTG
COXX_TRIV2       DMERTRHRPMPSG--KVQVRDALIFAIALAVLSF-TLLTVFA-------NLLAASLALSG
COXX_TRIEI       IMERTRWRPIPSG--RVKPRDALIFALTLAATSF-TLLTVFA-------NLLAALLAMSG
COXX_THEEB       VMERTRHRPLPAG--RVAPWEAVFLAVLLAITAF-SLLAAFA-------NLLSACLAMAG
COXX_ACAM1       IMERTRHRPLPSG--RIQVWQASVFAASLALTAF-FLLAFGA-------NLLSACLAMAG
COXX_SYNJA       MMERTRHRPLPSG--RIRARHALRFAGILAVMSF-GLLACFT-------NLLAASLAMAG
COXX_SYNE7       IMERTRWRPLPSG--RIQPFEAWAFALSLAALSF-ILLDWQA-------NQLAAGLALAG
COXX_GLOVI       LMERTRRRAIPAG--RILPWQAALFATALGVASF-AVLAAFA-------NLFAALLAISG
COXX_DEIRA       KMTRTAGRPTSSG--LISSRNAAIFGTTLQVLSF-VMLWVWG-------TPLAAWMSLAG
COXX_SYMTH       VMARTRRRPLPAG--RLTPEQALRFGVITGALSF-LVLLT-V-------NLLTALLATAG
COXX_SULTO       KMKRTSWRPTVKG--EVGRKEAYAIGSI-FIVVGTLIGF-LANPL-------TALFIALG
COXX_SULAC       VMKRTSWRPTVKG--EVGRKEAYMVGGI-ACALGSLIGL-LANPL-------TAFFILLG
COXX_METS5       VMKRTSKRPTVMG--YVSQKEAIYVGIA-LLTLGTLVGL-LDNPL-------TSFFILLG
COXX_SACS2       VMSRTSNRPTVVG--YVSRKEVIVVGSL-LAVLGTALGF-IDNAL-------TAFFIALG
COXX2_PICTO      KMKRTSSRSQILN--ANTRSLFFIIATA-MVLLSFVTSFILLNPV-------TSAFILGG
COXX1_MAGSA      LMRRTSRRPMATG--AGTPALGFALAVV-LMVAGMALANAAFNWV-------VALHLFLG
COXX2_MAGSA      MMNRTRNRPFATG--QFAAGPLWPLGLLALTVAAVALAAFAANAW-------AALHVFLG
COXX1_CENSY      KMRRTARRPIPSG--RIGENIVLAYGLA-ISSAAVVYAYFLLNAP-------TAFFIALG
COXX_THEAC       VMSRTMKRPLVTG--QIKP-INGLLFGLVLMFLSIAILAAFG-------KLYAALFMGIG
COXX_THEVO       IMDRTKKRPLVTG--QIKP-VKGLYFGLILMFLSIIILLFFS-------KYLAAVFMAIG
COXX1_PICTO      IMERTRNRPLPSG--EISE-KGAFLFGIILSLFSIFILLIFK-------RYLAALFMFLG
COXX2_CENSY      IMKRTQKRPLPSG--RVTP-AGARNFGLFLAGASMVMAACIALTTTPVQGAWAAAFIAFG
COXX_DESAP       QMGRTRRRPVPSG--RISPPARALYWGLFLFVASLGLAWNLN--------PIAWITLWGG
COXX_PYRNV       AMARTARRPLPAG--AIPPSNALVYSLALSATGILLGFYLLG--------PLPGVFVALG
COXX_PYRAR       AMRRTAKRPLPAG--LVEPRNALAYSLVLSALGIALGFLLLG--------PLPGLFVFLG
COXX2_PYRAE      LMTRTFKRPLPSG--LITPNAALAYSLALSATGISLGFLLLG--------LLPGLFVLLG
COXX1_PYRCJ      AMRRTSRRPLPMG--LIKPGRALAFSLALSAAGVALGFLLLG--------PLPGAFVALG
COXX2_PYRCJ      LMSRTAARPLPRG--LVSVGAAFAYASAVSALGVLLSLAWLG--------PLPTLFVVLG
COXX_CALMQ       LMVRTMKRPIPSG--KVTPLNALTFSIAVSLSGFTLSYLWLG--------SWVTLMIALG
COXX_KORCO       MMPRTKDRPVPSG--RVSRVE-ALSFGLLLFIVGLGLSYLIN--------PWTAFATSLG
COXX_ARCFU       IMPRTRKRPVPAG--ILKPSE-CAAFGAAIFAIGQVLAFLVS--------LEFGLVVFFG
COXX_AERPE       IMGRTRRRPLPSG--VLNPYE-ALAGSLALVIAGVLSAAAIN--------TYVALTVIAG
COXX_HYPBU       LMERTRDRPLPAG--RLDPLKVFIATVAATIVSVILAWRIIN--------PHFALAIVIG
COXX_THEPD       AMFRTRNRPLPAR--RMSAKDAVLASSAA-LAAGLAAGVAVN--------PYVFVAGLLG
COXX_FLAPJ       LMNRTKNRPIPSG--RMSVNTAFTIATILTITGLTILYM--------INPKTAM-FGAIS
COXX_FLAJ1       LMDRTKNRPVASG--RMSKVTALIVASLLTIIGIVLLYT--------INAKSAM-FAAIS
COXX_GRAFK       LMDRTKNRPLPAG--RMSVPVAFTIASAFTVLGLVVLYV--------INPKTAM-FGAIS
COXX_CYTH3       LMKRTASRPLPEG--IITVQQAIITSALFLIAGTVILAV--------YSTLNALILSLIS
COXX_GEOMG       LMERTRQRPLPTG--ELSPRAATAIGGISIIAGLVVLAG--------TGGIFPPLIGVGA
COXX_GEOSL       LMERTRQRPLPRG--DLSPAMATALGCACIGTGLLVLA---------AGGPVPPLLGAVA
COXX_DESAG       RMPRTRNRPVASG--RLPTTAARAVGMAALLPALILLHA--------AGGVRLVLLSAAV
COXX_DESVV       VIPRTASRPIPCG--RIGHMYGSLMGLALVTVGWMVLCL--------AGGLTSLLVGIGI
COXX_SOLUE       KMHRTAGRPLPSG--RLIAGRALAFGVALSIAGFVELWL--------GVNLLSAGIGAFT
COXX_KORVE       RMRRTAIRPLVTG--SMSLGHGMVVSLVMMIGGAGYLGL--------MTNWLTAALALMT
COXX_SALRD       QMKRTAQRPLPAG--RADPKMARRVGILLVCLAVGLLCP--------LVNVLTAVLAALT
COXX_OPITP       HMKRTADRPIPAG--KVATGSAFVLGVLMCIGSLFLLYA--------LVHPLAALFTLLT
COXX_ANADE       RMRRTRDRPLPAG--RVDPFVALGLGIAAPAFAIPILSL--------AANGLTALLALVA
COXX_ANADF       RMRRTRDRPLPAG--RVDPFTALGLGIMVPVFALPVLAL--------VANPLTAALAFVA
COXX_MYXXD       FMDRTRNRPLPSG--RMEPAVALWFGISLAAVSLPALAL--------GANVLTAALGLVA
COXX_SORC5       LMERTRSRPLPAR--RLSPELALWFGIALSAASIPVLLV--------GVNATTGVLAAAA
COXX_GEOUR       RMARLHRRVASLE--RIGAQRATVAAAGMLFAALALSITFLP--------RLTTALILLA
COXX_AQUAE       LMVRTSERPLPKG--TVDPTKAFIFGITLQVFSLVIMLTFVG--------VLPALLVALA
CYOE_ECOLI       KMERTKNRVLVKG--LISPAVSLVYATLLGIAGFMLLWFGANP--------LACWLGVMG
CYOE_PHOLL       IMERTKNRVLVKG--LIDPKISLIYASILGIAGIVLLYAAANA--------LAMQLAIIG
COXX_METFK       KMERTRNRVLVRG--LIPARNAAIYGYLLGIAGIALLYATTNM--------LTVWLSLFG
CYOE_PSE14       RMERTRNRVLVQG--LVSLKLALLYATILGVAGVALLYTEANP--------LAALFAVIG
CYOE_CHRSD       LMERTQGRVTVQG--LIPPGVTLAYGGVLGVAGFSVLWFGTNA--------LATAFALLG
CYOE2_SHEWM      KMQRTRNRVTVTG--EISVYSVLVFSLALGLIGFGLLAIFTNK--------IALLFAVIG
CYOE1_PSEA6      KMQRTRNRATVTG--DVSIARALQFGLALAVLGFGLLIRYTNS--------IAVGFAVLG
CYOE2_SHELP      KMQRTCRRATVTG--AIPLKQVLGLGIALGVLGFGLLAWFTNL--------AALLFAAFG
CYOE1_PSEHT      AMARTRTRVTVTG--EMSAMAALCHGVVLGIIGFGLLIAYTTP--------AAVFFAAFG
CYOE_MARMS       KMQRTRNRVTVNG--EMSGKAAFFHGIVLGVIGFALLSYFTNW--------VAVAFAAFG
CYOE2_PSEA7      HMERTRGRVTVTG--QISLKAALAHGLVLGVAGFGLLWWRTNP--------LTTALAGFG
COXX2_CHRVO      KMARTQKRVLVTG--AMSTKAALAHGVVLGLAGFALLWFCTNP--------LATGCVLFG
CYOE_ACIAD       KMERTQNRALVKK--TVSPSTALIFAFILGIIGFGILWFWVNP--------YSFSFAIIG
CYOE2_VIBPA      KMARTQNRETVKG--NINIDVAFVYALAMLLLGTALLFQLVNP--------LSAVVVLLG
COXX_PARUW       LMKRTQNRPLVIG--VIFEKQAIVFGLALAIVGAIILYFYTNL--------LTLVIAELG
CYOE_BLOFL       IMDRTKNRVLAKNINSCFVKNSIIYAIILNTLGFLFLGLTKNL--------LTILLTMIG
CYOE_BLOPB       VMERTKHRVLVQH-GQIFLNQSIFYAVILSIFGFLFLSFTKNV--------LTIYLSAIG
CYOE_BAUCH       KMERTKNRPLAIG--SISILTCLIYALICSIIGIYLLYNYTNK--------LTMLLAIIG
CYOE_WIGBR       KMQRTKNRAIAIG--LISSNIAYIYALILLILSFLLF-LKTNF--------LTIFISMLG
CYOE_BUCCC       KMNRTKNRFLCINTNVFLLKILFFFSIILLILGLLVFYIYINF--------LCTIISFFG
CYOE_BUCAI       KMKRTSNRVLSKK--LLPVFSVFNFAIFLGVLGLSILGCLVNF--------ISMSLAVFG
CYOE_BUCAP       KMNRTKNRVLVKN--LISPTSASIFASFIGIVGFFILGLFVNI--------LSMFLSFIG
CYOE_BUCBP       IMLRTQCRLLVKY--NKFCKLAILIAMFMLFLGLILCVKFINV--------VCFCLFLLG
CYOE_FRATH       SMTRTQNRPLVTG--DISVIQATIYGTILLILSCLVLYYLVNL--------LTLWIIIIG
COXX1_BACVZ      KMARTRTRASVTG--KIPPPVMILYGTCLGACGFIML-ASLNV--------LTAVLGLLA
COXX1_BACSU      KMARTRSRASVTG--KMPPAMILTYGSVLGIAGLAML-YSLNP--------LTAFLGLAA
COXX_BACLD       LMQRTRTRPTVTG--KIQPSQALWFGILLTALGFIML-LMTNL--------TAAGVGFVG
COXX_BACP2       LMERTKTRPTVTG--KIQPGQAYAFGILLVVLGLIML-LMTTV--------TSAVIGFIG
COXX_GEOTN       HMERTKTRPTVTG--TMEPRRVLWLGVTLVAIGTMSL-LMTTV--------TAAIVGLIG
COXX2_BACCN      LMERTKNRPTVTG--KYKPGFVLTLGVTLLLLGFVFL-LLTTA--------MAALIGFIG
COXX_BACPE       LMERTKERPTVTG--RFSAKHVLLVGLAQAALGIIFL-ALTTP--------TAAVIGLIG
COXX_LISIN       IMERTKNRPTMTG--KISGKRALMVALVLGVVGTIML-FMTTW--------QAGVLGVIG
COXX1_LYSSC      IMKRTKARPTVTG--RFKPNFVLTIALSFLIVGEILL-FAASF--------AAGMWGLAG
COXX_OCEIH       KMSRTKNRPTVTG--FFSLKSVLTFGLLTTAVGLLLL-MFTSW--------YATLFAFIG
COXX_STAS1       IMPSKQQRPTVNE--RISNRNLLILSFGMMLIGEALL-FALNI--------PSGVIGLLG
COXX1_BACCN      IMERTKNRPTVTG--DISPKTALWLGIFMTIFGLVFL-ALTTY--------LAAILGFIG
COXX2_LYSSC      IMPRTQSRPTVTG--EMSAKSTLSLAIVMLIIGLAVL-ALASP--------LAAAFGLLG
COXX_BACSK       IMDRTKNRPTVTG--RMQPANALVLGISLSLLGLLLL-GVASP--------RAALFGFLG
COXX_EXIS2       KMERTMGRPSVTG--KMDGQRILALGLGILATGTVLL-LIVNH--------VAAVFGLIG
COXX_BDEBA       KMPRTAKRPIPSG--KIKPAAAGILSVGLLLVGMNMLFKLEP---------VAGWVGLFC
COXX_RHOBA       NMPRTANRPVPGG--RMSYAVAVALTASSGIAGSIILWLGNG--------LVPACVGIAT
                  :     *                                                    

CYOE_XYLFT       LIGYAVIYTVYLKRMTSQNIVIGGLAGAMPPMLGWAAVTGLSTAADWI------NASLLV
CYOE_ALCBS       FVGYAFIYTLYLKRATPQNIVIGGIAGAIPPLLGWTAVTGEAHPYAW----------LLV
CYOE_METCA       LIGYAVIYTVYLKRATPQNIVIGGAAGAAPPVLGWCAVTGSVHPYAL----------LLF
CYOE_NITOC       MIGYGIIYTAFLKPATPQNIVLGGASGAMPPVLGWAAVTGELHVHAF----------LLF
CYOE_ALKEH       LIGYALVYTLYLKRATPQNIVIGGAAGAAPPLLGWTAVTGSVDAHAL----------LLF
CYOE_COXBU       LIGYAGFYTLYLKHATPQNIVIGGLAGAAPPLLGWVAVTGHIDPPAL----------ILL
CYOE_LEGPL       LIGYAGVYTGYLKRATSQNIVIGGLAGAAPPLLGWTAVTDQLDPQAL----------LLV
CYOE_HAHCH       LIGYAVVYTLFLKRATPQNIVLGGLAGAAPPLLGWTSVTGTVDPHAL----------LLV
CYOE_MARHV       LVGYAGVYTLFLKRATPQNIVIGGLAGAMPPLLGWTAVTGQVEGHAL----------LLV
CYOE_PSEU5       LIGYAVIYTGFLKRATPQNIVIGGLAGAAPPLLGWVAVTGQVTAEPL----------LLV
CYOE_SACD2       LVGYAFIYTFWLKRATPQNIVIGGLAGAAPPLLGWVAVTGEVHGHAL----------LLV
CYOE_SHEON       LIGYALIYTAYLKRATPQNIVIGGLAGAMPPLLGWTAVTNQFHGHAL----------LLV
CYOE_SHEAM       LLGYAVVYTAYLKRATPQNIVIGGLAGAMPPLLGWTAVTNDFHGHGL----------LLV
CYOE_COLP3       LVGYSFVYTMYLKRATPQNITIGGLAGAIPPLLGWTAMTNEVVPNAL----------LLV
CYOE_IDILO       MVGYAVVYTMFLKRATPQNIVIGGLAGAAPPLLGWTSVTNEINAPAV----------LLV
CYOE2_PSEA6      LVGYAFIYTMYLKRATPQNIVIGGLAGAAPPLLGWTAVTNDIHAHAL----------LLV
CYOE_PHOPR       LVGYAVVYTVWLKHATPQNIVIGGIAGAAPPLLGWTAVTGQLDPHAL----------LLV
CYOE1_VIBPA      LLGYAVVYTMYLKRATPQNIVIAGIAGAMPPLLGWTAVTGELHGNAW----------LLV
CYOE_VIBVY       LLGYAVVYTLYLKRATPQNIVIAGIAGAMPPLLGWTSITGELHPHAW----------LLV
CYOE2_PSEHT      LVGYAFVYTSFLKRATPQNIVIGGLAGAMPPLLGWVSETGQMAAAPW----------LLV
CYOE_PSYIN       LVGYAFVYTMFLKRATPQNIVIGGLAGAMPPLLGWISETGQLAAQPW----------ILV
CYOE_VESOH       LIGYTIVYTLYLKRATPQNIVIGGAAGATPPVLGWTAVSGTQGIEYA---------CLLF
COXX_METPP       FVGYAVIYTVLLKPATPQNIVIGGASGAMPPVLGWAAMRGELGAEPW----------ILC
COXX_LEPCP       FVGYAVIYTVVLKPLTPQNIVIGGISGAMPPLLGWAAMTGEVGPEGL----------ILC
COXX_POLSJ       FVGYAVVYTVILKPLTPQNIVIGGASGAMPPVLGWAAMTGTVGPEAL----------ILF
COXX_BORA1       FVGYAVIYTVILKPRTPQNIVIGGLSGAMPPALGWASVANAVPAEAW----------VLV
COXX_JANMA       FVGYAVIYTIILKPATPQNIVIGGLSGAMPPALGWAAVANDLPMQAW----------ILV
COXX_PARXL       FVGYAVIYTLLLKPATPQNIVIGGASGAMPPALGWAAVTGHVPGDAW----------ILV
COXX_RALSO       FIGYAIIYTLLLKPATPQNIVIGGLSGAMPPALGWAAVANSVPAEAW----------ILV
COXX_POLAQ       FVGYAVIYTWLLKPATPQNIVIGGLSGAMPPALGWAAVTNGLSAEAW----------LLV
COXX_AROAE       FVGYAVVYTVLLKPRTPQNIVIGGASGAMPPVLGWAAVTGEVSADAL----------LLF
COXX_THIDA       FVGYAVIYTVLLKPATPQNIVIGGASGAMPPVLGWAAATGEIHHDAL----------LLF
COXX_NITEC       FVGYAIIYTVILKPLTPQNIVIGGASGAMPPVLGWAAITGEISADAL----------LLF
COXX_NITMU       FVGYAIIYTVILKPMTPQNIVIGGASGAMPPVLGWAAVTGEVSADAL----------LLF
COXX1_CHRVO      FVGYAIVYTLLLKPNTPQNIVIGGASGAMPPVLGWTAVNGQIDAFAL----------ALF
COXX_DECAR       FVGYTVIYTLILKPATPMNIVIGGASGAMPPLLGWTAMTGQVSAEPL----------VLF
COXX_ACICJ       IGFYVFIYTMWLKRRTPQNIVIGGAAGAFPPVIGWAAATGHVGLLPV----------LLF
COXX_GRABC       IFFYSVIYTMWLKRSTPQNIVIGGAAGAFPPVIGWAAVTGTIDLMPV----------MMF
COXX_GLUOX       IFFYSVIYTMWLKRSTPQNIVIGGAAGAFPPMIGWAATMNSMAVLPV----------AMF
COXX_GLUDA       IFFYAVIYTMWLKRSTPQNIVIGGAAGAFPPMIGWAATTGSLGVLPV----------VMF
COXX_RHIL3       IFFYAVVYTMWLKRSTPQNIVIGGAAGAFPPMIGWACVTNSVTIEST----------VLF
COXX_AGRFC       IFFYAVVYTMWLKRSTPQNIVIGGAAGAFPPMLGWACVTGGVSLDSV----------ILF
COXX_SINMW       IFFYVAVYTMWLKRSTPQNIVIGGAAGAFPPMIGWACVTGGISVESI----------VLF
COXX2_RHILO      IFFYAVVYTMWLKRWTPQNIVIGGAAGAIPPVIGWAAVTGSVSLESI----------VLF
COXX_CHESB       IFFYVVIYTMWLKRSTAQNIVIGGAAGALPPVVGWAAMTGSVSLESL----------VLF
COXX1_RHILO      IFFYIVIYTMWLKRSTPQNIVIGGAAGALPPVIGWAAATGAVGVESL----------VLF
COXX_OCHA4       IFFYAVVYTMWLKRSTPQNIVIGGAAGAFPPMIGWAAATGEITWDSV----------VLF
COXX_BART1       IFFYVVIYTIWLKRITPQNIVIGGASGAFPPMIGWAVTTGAVSLDSF----------LLF
COXX_BARBK       IFFYIVIYTIWLKRITPQNIVIGGAAGAFPPMIGWAAATGTISLDSF----------LLF
COXX_NITHX       IFFYVVIYTMGLKRRTAQNIVIGGAAGALPPVVAWAAATGSLSVEPL----------LLF
COXX_RHOPB       IFFYVVIYTIWLKRWTAQNIVIGGAAGALPPVVAWAAAAGSLSVEPM----------LLF
COXX_AZOC5       IFFYVVVYTMWLKRSTPQNIVIGGLSGALPPMVAWAAASGSISLESV----------ILV
COXX_BEII9       IFFYVVIYTMWLKRSTPQNIVIGGAAGAFPPMVGYAAATGHFSLSSF----------ILF
COXX_METS4       IAFYAVIYSMWLKRATAQNIVIGGAAGALPPMIGQAVVTGTVGIEGL----------VLF
COXX_METRJ       IVFYAVVYSMWLKRATAQNIVIGGAAGALPPVIGQAVVTGSIGIESL----------ILF
COXX_PARL1       IFFYLVVYTMWLKRRTPQNIVIGGAAGAFPPMIGWAAVTGSVSIEPF----------VLF
COXX_DINSH       IFFYAVVYSMWLKRSTPQNIVIGGAAGAFPPMIGWVAATGSVSLEAV----------LMF
COXX_RHOS5       IFFYAVVYSMWLKRTTPQNIVIGGAAGAFPPMIGWAVATGGVSLESL----------FMF
COXX_ROSDO       IFFYAVIYSMWLKRWTPQNIVIGGAAGAFPPVIGWVIATGSLSIEAW----------LMF
COXX_RUEST       IFFYVVIYTMWLKRATPQNIVIGGAAGAFPPVIGWIAATGSMSVEPW----------LMF
COXX_PARDP       IFFYAVVYTIWLKRSTPQNIVIGGAAGAFPPMIGWACATGGIGIESL----------LMF
COXX_JANSC       IFFYAVVYSMWLKRATPWNIVIGGAAGSFPPMIGWAAVTGDVSLASV----------LMF
COXX_CAUSK       IVFYAVVYTMWLKRWTAQNIVIGGLAGALPPAIGWAAATGHAPLNAW----------LMV
COXX_HYPNA       IFYYGVIYTMWLKRATPQNIVIGGGAGAFPPVIGWAAVTGNTPLDAW----------ILF
COXX_MARMM       IFFYAVIYTMILKRSTPQNIVIGGAAGAFPPMIGWVAATGEISLDAV----------ILF
COXX_ERYLH       IVYYAVIYTIWLKPRTPQNIVIGGGAGAFPPMIGWVAVTGEITLMPV----------LLF
COXX_NOVAD       IFYYSWIYTVWLKPRTPQNIVIGGGAGAFPPMIGWVAVTGDITLMPV----------LLF
COXX_SPHAL       ILFYVVIYTMWLKPRTPQNIVIGGAAGAFPPLIGWVAATGSIAPLPV----------LLF
COXX_SPHWW       ILFYVVVYTIWLKRRTPQNIVIGGAAGAFPALIGWAAATGRVETLPV----------LLF
COXX_NEOSM       VFYYSVIYTVYLKRRTPQNIVVGGGAGAFPPMIGWAAVANHIGVESL----------VLF
COXX_ANAMM       IFSYAVVYTMLLKRRTPQNIVIGGIAGAFPPVIGWASVSGTLSLESL----------SLF
COXX_ANAPZ       IAFYAVVYTMVLKRRTPQNIVIGGIAGAFPPVIGWTSVTGIPSIESL----------LLF
COXX_EHRRW       IGFYIYVYTMYLKRRTPQNIVIGGAAGALPPIIGWTSVTGSISIESL----------VLF
COXX_WOLTR       ILFYIFIYTIWLKRRTPQNIVIGGASGAFPPVIGWAVVTDSVSWRGF----------VLF
COXX_RICPR       IFYYICIYTIWLKRRSIQNIVIGGVSGALPPVIGHAAVSNTISLESI----------ILF
COXX_RICBR       IFYYICIYTMWLKRSSIQNIVIGGAAGALPPVIGYASVSGSVSLDSV----------ILF
COXX_ORITB       ISFYIIVYTMWLKRRTAQNIVIGGAAGALPPVIGYSAVTNSIDTTCL----------MLF
COXX_PELUB       ILFYVFVYTIWLKRKTPQNIVIGGAAGALPPVIGWTIATNSLSLEPI----------TFF
COXX_LEPIC       LISYVFLYTIFLKPRTTQNIVIGGVAGCVGPLIGYAAIGNSLP----------VQAWSLF
COXX_LEPBP       LLLYVFLYTIWLKPRTEQNIVIGGISGCIGPLIGYAAMANALP----------MQAWVMF
COXX_PROMT       LCSYVLLYTAFLKPRTSQNIVFGGVAGAIPPLVGASAAAGHIG----------LGGWWLF
COXX_PROMA       LCSYVLLYTAFLKPRTSQNIVIGGVAGAIPPLVGAAAATGHIG----------LSGWWLF
COXX_SYNSC       LCSYVLLYTALLKPRTSQNIVIGGVAGAIPPLVGAAAATGHVG----------LGGWWLF
COXX_PROMP       LCSYVILYTIILKPRTTQNIVFGGVAGAIPPLVGASAATGHVG----------LSGWWLF
COXX_SYNR3       LCSYVLLYTIVLKPRTTRNIVIGGVAGAIPPLVGAAAATGHVG----------LGGWWLF
COXX_FRASN       IAFYVFVYTLGLKRRSPSNIVIGGAAGCFPVLIGWSAVTGTVG----------WPAVLLF
COXX_ACIC1       IVFYVGVYTIGLKRRTPSNIVIGGAAGCFPVLIGWSAVTGRVG----------WPAVVLF
COXX_NOCSJ       NAFYVLVYTMLLKRRTTQNIVWGGLAGCFPALIGWTAVTGSLS----------WVPVVLF
COXX_CUTAK       NLFYVFVYSMLLKRRTWQNTIWGGIAGCFPPLIGWTAVTGSVG----------WEPLVLF
COXX_THEFY       IAFYIFVYTLLLKRRTAQNVVWGGIAGCMPVLIGWAAITERLD----------WAPFILF
COXX_ARTS2       IVFYVVIYTMILKRRTAQNIVWGGAAGCFPVLIAWAAVTDTVE----------WPAIVLF
COXX_RENSM       IFFYVVVYTLILKRRTAQNIVWGGVAGCMPVLIAWAAVTNKVE----------WPAIILF
COXX_CLAMS       ILFYVFVYTLWLKRRTPQNIVWGGAAGCMPVLIGWAAVTGDIS----------WAPVILF
COXX_LEIXX       ILIYVVFYTLILKRRTTQNIVWGGVAGCMPVLIGWAVVTNSVG----------WAPVILF
COXX_TROWT       VFLYAFFYSIVLKKRTPQNIVWGGLAGCMPVLIAWAAVTGSID----------WPAIVLF
COXX_KINRD       ILLYVVGYTLLLKRRTSQNIVWGGVAGCMQVLIGWTAVRDSLD----------WAPFVLF
COXX_STRGG       LLFYVVVYTMLLKRRTSQNIVWGGIAGCMPVLIGWSAVTNELS----------WAAVILF
COXX_CORDI       IFFYIFVYTKYLKRKTHLNIVWGGAAGCMPVVVGWAVITDNLPAGTPA---QWWQAIVLF
COXX_CORJK       NWFYVFVYTKWLKRRTWQNVIWGGAAGCMPVIVGWAVITDNNGGAFHAGWSSWLQAIILF
COXX_MYCLE       VAFYVFVYTLLLKRRTSQNVVWGGAAGCMPVMIGWSAITDTIG----------WPALAMF
COXX_MYCGI       IAFYVLVYTLLLKRRTSQNVVWGGAAGCMPVMIGWSAVTGTIQ----------WPALVMF
COXX_NOCFA       ILFYVFVYTLGLKRRTSQNVVWGGAAGCMPALVGWSAVTGTIG----------WPALALF
COXX_RHOJR       IAFYVLVYTMVLKRRTWQNVVWGGAAGCMPVMVGWSAVTGSLS----------WQPIVLF
COXX1_SACEN      ILFYVFVYTLVLKRRTSQNIVWGGAAGCMPVVIGWAAVTGSVE----------WPALVMF
COXX2_SACEN      ILFYVFVYTLVLKRRTAQNIVWGGAAGCMPVVIGWAGVTGRVD----------WPALVMF
COXX_SALTO       ILYYDLVYTAWLKRTTTANTFWGGACGAAPVLIGWAAVTGSLA----------PAAWALF
COXX_SYNY3       IVFYMLVYTHWLKRHTAQNIVIGGAAGSIPPLVGWAAVTGDLS----------WTPWVLF
COXX_SYNP2       IVFYMLVYTHWLKRHHVQNIVIGGAAGSIPPLVGWAAVTGQLD----------WSAWILF
COXX_MICAN       IAFYMLIYTHLLKRHSIQNIVIGGAAGSIPPLVGWAAVTGDLG----------WIPWILF
COXX_TRIV2       IIFYVLIYTHWLKRHSTQNIVIGGAAGAIPALVGWAAVTGTLS----------WSAWLIF
COXX_TRIEI       IVFYVGVYTHWLKRHSVQNIVIGGAAGAIPPLVGWAAVTGELS----------WAAWLLF
COXX_THEEB       IAVYVGVYTHWLKRSSPQNIVIGGAAGAIPPLVGWAAVTGELS----------WAAWVLF
COXX_ACAM1       IAVYIGVYTYWLKRSSTQNIVIGGAAGAIPPLVGWAAVTGELS----------WAAWVLF
COXX_SYNJA       ILVYVGVYTHWLKRSSPQNIVIGGAAGAIPPLVGWAAATGELS----------WAAWVMF
COXX_SYNE7       IVFYVVIYTHGLKRHSSQNIVIGGAAGAIPPLVGWAAVTGELA----------WPAWILF
COXX_GLOVI       IGFYVVIYTLWLKRTTTQNIVIGGAAGAIPPLVGWAAVTGDLG----------WSAWVLF
COXX_DEIRA       FVFYVVIYTQWLKRTTWHNIVIGGAAGCFPPLVGWAAVTGDLN----------LFAGYLF
COXX_SYMTH       LLFYVLVYTMWLKRSTVHNIVIGGAAGAAPPLVGWAAVTGRLD----------WAAVIMF
COXX_SULTO       AFIYVVIYSIWLKPRTWWNIVIGGFAGSAAAWAGFAASSGS-FTLLS---------FLLG
COXX_SULAC       SLVYVFVYSYYLKPRTWLNIVIGGFAGSAAAWAGYAAASNS-FNLES---------LLLG
COXX_METS5       GLVYVLVYTVWLKPRSPLNIVIGGLAGSAAAWAGYASTTSS-FTIPS---------ILLG
COXX_SACS2       VIIYVFVYTILLKPRTWLNIVIGGFAGSAAAWAGYTSLTNS-LTLEA---------FLLG
COXX2_PICTO      FASYVLLYTIILKRRTSLNIVIGGIAGSFPALAGWASITGS-VSATS---------LFIA
COXX1_MAGSA      GFVYVAIYTVWLKRRHWTNIIIGGAAGSFAVLAGAAAVDQT-QWLLP---------MVLA
COXX2_MAGSA      AFVYGIVYTVWLKRRTAWNIVIGGLSGSFAVLAGAAVAVPT-LSPES---------LILA
COXX1_CENSY      IFSYVIIYTAWLKRTNRSNIVIGGIAGSAASWAGWTAATGT-LDLLG---------FLIG
COXX_THEAC       LFDNVFIYSYLTKRRTPWNIILGGFSGGFPVVIGWYTVTSK-FSILP---------WFLF
COXX_THEVO       LFDNVFIYSYLTKRRTPWNIILGGFSGGFPVVIGWYTVTNA-FSVLP---------WFLF
COXX1_PICTO      LFDNVFIYSYLLKRRTPYSIILGGFSGAFPVLIGWYTVTDR-FSWIP---------FILF
COXX2_CENSY      LFNNVLVYSYMLKRRSRSNIVLGGLCGGMPPMIGWVAVTTADLWTMG---------LVMG
COXX_DESAP       MLGYVVVYSLWLKRRSVWNIVIGGVSGGMPALFGWAAVTGE-ISLLP---------VLIA
COXX_PYRNV       WFFYAVVYTVWLKRRTWLNILGGGFAGNATFLGGYALGKGT-VDLPA---------VLIS
COXX_PYRAR       WFFYAVVYTVILKKRTWLNILGGGFAGNATFLGGYALGAGT-VDLHA---------VLIS
COXX2_PYRAE      WLFYAVVYTIVLKRRTWLNIFGGGFAGNAVFLGGYALAKGT-VDLPA---------VLIS
COXX1_PYRCJ      WFFYAVVYTMWLKRRSWLNVLAGGFAGNAVFLGGYALGKGH-IDLAA---------VLMS
COXX2_PYRCJ      WFSYVVVYTVWLKRRSWLNVLAGGFAGNASFLTGYVFGRGT-LDWPG---------VLMS
COXX_CALMQ       WFFYAVLYTIMLKRRTWLNIVIGGFAGNAALLSGWIMAK-P-IDLES---------ILLS
COXX_KORCO       MAFDILVYTMWTKRRTPLSIIFGGVAGAAPSLAGWAAARGS-IELQA---------IMIA
COXX_ARCFU       LFFDIVVYTILLKRKSPYSIVLGGFAGAMPALGGWVAVQG--FTLPG---------FIIA
COXX_AERPE       LYFDIIAYTQLTKRFTPLSIIFGSIAGSMPALGGWAAAAGS-ITTGG---------VLMA
COXX_HYPBU       FLFDIVAYTYLLKRRTPLSIIAGAVAGGAPALGGWAAAAGR-IDVNA---------LLFS
COXX_THEPD       FLIDIAVYTVLLKRKSPWSVVFGGFAGGMPALGGWAAATGG-FGYQG---------VLLM
COXX_FLAPJ       IFLYTCVYTPLKTV-TSLSVFVGAFPGAIPFMLGWVAATND-FGIEA---------GTLF
COXX_FLAJ1       IFLYTSIYTPLKTV-TSLSVFVGAFPGAIPFMLGWVAATGE-FGIEA---------GTLF
COXX_GRAFK       IFLYVSIYTPLKTK-TPLSVFVGAFPGAIPFMLGWVAASGS-FSIEP---------GTLF
COXX_CYTH3       LVIYSFIYTPLKTV-SPIAVFIGAFPGAFPPMIGWIAVTGE-YGWEP---------GVLF
COXX_GEOMG       LAWYLGIYTPLKRR-TSCSLLAGAVSGAVPPLVGWTITGGSLVDFRI---------VLVA
COXX_GEOSL       LAWYLAVYTPLKRR-TSLALAIGAVSGALPPVIGWTLAGGAPGDYRI---------ILLA
COXX_DESAG       LALYNGVYTPMKKY-TAFSLLAGAVPGALPPVFGWLAAGGNLYSPEI---------ALLF
COXX_DESVV       VAVYNGLYTPLKRR-TSFALLVGAAAGAMPPVVGWLAVGGHPASPML---------VVVY
COXX_SOLUE       LASYLFLYTPMKRR-TWWSTTVGAIPGAMPPVIGFAAAAGG-LTRES---------WVLF
COXX_KORVE       SVVYLMAYTPLKKI-HPICTTIGAFPGAMPPVLGWTAIRGH-LGWEA---------VALF
COXX_SALRD       AVLYLFVYTPLKRT-TKWNTLVGTVPGALPALGGYTAATGH-LGAGG---------WATF
COXX_OPITP       IFSYLGWYTPAKRW-SRWSTEIGAVAGAFPPLIGWSAGEGR-VTALG---------WVLF
COXX_ANADE       LLTYVLVYTPMKQR-SATALFVGAVPGAIPPLMGWTSVTGG-VDAGG---------LALF
COXX_ANADF       LVTYVAVYTPMKQR-STLALLVGAVPGAIPPLMGWTAATGR-LDAGG---------LALF
COXX_MYXXD       LLSYVLAYTPLKAR-TSAAMLVGGVPGALPPLMGWTAVTNQ-MDVGG---------FSLF
COXX_SORC5       LLSYVLVYTPLKRR-TTLSLPIGAIPGAIPPLLGWTSVTGQ-IDAPG---------FLLF
COXX_GEOUR       IFSYTPLYTLWFKRRSPWGVVPGGIPGALPVLVGASAVSGTISSAPL----------ILF
COXX_AQUAE       SFSYVILYSLLLKRKSPVATEIGGISGALPPVIGYVAASGSVDINAI----------ALF
CYOE_ECOLI       FVVYVGVYSLYMKRHSVYGTLIGSLSGAAPPVIGYCAVTGEF-DSGAA---------ILL
CYOE_PHOLL       FVVYVGVYSLYMKRKSVYGTLIGSLSGAAPPVIGYCAVTGQF-DTGAL---------ILL
COXX_METFK       FAIYVGAYSLYLKRNSVYGTLIGSLSGAAPPVIGYCAVSNEF-DMGAV---------ILL
CYOE_PSE14       FVIYVGLYSLYLKRRSVHGTLVGSLSGAMPPVIGYCAVTNSF-DFAAL---------TLL
CYOE_CHRSD       FVVYVGLYSLYLKRHSIYGTLVGSLSGAAPPVVGYCAVSGQF-DLGAL---------TLL
CYOE2_SHEWM      YLVYVGIYSLYMKRHSVYGTLIGSFSGAVPPVVGYCAVTGEI-DTGAV---------ILL
CYOE1_PSEA6      YAVYVGVYSLYMKRKSVYGTLVGSLSGAVPPVVGYCAASGQF-DAGAA---------ILL
CYOE2_SHELP      YLVYVGLYSLYMKRNSVYGTLVGSLSGAVPPVVGYCAVTGRM-DGAAL---------ILL
CYOE1_PSEHT      YFIYVGVYSLYMKRNSVYGTFIGSLSGAVPPVVGYCAVSGEF-DMGAL---------ILL
CYOE_MARMS       YVVYVGLYTMYFKRKSVYGTFVGSLSGAVPPVVGYCAAAGQF-DAGAA---------ILL
CYOE2_PSEA7      YFVYVGLYSLWFKRRSQYGTLVGSLSGAMPPVVGYCAVTGQF-DAGAA---------SLL
COXX2_CHRVO      FVIYVGVYSLYMKRNSVYGTLVGSLSGAVPPVAGYCAVTGRF-DMGAA---------ILL
CYOE_ACIAD       FVVYVGFYSLWTKRTSIHQTIIGSISGASPPVIGYTAVTHQF-DVAAL---------LIF
CYOE2_VIBPA      YVYYVFFYTMWYKRNSVYGTLVGSISGAVPPLVGYLAVTNFI-SLEAI---------LLF
COXX_PARUW       FIIYVFFYSIWKSR-TVYGTAIGSLAGAVPPLVGYCAVSNQL-DLGAF---------ILF
CYOE_BLOFL       FLVYIGIYSLWMKRKSIYSTIIGSISGSMPPIIGYCTVSHTL-DTGAW---------LLF
CYOE_BLOPB       LFIYVGVYSLWMKRRSIYSIMVGSISGAMPPVIGYCAAANQF-DAGAL---------MLL
CYOE_BAUCH       LIVYVGIYTKCMKRQSIYSTIIGSFSGAIPPVIGYCAVSNQF-DTGAL---------LLL
CYOE_WIGBR       FFIYVFIYSLLMKRKSVYSTIIGSLSGATPPIIGYCSVKEHF-DIGAF---------ILL
CYOE_BUCCC       FFFYVYLYSYLFKRKTYFSTFVGSVSGSLPPIIGYVAVNNCL-NRCCT---------ILF
CYOE_BUCAI       FFIYVVLYTMFYKRRSFYSTFIGSFSGSTPSVIGYTAVSNTI-DICSI---------LLF
CYOE_BUCAP       FVIYVFFYTFFLKRKSMYSTFIGSFSGSIPSVIGHTAISNSI-DLFCF---------LLF
CYOE_BUCBP       WLTYIFLYSFFLKKTSAISTIVGSISGSLPPIVGYCSVTNNF-DFCSL---------NLL
CYOE_FRATH       FIVYVGIYTV-SKRLTIHATVLGGISGAIPPVAGYTAVVNIL-DYNAL---------ALF
COXX1_BACVZ      FLLYAVVYTLWFKRHSVLSTFVGSFPGAAPPLIGYCALTGYI-DMPAI---------LLY
COXX1_BACSU      FIFYAIIYTVWVKRTSVWSTFVGSFPGAAPPLMGYCAVTGDF-SMTAV---------LLY
COXX_BACLD       VFTYVFLYTMWSKRRYTVNTIIGSVSGAVPPLIGWTAVQGSI-GVEAW---------VLF
COXX_BACP2       VFTYAVLYTMWSKRHYTINTVIGSVSGAVPPLIGWTAVTGTI-DTTAW---------VLF
COXX_GEOTN       VVTYVFLYTLWTKRNYTLNTVVGSISGAVPPVIGWTAVDSDF-HIVPL---------ILF
COXX2_BACCN      AFTYVVLYSLWTKRAYTLNTVVGSVSGAVPPLIGWAAIHPSLDHPIAW---------MLF
COXX_BACPE       LFIYVVLYTMWTKRTTTLNTIVGSFSGAVPPLIGWAAIDGGL-HLYAW---------LLF
COXX_LISIN       VFLYVVVYSLYAKRKLVSNTVIGSFSGAVPPLIGWFAVEPSF-SIVPI---------MLF
COXX1_LYSSC      IFAYVVLYSMWSKRKHVSNTVVGSISGAIPPIIGFAAVEPAL-GPGAL---------ALF
COXX_OCEIH       WFGYVVLYTIWSKRRYTLNTVIGSLSGAMPPLIGWAAISPSF-HIVPF---------VMF
COXX_STAS1       IVGYVSFYSIWSKRHTVWNTVIGSFPGAVPPLIGWTAIEGNI-SLVAV---------ALF
COXX1_BACCN      LFLYVVPYTMWSKRRTIYNTEIGSVSGAMPPLIGWAAIYPDVTHPAII---------GLF
COXX2_LYSSC      VFLYVVPYTMWTKRRTIYNTEIGSISGAVPPLIGWSAVSTDITHPAIA---------RFI
COXX_BACSK       LFLYVVPYTMWSKRRTIYNTEIGSVGGAVPPLIGWAAISGDLVHPAII---------GLF
COXX_EXIS2       SFVYVVIYTMWLKRTHTINTVVGGISGAVPPIIGFAAVTPTL-HIDAW---------ILF
COXX_BDEBA       VFLYNGPYTLWWKRRWVFAAVPGAIPGALPVTIGYAVANPDIFNSES---------LYLF
COXX_RHOBA       WLIYVLVYTP-MKTRTAWNTTVGAIAGALPVFIGYTAAGGTLTELPGW---------MLF
                        *:             .   *      .                          

CYOE_XYLFT       AIIFVWTPPHFWALAIFRRADYAKASIPMLPVTHGVQHTSRQILLYTVILSVVTLLPVAT
CYOE_ALCBS       LIIFVWTPPHFWALAIHRRDEYAKADIPMLPVTHGIPFTRESVLYYTILLFICTLLPYLT
CYOE_METCA       LLIFVWTPPHFWAYAIAKRDDYAKVDIPMLPVTHGIAFTQLHILLYTILLFLAGLMPYVT
CYOE_NITOC       LIIFVWTPPHFWALALARREEYSRTKYPMLPVTHGVDFTKQQIVLYTFLLFAVSLLPFVS
CYOE_ALKEH       LIVFVWTPPHFWALAVARLKDYERADVPMLPVVYGERFTRWQILLYTVLLLAVSLLPWAT
CYOE_COXBU       LIIFLWTPPHFWALAIHRIDDYAKANIPMLPNTHGIIYTKINILLYTLLLTAISFLPFVI
CYOE_LEGPL       LIIFTWTPPHFWALAIYRYKEYQDAEIPMLPVTHGIQFTKLNIYLYTVLLLVVSLLPFVV
CYOE_HAHCH       LIIFAWTPPHFWALAVHRKDEYAKAGVPMLPVTHGDRYTKLHILLYTLMLFAASMLPFIT
CYOE_MARHV       LIIFAWTPPHFWALAIHRKEEYAKAGIPMLPVTHGNRYTELHILLYTLMLLAVSLLPFVT
CYOE_PSEU5       LIIFAWTPPHFWALAIHRKDEYAKVNVPMLPVTHGVHYTKVHILLYTAMLLAVSFMPFAI
CYOE_SACD2       LIIFAWTPPHFWALAVHRKEEYANAKIPMLPVTHGEAYTKIQILLYTFILIAVTLLPYAT
CYOE_SHEON       IIIFLWTPPHFWALAIHRRAEYAKVDIPMLPVTHGVEFTKTCILLYTILLAIACLLPVLV
CYOE_SHEAM       IIIFAWTPPHFWALAIHRKADYAKVDIPMLPVTHGVAFTKTCIFLYTILLALACLLPVLV
CYOE_COLP3       LIIFTWTPPHFWALAIHRKNDYAKVNIPMLPVTHGVSFTKTQILLYTVLLFVVCLLPYLV
CYOE_IDILO       MIIFTWTPPHFWALAVHRAKDYARAKVPMLPVTHGIEFTKTCIFLYTVLLTVVCLMPFLI
CYOE2_PSEA6      LIIFIWTPPHFWALAIHREKDYARAKIPMLPCTHGIEFTKTSILLYTVLLALISVLPYLI
CYOE_PHOPR       MLVFTWTPPHFWALAIHRRDDYAKAGIPMLPVTHGIEFTKTMVLLYTVMLFIVGLLPWLT
CYOE1_VIBPA      MIIFIWTPPHFWALAIHRVEDYRKVDIPMLPVTHGIEYTKTSILLYTVLLTLVCVMPVLV
CYOE_VIBVY       MIIFIWTPPHFWALAIHRKEDYAKVNIPMLPVTHGVEYTKTSILLYAILLALVCMLPVLV
CYOE2_PSEHT      MIIFTWTPPHFWALAIARKSDYARAKIPMLPVTHGIDFSKTCVVAYSVLLAIVCIFPYLI
CYOE_PSYIN       MIIFTWTPPHFWALAIHRKADYAKAKIPMLPVTHGTDFTKTCILLYSLLLTVVCFLPFLI
CYOE_VESOH       LIVFIWTPPHFWALAIYRVEEYKKIDMPMLPVTHGLAYTRTQILLYTVLLLLVSLLPYLS
COXX_METPP       LIIFLWTPPHFWALALYRAEDYARAGLPMLPVTHGNDFTRLQILLYTFVLFAATLLPFVY
COXX_LEPCP       LIIFLWTPPHFWALALYRAEDYARAGLPMLPVTHGNEFTRLQILLYTFVLLAGTLLPFVQ
COXX_POLSJ       LIIFLWTPPHFWALALYRVEDYRKSGLPMLPVTHGNEFTRLQVFLYTLVLFAACLMPFVF
COXX_BORA1       LIIFIWTPPHFWALALYRTEDYRKAGLPMLPITHGSKHTRLQIMLYSFALFAVTLLPYFM
COXX_JANMA       LIIFIWTPPHFWALALYRRDEYAKSGLPMLPVTHGTEFTQFHIWLYTIALVATTMLPFAV
COXX_PARXL       LIIFVWTPPHFWALALYRRKDYENAGLPMLPNTHGEKYTRLHILLYTVILFAVTMMPFIS
COXX_RALSO       LIIFTWTPPHFWALALYRRADYAKSGLPMLPITHGEKFTLLHILLYTLIMVAATILPFVH
COXX_POLAQ       LIIFVWTPPHFWALALYRRDDYVQSGLPMLPVTHGERFTLLNILLYTLILIAATLLPYIY
COXX_AROAE       LIIFAWTPPHFWALALYRSADYARAGLPMLPVTHGPEFTRLSVLLYTCILFGVTLLPFAT
COXX_THIDA       LIIFAWTPPHFWALALYRREEYARAGLPMLPVTHGEAYTRLHVLLYTLLLLAVSLLPVGT
COXX_NITEC       LIIFAWTPPHFWALALYRKSDYAKIGMPMLPVTHGEEFTRLHVLLYTIILCIATVLPYLT
COXX_NITMU       LIIFAWTPPHFWALALYRKLEYAKVGMPMLPVTHGDKFTRLHVLLYTLILIAVTLMPYAT
COXX1_CHRVO      LIIYTWTPPHFWALALYRRDDYARAGLPMLPVTHGQRYTTLSIVLYGFLLTAVTLLPVAL
COXX_DECAR       LIIFLWTPPHFWALACYRRDDYACSGLPMLPVTHGIAFTCQHILWYTLMLAAASLIPVSL
COXX_ACICJ       AIIFFWTPPHFWALSLFASADYQKAGVPMLPVVAGQKATRLAVMRYTLWLVPLSLLPYVL
COXX_GRABC       AIVFFWTPPHFWSLSLWAQMDYERAGVPMLPVVAGARKTRQHIMAYTVLLSVIAVLPWAL
COXX_GLUOX       AIVFLWTPPHFWSLSLYACKDYGKAGIPMLPVVKGARHTRWQILIYTFILTAVSLVPSFV
COXX_GLUDA       AIVFLWTPPHFWSLSLYACKDYGRAGIPMLPVVRGARHTRWQILFYTLILSAVSLVPSFL
COXX_RHIL3       LIIFLWTPAHFWALALFKMRDYEAVGVPMLPNVAGERVTKHQIVAYAVLTAVCAVLPSFL
COXX_AGRFC       LIIFLWTPAHFWALALFKMRDYGAVGIPMMPNVAGERSTKNQMIVYAVLTAAAAVAPFFT
COXX_SINMW       LIIFLWTPAHFWALALFKMGEYGAVGVPMMPNVCGEATTKRQIVIYAVLTAISGICPTLL
COXX2_RHILO      LIIFLWTPPHFWALALFKSGDYERAGIPMMPNVAGHASTRRQIFAYALVLAPVGVAPWLL
COXX_CHESB       LIIFLWTPPHFWALALFKEGDYERAGVPMMPNVAGAASTRRQIFAYSVLVAVSGVLPTAM
COXX1_RHILO      LIIFLWTPPHFWALALFKVGDYAAAGIPMMPNVAGPASTRRQILAYALLLAPVGVLPWAF
COXX_OCHA4       MIIFLWTPPHFWALSLFSANDYEAARIPMMPNVKGELSTRRQALFYSIIMAPVGVLPWVL
COXX_BART1       LIIFMWTPPHFWALSLFSSLDYEAAGIPMMPNVRGEYSTKKQILFYTVLMVLCATAPCFT
COXX_BARBK       LIIFMWTPPHFWSLCLFSSSDYEAAGIPMMPNVRGERSTKNQILVYAIITAVCAIGPYIT
COXX_NITHX       LIIFFWTPPHFWALALFRSDDYARAGVPMLPVVAGPDATRLQILLYTIVLVAIAAAPWPL
COXX_RHOPB       AIIFFWTPPHFWALALFRAGDYANAGVPMLPVTAGPDATRLSILLYTIVLVAVAFAPWPL
COXX_AZOC5       AIIFFWTPPHFWALSLYRADDYARAGVPMLPVTAGPDETRKQILLYTLFLVPLALSPVML
COXX_BEII9       AIIFIWTPPHFWALALGRSEDYRQAGIPMMPNVKGAARTRLEILLYTLLLAPLGVAPWLL
COXX_METS4       LIIFVWTPPHFWALALVKSGDYAKAGIPMMPNVAGPDSTRRQIVAYTLLLAPLGLAPVAL
COXX_METRJ       AIIFIWTPPHFWALALIKADEYARAGIPMMPNVAGPASTRRQIVWYSLLLAPLGLVPVAL
COXX_PARL1       LIIFMWTPPHFWALALYRSGDYEKVGVPMLPVVSGEKETRRQIMLYSLALVPVTLLPGFL
COXX_DINSH       ALIFMWTPPHFWALALFMKSDYHDAGVPMLTVTHGRKSTRTHILVYTVLLVPVALGLALT
COXX_RHOS5       ALIFMWTPPHFWSLALFMKTDYSDAGVPMLTVTHGRRVTRGHVLAYALLLAPLAVAGAFT
COXX_ROSDO       ALIFMWTPPHFWALALFMKSDYDDAGVPMLTVTHGRKKTRAHIIAYTVLLAVLAVGTGFS
COXX_RUEST       ALTFLWTPPHFWALALFMRNDYDMADVPMLTVTHGRRSTRKHILVYTVILAAFALTTAFT
COXX_PARDP       ALIFFWTPPHFWALALFMKDDYSKAGVPMLTVTHGRKVTRCHIFAYTLVLAPFALWLGFT
COXX_JANSC       GIIFMWTPPHFWALALFLKKDYNNAGVPMLTVTHGRTETRRQILIYTILLVPVALGLVLT
COXX_CAUSK       LIIFLWTPPHFWALSLYISTDYAKAGVPMLPVVKGAKETRKQILLYSLALIPVCLAPAFT
COXX_HYPNA       AIIFFWTPPHFWALSLLAHKEYAKVSVPMLPVTHGAKATRFQILVYTLVLIPVSLAPLAT
COXX_MARMM       MIIFLWTPPHSWALALYKSGDYAAANVPMMPVAKGAKSTRLQILLYSIVLVIFAGAPVLT
COXX_ERYLH       AIIFMWTPPHFWALALFVKTDYEKVGIPMMPVVKGEASTRRQILVYSILLIPFAVAPWAI
COXX_NOVAD       LIIFMWTPPHFWALALFVQTDYAKVGIPMMPVVAGERSTRKQILAYSILLLPLTLVPWWI
COXX_SPHAL       LLIFLWTPPHFWALALFVRSDYAAAGIPMMPVVAGEKSTRRQILFYALIMAAAAIAPWPL
COXX_SPHWW       ALVFLWTPPHFWALALFINSDYARAGVPMLPAVAGQRATRIQIMLYTVPMVIAAVAPWAM
COXX_NEOSM       LIIFLWTPPHFWALALKNSGEYEAAGIPMLPVTSGVKATKMQILCYSVLLFITSILPYLL
COXX_ANAMM       AIIFVWTPPHFWAIALLTLEEYKKANVPMLPV-YCIRKTRSHILLYSIILAVVGATPGLF
COXX_ANAPZ       MIIFLWTPPHFWALSLLNRDEYKLAGIPMLSV-YSVQSTKNHIMGYSLLLFIVALLPGLY
COXX_EHRRW       LIIFMWTPPHFWALSLLNYHEYEKAKIPMLPVTHGIFTTKIHILVYSILLFPITLLPGLF
COXX_WOLTR       LIIFMWTPPHFWALSLNKSEDYEKASVPMFNVVYGPEKTRKYILVYSVLLVLTSLLPALF
COXX_RICPR       LIIFIWTPPHSWAIALFCNDDYKHCKIPMMPVVKGTLYTKKQILIYSIILFIVSLMPFFI
COXX_RICBR       LIIFIWTPPHSWALALFCNDDYKNCKVPMMPVIKGALYTKKQILIYSVLLFLTSLKPFFV
COXX_ORITB       LIIFLWTPAHFWTLSLYYTNDYKLANVPILPLVKGINYTKYSILAYTFLTVISASLPYFT
COXX_PELUB       LIIFFWTPSHFWALSLYKSDDYKKAKIPMLPLTNGIESTKINILVYSLLMLPMVILPYAI
COXX_LEPIC       MMIFLWTPAHFWALAIFLKEEYSDADFPMLPVVKGIHQTTKSIFFYTILYSIACVSFYFL
COXX_LEPBP       LMIFLWTPAHFWALAIFLKDDYEFAGIPMMPVVSGIEKTVNQIFLYAIAYSLSVIGFYFV
COXX_PROMT       SLVMVWTPAHFWALAILLKEDYRSVGIPMLPTVSGPFVTAKAISVYGYLTVFLSFLGCFV
COXX_PROMA       ALVMVWTPAHFWALAILLKDDYRSVGIPMLPVVKGSVFTAKAIAQYGWATVLLSCFGVFA
COXX_SYNSC       ALVMVWTPAHFWALALLLREDYRAVGIPMLPVVKGPVVTARAIKTYGWITVLLSSLGVFA
COXX_PROMP       SLVMLWTPAHFWALAILLKDDYASVGIPMLPSVKGSEFTVKAISRYGWATVFMSILGVFA
COXX_SYNR3       GLVMLWTPAHFWALALLLTDDYRSVGIPMLPVVKGPEVTGRAINRYAYATVAASLLGVLT
COXX_FRASN       AVVFFWTPPHFWALAIRFKDDYAAAGVPMLPVVATLEVVTRRILAYSYLMVAVSLAVAPV
COXX_ACIC1       AVIFAWTPPHFWALAMRFREDYAAAHVPMLPVVAEPLVVARQILWYSYGMVAASLALAPV
COXX_NOCSJ       AVVFFWTPPHTWALALRYREDYANVDVPMLPVVAPAREVGRQVVIYSWVMVATSLLLWPV
COXX_CUTAK       FIVFWWTPPHTWALSFRYREDYEAAGVPMLPVVRDAPEVAIQILIYTVMTVAISLVLWPV
COXX_THEFY       LVVFFWTPPHTWALAMRYREDYAAANVPMLPVVASDRRVMLECVLYSWATVVVSLLLWPI
COXX_ARTS2       MVIFLWTPPHYWPLSMRYGEDYRNANVPMLGAIAGAKVVSVQVVLYAWAMVACSLLLIPA
COXX_RENSM       MVIFLWTPPHYWPLSMRYSEDYKAANVPMLGAVAGARIVSVQVVLYTWAMVVCSLLLIPL
COXX_CLAMS       MIVFLWTPPHYWPLSMKYRDDYASVNVPMLAVVRGRAAVGLQTILYSWATLACSLLLIPV
COXX_LEIXX       GVIFLWTPPHYWPLSMKYREDYKDAGVPMLAVVRGRAVVGLQVVLYAWAMVACSLLLIPV
COXX_TROWT       AVVFLWTPPHYWPLSIHYSEDYRLTSIPMLGAIFPRKLVVLQVLLYAFAVVACTLLLIPV
COXX_KINRD       GVIFLWTPPHYWPLSVRYREDYANAGVPMLPVVAKPTTVSRQIVLYTIAMVLCSLLLVPL
COXX_STRGG       AVIFFWTPPHYWPLSMKVKDDYARVGVPMLPVVATNRVVAKQIVLYSWVMVAVSLLLTPL
COXX_CORDI       MVIFFWTPPHTWALAMKYKDDYARAGVPMLPVVRTPVEVTRQIVWYTVATVLTTFLLIPA
COXX_CORJK       MIIFFWTPPHTWALGMRYREDYEAAGVPMMPVVKPPLQVTRQILAYTWAAVITSLLLVPA
COXX_MYCLE       AIIFFWTPPHTWALAMRYKDDYKVASVPMLPAVATERHVTKQILIYTWLTALSTLVLALA
COXX_MYCGI       LIIFFWTPPHTWALAMRYKEDYEAAGVPMLPVVATEQQVTKQILVYTWLTVLATLALALT
COXX_NOCFA       GVIFFWTPPHTWALAMRYKEDYRAAGVPMLPVVATERTVTKQIVIYTWLTVLTTLALVPA
COXX_RHOJR       LVIFFWTPPHTWALAMRYKEDYKAAGVPMLPVIATEEHVTKQILLYSWAMVITSLTLVPA
COXX1_SACEN      GVVFLWTPPHFWSLAMKYREDYARAGVPMLPVVATPRQVSARILVYSWATVACTLLLVPA
COXX2_SACEN      GIIFFWTPPHTWSLAMKYRDDYERAGVPMLPVVARPTYVSRQIVVFTWLMVLWTLLLAPA
COXX_SALTO       GVVFFWQMPHFYPLAMKYKDDYARAGIPMLPVVASTRRVNAEILVFAWLTVLVSLVTWPL
COXX_SYNY3       ALIFLWTPPHFWALALMIKDDYAQVNVPMLPVIAGEEKTVSQIWYYSLLVVPFSLLLVYP
COXX_SYNP2       ALIFLWTPPHFWALALMIKEDYAEVEVPMLPVVKGEKITVDQIWIYTLIVVPFSLLLVFP
COXX_MICAN       AIIFLWTPPHFWALALMIKDDYAEVDIPMMPVVKGEEATSEQIWLYTLIVVPFTFLLIYP
COXX_TRIV2       AIVFLWTPPHFWALALMIRDDYAKVGIPMLPVVEGNAATVKQIWYYTLITVVATLLLVYP
COXX_TRIEI       AIIVVWTPPHFWALAIYIRDEYQEVGVPMLPVIEGNEETARQIWVYTLILIPMTLLLVYP
COXX_THEEB       GMIFVWTPPHFWPLAMLIQEDYARVQVPMLPVVGGDRVTAQQIFLYTLALVPTSLLLVYP
COXX_ACAM1       AIIFIWTPPHFWPLAMMIEEDYSKVGVPMMPVVNGMATTANQTFIYTLLLLPVTLLLVYP
COXX_SYNJA       ALIFLWTPPHFWALAILKREDYARAGVPMLPVVAGERPTAAQILLYALLLVPVSLLLVYP
COXX_SYNE7       AIVCLWTPPHFWALALMIRDDYAAVKVPMLPVVVGNAATAQQILAYAGLLLPTTLALAWP
COXX_GLOVI       GIIFMWTPPHFWALAMMIREDYRKAGVPMLPVVAGDEATARQIFIYTLVLVPVTLVL-YP
COXX_DEIRA       AIIFFWTPVHFWALALMIKEEYREVGIPMLPVVHGDHMTVAQIGLYAIYTVVLSLMPVYF
COXX_SYMTH       LVVFLWTPPHFWALALFRSEDYERAGVPMLPVVRGERATKWQILLYSLLLIPSAALL-YW
COXX_SULTO       FLIFMWTPGHFWSLALRFRDDYKNAEIPMLPVLTDER-TSAKAIAISNALMVPFALLIGL
COXX_SULAC       LLVFAWTPGHFWALALRYKRDYANAEIPMLPAIVDDK-TAARAIAISNILMIPFALGLML
COXX_METS5       LLIFMWTPGHFWALALKFKEDYSRAGIPMLPVIMPEN-FSAKMIALSNALMIPFALALYL
COXX_SACS2       FLIFMWTPGHFWSLALKYREDYINAHYPMLPAVVGIT-TSARAIATSNALMIPIVLLMGY
COXX2_PICTO      FLVFMWTPTHFWNLSVNNVDDYKKSNIPMLPAVVGIK-RTEFWIMVNTSILVIYSILPLF
COXX1_MAGSA      LVLFLWTPSHFWSLAILLADDYRQAGVPMLPVVVGAK-RTAWCILANTVILVGASLLPWG
COXX2_MAGSA      LVLFLWTPPHFWSLATALKDDYAAAGIPMLPVVCSET-ETNRIILANTIALVASSLLPAF
COXX1_CENSY      FLVFVWTPSHFWCLAMKIREDYEAAGVPMLPVVIGMQ-RTSKYILGNTLLLLPYSLALYA
COXX_THEAC       LLVVVWIPIHVWSLAYRYRDDYNRAHVPMMTSIHNDR-ISAICISSAAIILFAFSIIPAF
COXX_THEVO       ALVVIWIPIHVWSLAYRYRDDYNRARVPMMTSIQSDR-ISAICISSSAVILFIFSIIPVF
COXX1_PICTO      FLVMFWIPVHVWSLAYKYRDDYYRAGVPMLPVVYSDR-KTAVSISLSSMLLILFSVIPYF
COXX2_CENSY      GLVFIWTPMHIWALTLHFRDDYNKVNVPMLTAVHSEG-TSARVIAVSTVAMALFSLAPLL
COXX_DESAP       ALVVLWIPNHIWSLAIFYREEYARVKVPMLPVVYELR-RALNWLLLTVVLMVVFSVLIYF
COXX_PYRNV       FAIYLWIPSHIWALAYKYREDYRRAGVPMLPAIIDEG-KAVAIISALNIASAAYILWLYL
COXX_PYRAR       FAIYLWIPSHIWALAYKYRDDYRRAGVPMLPTVVGEK-AAVAIISLLNLASAAYIMTLYL
COXX2_PYRAE      FAIYLWTPSHIWALAFKYRGDYKRAGVPMLPALIKEE-RAVAVISAINAAAAAYILWLYL
COXX1_PYRCJ      FAVYLWIPAHIWSLAYKYKEDYRRAGVPMLPVVIGEQ-KAVVVISVLNVASVAYIALLTL
COXX2_PYRCJ      FAVYLWIPAHIWSLAYRYREDYRRAGVPMFSTVVDQR-TAVVAISLLNIASALYMAFLYV
COXX_CALMQ       MVIYVWIPAHIWSLAYYARDDYKRVNVPMLPTMVNEK-ASVRIISILNLVSIIYMLVLYQ
COXX_KORCO       LITILWIPSHIWYISIYYLDDYAAARVPMAPVVWGIE-RTSKLIVASNVLMIILQLLLFL
COXX_ARCFU       AIVLLWIPSHIWYISMHYEEDYRMANIPMYPLVVGME-RASWAIVFATAAMLVLAASLYV
COXX_AERPE       LIVFLWQPMHVWFLGYYFKEEYSVARIPILPSNGNPR-LVSSLIAVSLAGLIAVAWAFAL
COXX_HYPBU       LIVATWVPSHIWFLATYYRDDYRRANVPMLPVVADTPIAVASGIGLGSLVMGYSIVGLWV
COXX_THEPD       LLVAVWSSLHIWTLSTYYSEDYRRAGVPMLPAVYGERAGVVASLAAAVAVFLVAFLAFRA
COXX_FLAPJ       LIQFFWQFPHFWAIGWFLFEDYKKGGFYMLPTGK-RDKGTAMQIVLYTLWLTAASILP-S
COXX_FLAJ1       LIQFFWQFPHFWSIGWFLYDDYAKAGIFMLPTGN-KDRKTALQVILYTIWLIIASLLP-V
COXX_GRAFK       MIQFFWQFPHFWAIGWWLFDDYKKGGFFMLPTGK-RDRGTAIQIILYTCWTILVSLIP-V
COXX_CYTH3       AIQFLWQFPHFWAIAWVLDEEYKKAGIKLLPTKDGRSKHTATIIMTYTLCLLPLGFLPYL
COXX_GEOMG       GLLYLWQIPHFWLLQCRHAEDYRRAGLPLFAPGVTAGSPVF--RVWIGAFAAGTLLLPLF
COXX_GEOSL       GIFFLWQVPHFWLFQRRHADDYRRAGIPLFTPGAGRLGPSFHVRLWLGALAASVLLLPAF
COXX_DESAG       IVYYLWQVPHFWLRAERDRQSYLAAGLPLPSVELPH-RYHALLRLWYASYMVALLLLPVF
COXX_DESVV       TLYLLWQIPHFWLHAARDREAYRKARLPLPLLSLPHERYARLLKVWFHAYAVAVLMVPAF
COXX_SOLUE       AILFLWQFPHFYSIAWMYKEDYARAGIQMLPVVDPDCRSTARQIVIYGIALIPVSLVPAL
COXX_KORVE       AILFFWQFPHFHSIAWLYRDDYANAGIRMLPVVERDGRSTAREIVIYAAFLLPITLTPFL
COXX_SALRD       GILATWQMPHFLSLAWMYRKDYARGDYAMLPVVEPDGNSTAAQMIGFAALLVPVSVLPVL
COXX_OPITP       GVLFFWQVPHFMAVAWTYRKDYSAVHFPMLPVRDESGERVALWSLINTAALLVTSLLPLL
COXX_ANADE       GLLFAWQLPHFLAISLYLREDYQRGGLRMFASVH-GERATRLWMALTTILLLPASLALVP
COXX_ANADF       ALLFAWQLPHFLAVSIYLRDDYARGGLRVFSIVH-GERTTRAWIAATAAALVPVSLLLVP
COXX_MYXXD       AIMFLWQMPHFIAIALFRKEEYRAAGLTSVPLER-GDESSRAQVVLYLVALIPMTLLPFQ
COXX_SORC5       AVMFLWQIPHFLAISLFRQDEYQRAGLKVLPLEK-GDLTTRRHIVGYLALLVLSSVLFVP
COXX_GEOUR       LVMLLWQPPHFWALALKHQDDYRRAGVPTLPLVRGEAYTKVCIFVFAALLLPASLALWFT
COXX_AQUAE       LLMFMWQPPHFWVLALKYADDYKRAGIPTLPVARGVFITKLKTLLYTASLFPVSLIPYLT
CYOE_ECOLI       AIFSLWQMPHSYAIAIFRFKDYQAANIPVLPVVKGISVAKNHITLYIIAFAVATLMLSLG
CYOE_PHOLL       LIFSLWQMPHSYAIAIFRFKDYQAANIPVLPVIKGISVAKNHIILYILAFMIATLMLAIS
COXX_METFK       IIFSLWQMPHSYAIAIFRLKDYTAAAIPVLPVKKGILATKKHIVLYIVAFVIAAVMLTLS
CYOE_PSE14       VMFSLWQMPHSYAIAIFRFNDYRAAKIPVLPVKRGILVTKRHIMLYILAFLVATLMLTVG
CYOE_CHRSD       LIFCLWQMPHSYAIAIFRFHDYRAASIPVLPVERGVRAAKHHIFWYILAFLGATLMLTLG
CYOE2_SHEWM      LMFSLWQMPHSYAIAIFRYKDYAAAKIPVLPVAKGMTRAKLHIVLYIAVFSLVSALLPLA
CYOE1_PSEA6      LMFSLWQMPHSYAIAIFRFDDYAKANIPVLPVAKGIAKTKLHIVLYIAVFAIVSALLPLS
CYOE2_SHELP      AMFSLWQMPHSYAIAIFRFKDYEAANIPVLPVAQGVEKAKLHIVFYIALFALVSTLLPLA
CYOE1_PSEHT      VMFSLWQMPHSYAIAIFRFKDYQAAGIPVLPVAQGIDKAKRHIVLYIAIYALVVMLLPIS
CYOE_MARMS       TMFCIWQMPHSYAIAIFRYKDYEAAGIPVLPVSQGIAKAKRHIILHIAAFAVVAALLPLT
CYOE2_PSEA7      AIFCLWQMPHSYAIAIFRLKDYEAAGIPVLPVARGIAVTKIHIVLYILAFMAATLALCLG
COXX2_CHRVO      LMFSLWQMPHSYAIAIFRFKDYEAAGIPVLPVVKGISAAKQQIVLYILAFAAATVMLVFG
CYOE_ACIAD       LAYGLWQMPHSWAIAIYRFDDYKNAGIPILPVARSVYRTKVECLIYIVLFAAVLNGLYCF
CYOE2_VIBPA      TMFCLWQMPHSYAIAMFRMQDYREAGIPVLPVKDGIHKAHRHMKAYVVAFGAVSLGLFLL
COXX_PARUW       AMMVFWQMPHFFSIAIYRLQDYSAANIPVLPLKKGIQITKIRILLYIIIFTLTSSLLTFF
CYOE_BLOFL       IAFSFWQIPHSYSITIFRSQDYKKASIPTFNIKKGIKLTRIHMILCILIFTLANISLTVL
CYOE_BLOPB       IIFSLWQIPHSHSIAILRLNDYKVAFIPTFPIKKGVESTKNHMVVYIIGFIIATILFTVM
CYOE_BAUCH       LIFCLWQMPHSYAIAILRLQDYQAASIPILPIKKGIRITKNHIVIYIVAFIVTTILLNIS
CYOE_WIGBR       CIFSFWQIPHSYAIGLVRYNDYKIASIPIFPIKKGSFKTKINIIIYIIAFFISTIMLFFA
CYOE_BUCCC       FMFSFWQIAHSYSIIIYRYSDYKLLNLPVFPILYGKLKTIIFISICILNLFFFNFLLYFF
CYOE_BUCAI       VIVIFWQMSHFYSISIMRIKDYREAKIPVFSVVKGVAITKKHIFFYVLNFSFFSSLFTFL
CYOE_BUCAP       IIFIFWQMSHFYAIAILYINDYRKANLPFFPVVKGILKTKKHIFYYITCFIIASSMLTFL
CYOE_BUCBP       IMFALWQIPHSYAICILHFRDYKIANIPVFPVIYGFKITRYHIILHIILFFISVIVLTFI
CYOE_FRATH       LILFFWQIPHSYAIAMLYIDDYKKVKLPMLPIVKGIAYTKKIMLFYLALFVVSCALPAVL
COXX1_BACVZ      AIMFLWQPPHFWAIGIRRKEEYRAAGIPLLPIIKGNRATKIKMLRYTAVLTAVSLLVPLY
COXX1_BACSU      TIMFLWQPPHFWAIGIRRKEEYRAAGVPLLPVVKGNHVTKIKMMQYIAVLVPVTLLFPFS
COXX_BACLD       LIMFIWQIPHFLALAIKKTEEYRAANIPMLPVVHGFEVTKRQIIIWIACLMPLPFFL-GG
COXX_BACP2       MIMFIWQIPHFLSLAIKKTEDYRKAGIPMLPVVYGFEVTKRQIIIWTACLLPLPFFL-GG
COXX_GEOTN       LIMFLWQPPHFLALAMKRCEEYRAAGIPMLPVVHGFEMTKRQIIVWVACLLPLPFYL-FS
COXX2_BACCN      LIMFIWQIPHFLALAMKRVDEYRNAGIPMLPVVHGFDITKRQIMIWTVCLLPLPFYM-SG
COXX_BACPE       FIMFLWQPPHFLALAMKRVEEYRAAGIPMLPVVAGFEMTKRQMVVYVAALLPVSLML-YP
COXX_LISIN       LVMFCWQPPHFYAIAIKRKEEYAAAGIPMLPVVKGIERTKKSMFFWVILLTVLPFFM-FD
COXX1_LYSSC      LIMFAWQPPHFYALAMKRTEEYRAAKIPMLPVVKGFKRTKYSMLFWILLLLPLPFLL-PE
COXX_OCEIH       LIMFIWQTPHFLALAMKKRDEYEAAGIPMLPVVRGMAVTKRQIIVYIACLLPLPFFLLPT
COXX_STAS1       LVIFCWQPIHFYALAIKRKDEYSLANIPMLPSVKGFNRTRVSMFFWLVVLLPLPFLL-SS
COXX1_BACCN      IIMIIWQMPHFYAIAIRKHKEYEAANVPMLPVVKGVKRTYIQTNVYLVILIIISILL-GS
COXX2_LYSSC      FVMVIWQMPHFYAIAIRKRVDYEAASVPMLPVVKGMRRTYYQTNFYLILLILSSFLF-GS
COXX_BACSK       VVTVLWQMPHFYAIAIRRYDEYKAAKVPMLPVVKGFKRTFIQTNVYLVVLAASSFFF-VS
COXX_EXIS2       LIMFVWQPPHFLALAMRRTEEYRAAGIPMLPVVNGFAITKRQIVWWIAVLLPSSLLL-AH
COXX_BDEBA       LIMFLWQMPHFWVLAIRYKDDYAAGGIPTLPVALGMEKTMFQVGLYTLVYVGVALAAPMF
COXX_RHOBA       GVLACWQYPHFMAIAWLYRTQYAEAGFCMTTTVEPTGRHAAWQSILGSVALATCGVVLAW
                      *   *           *                                      

CYOE_XYLFT       GM-------SGVFYLGAALVLDAVFLWYAWRLLDP-------------------------
CYOE_ALCBS       GM-------SDLIYLLSALILGLVFLYHAVRLRFS-------------------------
CYOE_METCA       GM-------SGEIYLAAALIFGGIFVYYAIRLKRK-------------------------
CYOE_NITOC       HM-------SGLLYLVGAIGLGGRFVYLTIVLYRN-------------------------
CYOE_ALKEH       FM-------GGWLYLAAAVGLGGWYLMLNVRLLLT-------------------------
CYOE_COXBU       MT-------SGWIYFSSVCLLNLGFLYWAIRLLTS-------------------------
CYOE_LEGPL       SM-------SGWIYLLGALILGIRFLVWAHKLYFT-------------------------
CYOE_HAHCH       GM-------CGWIYFVAALALGVRFLDWAWAMWRD-------------------------
CYOE_MARHV       GM-------SGGIYLVGALALGLRFLQYAVRLLRG-------------------------
CYOE_PSEU5       HM-------SGPLYLAAAVLLGARFLYWTIALYRD-------------------------
CYOE_SACD2       HM-------LNELYLLGAVVLGIGFLYYAVAMMRN-------------------------
CYOE_SHEON       GM-------SGPLYFVCSSALSCGFIYKAWQLKYQ-------------------------
CYOE_SHEAM       GM-------SGALYLLGSTLLSIGFIYKAWQLKYH-------------------------
CYOE_COLP3       GM-------SNWLYLIGACSLNLIFFGYAWQLKFN-------------------------
CYOE_IDILO       GM-------TGMIYLVGVSVLNAIFLAYAWKLKYS-------------------------
CYOE2_PSEA6      GM-------TGAIYLLGSSALNAGFLYYAWKLKFA-------------------------
CYOE_PHOPR       GM-------SGGVYLVGSSLLNLGFIGYALKLKFA-------------------------
CYOE1_VIBPA      GM-------VGFIYLFSALLLNAGFIYHAWKLKFA-------------------------
CYOE_VIBVY       GM-------ASYLYLFSALVLNVCFVRYAIKLKFR-------------------------
CYOE2_PSEHT      GM-------SGLIYLIGASGLNAVFIYKAIKLKLA-------------------------
CYOE_PSYIN       HM-------SGYLYLFVAMLINIIFIYKAVALKLS-------------------------
CYOE_VESOH       GM-------SGLIYLVITIALGVRFLVYAIKIYNNP------------------------
COXX_METPP       GM-------SGWFYLVAACALGVGFCGHAFRLWRH-------------------------
COXX_LEPCP       GM-------SGWLYLAAAFVLGLRFIHYAWRLWRN-------------------------
COXX_POLSJ       KM-------SGWLYLVVAVVLSVGFSWHAWRLWRS-------------------------
COXX_BORA1       HM-------NGLLYLLAAVILGGIFVAHALRLYRS-------------------------
COXX_JANMA       GM-------SGLIYLVSVAILDIIFVWYAWQVYRH-------------------------
COXX_PARXL       GM-------SGVVYLAAAVLLGALFLAYAWKIYRE-------------------------
COXX_RALSO       GM-------SGYLYLAVALVLGFGFLVHAWRMYRN-------------------------
COXX_POLAQ       GM-------SGIIYLISAIVLGLMFLAYVIALFVS-------------------------
COXX_AROAE       RM-------SGPLYLVCAVALGIGFLRHAWRLYAD-------------------------
COXX_THIDA       GM-------AGALYLVGAVLLGARFIQYGWALHRE-------------------------
COXX_NITEC       QM-------SGLIYLVSVLILDAIFLYYAIRIYLH-------------------------
COXX_NITMU       QM-------SGLIYLAGAIVLDVIFLYYAVKIYLN-------------------------
COXX1_CHRVO      GE-------AGAIYLGAVLLLDGRLLFLAVRLHRQ-------------------------
COXX_DECAR       GM-------SGGFYLIAIGLLDLVFLGYAIALCRR-------------------------
COXX_ACICJ       HL-------AGPVYGASAMVLGLAFVWYSWRVLRDRQDGNGVS-----------------
COXX_GRABC       GD-------TGRVYGLSAVVLSLGFLVQSWRVLRDKQDEVGLS-----------------
COXX_GLUOX       HE-------VGLTYTVVTSLLDLGFILCAFRVLMDKQDAEGVS-----------------
COXX_GLUDA       HQ-------AGWLYTGVASLLDAGFVACAVGVLTDRQDEAGVS-----------------
COXX_RHIL3       GF-------ASLGYGLVAAALGAIFIYCSIAVWRMP---DGDL-----------------
COXX_AGRFC       GL-------ASAGYGIFAAVLSAIFVYCSFDVRRMP---EGDE-----------------
COXX_SINMW       GF-------ASLGYGALATALGLGFVGYSLGVLRMP---EGDK-----------------
COXX2_RHILO      GY-------TTPFYGVAAMLLGLGFVWYAWKVLGMA---DDDR-----------------
COXX_CHESB       GF-------ASLSYGAVAAALGVAFVWYSWRVLAAK---GQDP-----------------
COXX1_RHILO      GF-------TSGYYGIASAALGVGFIWHSWKVRAAS---ETE------------------
COXX_OCHA4       GF-------AGPVYGAISTLLGLAFVYYAWRMWVAG---SQPE-----------------
COXX_BART1       GL-------GGVFYGIFSTILGIIFIYFAYRLWKAN---THDE-----------------
COXX_BARBK       GY-------AGIIYGISSTILGGMFVYFAYRLWKTD---THDE-----------------
COXX_NITHX       GY-------FDWVYGVTSLVLGAGMLVLAINVYRHR---TGST-----------------
COXX_RHOPB       GY-------FDAIYGITSLALGGWMLLLTLRVYRLR---HGSA-----------------
COXX_AZOC5       GE-------AGLAYGVVAGVTGLGMLLLAVNVYRRR---TGPA-----------------
COXX_BEII9       GF-------ASFVYGMLSIALGAAMLFFAARVYIVQ---EGPS-----------------
COXX_METS4       GF-------GGLIYGLVALLGGLAMLALSLQVYHRR---EGEG-----------------
COXX_METRJ       GF-------GGLVYAVVGLVGGLGMVAFSIRVLRNP---EGDA-----------------
COXX_PARL1       GF-------AGALYMGATAALGAGFLWLAFGIWRTE---PGAA-----------------
COXX_DINSH       PV-------AGPLYLATALVLNAIFLKGAWDIWRRDEAQAEAD-----------------
COXX_RHOS5       GI-------GGPLYLVVALALNGWLLRGAVRIWRRDEAEAEAD-----------------
COXX_ROSDO       AI-------GGPVYLAAALVLNALFLKGAIDIWRRDEDTAIAD-----------------
COXX_RUEST       SV-------GGPIYLTTAVVLNALFLKGAVQIWRRDEEICESD-----------------
COXX_PARDP       SV-------GGPLYLAVSVVLNALFIAGGWQILRRSEDQAQAD-----------------
COXX_JANSC       EV-------AGPVYLITALVCNAIFLKGAYDIWKRDEAMAEAD-----------------
COXX_CAUSK       GL-------GGWLYLAVSGLGGLVFLTLAVRVFRSLAGEASDPRPADRDLYEVGEAAAKR
COXX_HYPNA       GL-------GGWIYGAVAGGLGLVFLAYAVAILRSKAGDD--------------------
COXX_MARMM       GL-------GGAVYGATSLGGGALFLLLAWRIFRSRAGEAGS-----------AEEGALY
COXX_ERYLH       GA-------TGAIYGVSALLLTGAFAALSVPVATRRQIEGD-------------------
COXX_NOVAD       GG-------AGAVYGWSALVLGLVFVALSVKVGLRRSVPND-------------------
COXX_SPHAL       GY-------TGALYGWTAILLSAIFVLLSVQVGIRTTAEDD-------------------
COXX_SPHWW       GL-------TGAIYGIGASLLSALFLLLAAQVGFSREADPA-------------------
COXX_NEOSM       RF-------SGGTYMIVAFILGLVFLYYAINVYLDE------------------------
COXX_ANAMM       VK-------HPVLYEILATGLSATFIAYAIAVFREKGQPSHKAC----------------
COXX_ANAPZ       VA-------ETVLYEIIATSLGAVFLTHAYCLLKEVGEPSPKAC----------------
COXX_EHRRW       LK-------DPVLYEITAIPLGLMFVVQAFQVFKSSISYHYRV-----------------
COXX_WOLTR       LK-------RAPFYLGMAIFGGCIFIWHAVSIMKLKDHSSQKR-----------------
COXX_RICPR       GM-------NNDIYLIIVCIIGLVFLYYAFSLFYDTPDNKQAK-----------------
COXX_RICBR       GM-------SNIIYLVIAAVLGLVFLYYSISLFYDNADNKQAK-----------------
COXX_ORITB       DI-------AGLLYLICSTISGIIFLCYASMLFNDR-NNILAR-----------------
COXX_PELUB       DF-------VGLVFLVPALMLTLYYNILCFELYKFKINKFNPKK----------------
COXX_LEPIC       ESS------MGFLYLIVSLIVCIWMGILSYQLIQ-----NPEP-----------------
COXX_LEPBP       DDR------MGYLFLLSAIVLTVLILGFAYRLKL-----SMDK-----------------
COXX_PROMT       LPE------GGLLYGILLLPYNSRLLQLVSRLRD-----NPEDL----------------
COXX_PROMA       LPE------GGALYGILLVPFNVRLLQMVRRLAA-----DPEDL----------------
COXX_SYNSC       LPS------GGAFYGVMLLPYNARLLQLVDRLSL-----DPDSL----------------
COXX_PROMP       LPE------GGILYLIMLLPFNGRLLQLINRLKS-----SPDDL----------------
COXX_SYNR3       LPS------GGLFYGLMVLPFNGRLLQMAQRLGE-----LPDDK----------------
COXX_FRASN       AD-------IGLVYLVPAVLLGAWFVAEAHRMAARA---KRGEE----------------
COXX_ACIC1       AH-------VGWVYVAIAALLGGWFLAEAHRIVQRV---RLGRD----------------
COXX_NOCSJ       AG-------TGIFYPIAAGVLGAVFLLEAHRMWARS---RDTESLSV-------------
COXX_CUTAK       AH-------MGWIYVVVAVVSGAVFIVEAAQLLRRA---NAGLRDAL-------------
COXX_THEFY       AD-------TTLLYPVAAAVLGVILLAQAHRLYNQV---RAGVSGSK-------------
COXX_ARTS2       GG-------AGWVYTVTAVVAGAWFLYESHALYNRA---QGGDVSNK-------------
COXX_RENSM       GH-------ACIVYTVVAGAAGLWFLLEAHRLHSKA---SHDTVTNK-------------
COXX_CLAMS       AG-------MGLVYTLAALAGGGWFVYETHRLYDLA---VRHEPIK--------------
COXX_LEIXX       AR-------MGVLYTAVALVAGGWFLYESHRLYNLA---ICHATVS--------------
COXX_TROWT       AH-------MTPLYGLFSAVLGAWFVYEIYRLYVRV---VRGHEIK--------------
COXX_KINRD       GG-------AGVVYGAAALVLGIGFLVQTIGLHRRA---TRFEVETGGRDAG--------
COXX_STRGG       GY-------TGWFYTAVALLSGGAWLWEAHGLQNRA---KAGVTGA--------------
COXX_CORDI       A---------SWIHAIIAVVSGVWFLVMAVRLHNGI---KNGGE----------------
COXX_CORJK       A---------SWIYLAAALISGGWFIIKAHMLHQGV---KNGTP----------------
COXX_MYCLE       T---------GWLYMAVAVVAGAWFLTMAHQLYVGV---CAGEP----------------
COXX_MYCGI       T---------GWLYASVAILAGTWFLVMAHQLYAGV---KRGEA----------------
COXX_NOCFA       T---------GVIYAAVALVAGAWFLLMAHQLYAGV---RRGES----------------
COXX_RHOJR       A---------GVVYAAVTLVAGAWFLLMAHQLYRSV---RGGAA----------------
COXX1_SACEN      T---------SWVYVAFAVLAGAAFLIVAQRLHNSI---RRGHA----------------
COXX2_SACEN      T---------GWLYTAFAIAAGAWFLVLAHRLHAQT---RRGEP----------------
COXX_SALTO       GAG------MGPIYGLPTLVVGVIFLVEAHRLCRRA---ARGEA----------------
COXX_SYNY3       LHQ------LGILYLAIAIILGGQFLVKAWQLKQ-----APGDR----------------
COXX_SYNP2       FQA------SGLFYAIAALVLGAIFIQKAWELKQ-----NPFDQ----------------
COXX_MICAN       LAA------CGVVYGVAALVLGFVFLKKAWRLKQ-----NPFDR----------------
COXX_TRIV2       LHS------SGIVYAAIAISLGAVFIRKSWRLLH-----NPEDR----------------
COXX_TRIEI       LHV------SGAIYAVLATYLGVIFIKKAWQLLK-----DPSNK----------------
COXX_THEEB       CGV------VSWGYGVVAIALGSWFIYRAWQLTQ-----APAER----------------
COXX_ACAM1       LKV------SGALYASIAIVLWVQFIHKAWQLTQ-----TPDDK----------------
COXX_SYNJA       LHV------LGSFYLSAATLLGSLLIWKAVQLLQ-----EPHSR----------------
COXX_SYNE7       LGA------AGPFYSATALLLGLELLRRSRQLCQ-----APDSR----------------
COXX_GLOVI       LGT------MGWIYLLAAGALGLWLIEGAFRLLK-----APNDR----------------
COXX_DEIRA       GAV------S-WIYFVSGALLGAWLLWLSYKLYRHVASGQPAER----------------
COXX_SYMTH       TGT------VGRLYLWTSVVLGCAMVSASVGLLRE----RAPQM----------------
COXX_SULTO       --------YAGLIYLIVSTIVSAFLLYVSVKLYLNPTA----------------------
COXX_SULAC       --------YLNLIYVIITLAATAVLLYFNVRLMRNPTP----------------------
COXX_METS5       --------YAGVIYGIVAGILSAVQMYFSVRLMRNPTG----------------------
COXX_SACS2       --------YISLIALIVFSVLSALLLFLSYRLILNPTK----------------------
COXX2_PICTO      IK----EIHVGLLYMPMAAVMDALLIYYVARPMINNYN----------------------
COXX1_MAGSA      ------LGLLGNVYGFVAAVSGAVLLGFNVVLVRDTSR----------------------
COXX2_MAGSA      ------FGA-GPLYLGAAILGGGWFLYKSVALVRRPGR----------------------
COXX1_CENSY      ------FGM-GLVYLVIAVASGGLMLVYHYKLTKTPTP----------------------
COXX_THEAC       F------RVMPMVYMILASAIAVPMIFYSIVFVRHPD-----------------------
COXX_THEVO       F------KAMPYTYMIVATIIAIPMLVYSVLFVRKPD-----------------------
COXX1_PICTO      L------GFFNYLYLLVILILSVPIVIYSVNFIKKPT-----------------------
COXX2_CENSY      ITLEDGAAAVGPVYLATAAASGALIIALSAWVVYKPT-----------------------
COXX_DESAP       V------GDWGLVYLATALVMGAAALALSVHIYRNPE-----------------------
COXX_PYRNV       VF------GRGLPGLALVLAGVAGTVATSALALREKS-----------------------
COXX_PYRAR       AF------GGGLLGGALVAAGVVATIATGAYALATKT-----------------------
COXX2_PYRAE      QF------GGG-AGGAIVALGVAATIATSIYAAVKKT-----------------------
COXX1_PYRCJ      LF------LPSLLSLLLVAVGAGAAVASSIYALVKRT-----------------------
COXX2_PYRCJ      LF------GGDPLGYVFVAPAVGLTLYTSALALVKKS-----------------------
COXX_CALMQ       LY------MAKLIGYILVIPATLAGIIVTIKALIKPS-----------------------
COXX_KORCO       MG------PLGPIFLVLSLPITLRFLIHSIRYARSPS-----------------------
COXX_ARCFU       LL------PLGIFYLVISTSAVAFFLYKAVKFALSPD-----------------------
COXX_AERPE       YY------GYGFLTAVITTVLAALAISRIGGFARTGE-----------------------
COXX_HYPBU       NN------VIGTVSLIVGVIAAIAIFHLAVKYAELGGD----------------------
COXX_THEPD       G-------LISAVGFAVAAVPLVLAVAVLLKGLVSGEY----------------------
COXX_FLAPJ       FGYTGRL-YLTPVSAIIVVLLGLWMLVYAIKLY---------------------------
COXX_FLAJ1       LGYTGQL-FISPVAAVLVFLLGLWMLFYAVRLY---------------------------
COXX_GRAFK       FGVTGKL-MLTPVSGIIIFLLGLGMLYYAIRLF---------------------------
COXX_CYTH3       FGMSGI------TSAYIALACGILFFFQTMYLW---------------------------
COXX_GEOMG       GIIGG---------SAAPGFCAFPLLLVLLAFS---------------------------
COXX_GEOSL       GLMAP---------RMAPWIAAVPLLLLPVCRP---------------------------
COXX_DESAG       PFIAET------AVRIAVCLAGITGLAASGYLL---------------------------
COXX_DESVV       PLLEGV------GMRIMVTLCGIALLFAAMLAV---------------------------
COXX_SOLUE       LGMSGR------LYLVGALLLGLWFLYSGVRV----------------------------
COXX_KORVE       LRFAGR------IYFLAALVLGSMLFWVSLRMFTMNLA----------------------
COXX_SALRD       TEAAGW------IYGVGVVPLGLWFLWTTIVF----------------------------
COXX_OPITP       WGLTTW------FYGVAAAVTGLWFLWQAIKFM---------------------------
COXX_ANADE       LGLAGT------GYAITAAVLGLALSAYAISGIGRE------------------------
COXX_ANADF       LRVAGP------SYGAVAAVLGVALAGYAFAGVGRE------------------------
COXX_MYXXD       LHIAGA------WYLAAAVLLGLSFLGLGAWGFFRRL-----------------------
COXX_SORC5       LGVAGP------VYLGAAILLGGAFFGLGVYGLRAGT-----------------------
COXX_GEOUR       GA-------CSARFAIEALCLGFFNL-FSCYLYLVK------------------------
COXX_AQUAE       GL-------VENLYFVVAVVMNLIYLGLTLKFFFSK------------------------
CYOE_ECOLI       GYA-------GYKYLVVAAAVSVWWLGMALRGYKVADD----------------------
CYOE_PHOLL       GYA-------GYKYLVVAAAVSVWWLGMALSGYKTDND----------------------
COXX_METFK       GYT-------GNHYLVVAGVISIYWLGLALAGYKTNND----------------------
CYOE_PSE14       GYA-------GLNYLAVAAGMGMYWLYMAWKGYKAVDD----------------------
CYOE_CHRSD       GYA-------GYGYFAVAAAMGLYWLVMALRGYRAGDD----------------------
CYOE2_SHEWM      GYT-------GIAFMAVTCATSLWWLGMALKGYQRDINL---------------------
CYOE1_PSEA6      GYT-------GLTFMAVACVTSLWWLFMALRGYRKNIEL---------------------
CYOE2_SHELP      GYT-------GVGFMAVSCVTSFWWLLMALKGYRSDVNL---------------------
CYOE1_PSEHT      GYT-------GAAFMAVACITSFWWLLMALRGYRRNIDI---------------------
CYOE_MARMS       GYV-------GIGFMVVALATSLWWLAMALRGYRPGIDV---------------------
CYOE2_PSEA7      GYA-------GYGYLLVAVAVSLWWLAIALTGY-WTADD---------------------
COXX2_CHRVO      GYA-------GYGYLAVAVATSLWWLKMALSGYKRETDD---------------------
CYOE_ACIAD       GYT-------NVFFLLTFNVLTAYWLYLSIIGFKAEND----------------------
CYOE2_VIBPA      GEA-------GYEYLAVAAVVCLMWTKVTFRSIDESNY----------------------
COXX_PARUW       HFT-------GSLYLILTIGLGLTWLLMGLRGLKTSND----------------------
CYOE_BLOFL       GYT-------SYTFLYIISIMSIFWLYTGWYQYKQLD-----------------------
CYOE_BLOPB       GYT-------SYIFLIIISIMNLWWLHMGFYGYRIIN-----------------------
CYOE_BAUCH       GYTT------SYQYLIVTNFINFWWLYLALQGYKEDN-----------------------
CYOE_WIGBR       GYT-------GNNYLFFSIFFGLIWIFIAIKGFKSSEENF--------------------
CYOE_BUCCC       GYV-------KFFYFLYTSFFIFLWFIFS---FLSNSRYF--------------------
CYOE_BUCAI       GYL-------SYNFLLLSSIVNFYWSFLSYSNIKKNN-----------------------
CYOE_BUCAP       GYL-------SYIFLLFFSFFSFYWLYISYLSIREKD-----------------------
CYOE_BUCBP       NSI-------NYKFLIISFFLCLTWLYYSLLELTIKN-----------------------
CYOE_FRATH       GSA-------DLFSFIVCMLVALFWMYKSIQSYRTDTD----------------------
COXX1_BACVZ      I---DV----SPFYTASALLLGAIWLYRSVKGFQAA------------------------
COXX1_BACSU      LGTGHI----SPFYFLAALVLGGIWIKKSIKGFKTD------------------------
COXX_BACLD       LGL---------PIVILGTVLNIGWLVCGLVGYRSK------------------------
COXX_BACP2       LGW---------PIVALGTLLNIGWLVIGLMGFKMK------------------------
COXX_GEOTN       LGI---------PFLIVATVLNVGWLLLGLWGLKMK------------------------
COXX2_BACCN      LGI---------TFMIIATLLNIGWIVLGFYGFRKK------------------------
COXX_BACPE       FGL---------VYTIVAAVLGVGWLALGIAGFKMK------------------------
COXX_LISIN       LGL---------VYVILATLLNIGWLALSIYGFKMD------------------------
COXX1_LYSSC      LGI---------GFLTLATALNLGWLILALKGFTAK------------------------
COXX_OCEIH       MGI---------TFAVIATLLNLGWLAIAFTGLFVD------------------------
COXX_STAS1       LGV---------TFIVLATLLNLGWLYLGLTSFKKDT-----------------------
COXX1_BACCN      LSI---------GLMLVSLLLSILWLALSIYGYK-KM-----------------------
COXX2_LYSSC      LSV---------GIMLVALLLSIAWLVMSIYGYHSNK-----------------------
COXX_BACSK       LSW---------FITIVALVLSLIWLTLSIAGYK-RM-----------------------
COXX_EXIS2       YGI---------IYMLVMAVLGGYWLYMGLKGLKIKEEQ---------------------
COXX_BDEBA       VHA-------SWMFVLLTFPFVFKVLQEFYRYYKSNG-----------------------
COXX_RHOBA       FPD------GQWVASAASVLATVLILAASWPLLRASLNFRANPN----------------
                                                                             

CYOE_XYLFT       ----PDELFAMKTFGYSIVYLMALFAFLMFDHWLRLADFYWN------------------
CYOE_ALCBS       ----EDPKLPMKTFGYSITYLFALFTALLVDHYLPVTPANVASWLGA-------------
CYOE_METCA       ----ADPRLAMQTFAYSLVYLVGIFSALLVDHYIVL------------------------
CYOE_NITOC       ----TSNELAMKTFGYSIVYLAALFAFLLVDHYLPKFL----------------------
CYOE_ALKEH       ----PGPRLPMRSFRFSIIYLFGLFAALLVDRQLPVWLGA--------------------
CYOE_COXBU       ----QRKEIPMRTFQYSIWYLMLLFTALLVDHYVYLALKLY-------------------
CYOE_LEGPL       ----DKPVVAMQTFRFSILYLMLLFVFLLVDHYF--------------------------
CYOE_HAHCH       ----SRKHAAIKTFRYSITYLMLLFVALLADHYIPVTLS---------------------
CYOE_MARHV       ----DDRRVALNTFKYSITYLMALFVVLLVDHFVFVPA----------------------
CYOE_PSEU5       ----SRPHAAIKTFKFSIWYLFALFIALLVDHYLLLDF----------------------
CYOE_SACD2       ----KNKNAGMDAFKYSIVYLMALFVVMLLDHYLLPTNIVS-------------------
CYOE_SHEON       ----DHEGLAMQVFRFSIYHLMLLFMALLLDHYLWA------------------------
CYOE_SHEAM       ----ETPGMAMDVFRFSIYHLMLLFILLLVDHYI--------------------------
CYOE_COLP3       ----AKEGTAMATFKFSIIHLMLLFIILLLDHYWLPMG----------------------
CYOE_IDILO       ----PSKKTAFNMFAFSIWHLMLLFVILLVDHYV--------------------------
CYOE2_PSEA6      ----SDEHTAMKTFKFSIIHLMVLFVVLLVDHYMRFTF----------------------
CYOE_PHOPR       ----DSKGHAWATFKYSIWHLLALFVVLLGDHWITSLMF---------------------
CYOE1_VIBPA      ----PEPNSAIETFKFSIYHLLALFVALLADHYIGMVLQ---------------------
CYOE_VIBVY       ----AEERTAIEMFRFSIYFLLLLFCALLLDQQLAL------------------------
CYOE2_PSEHT      ----ANDDTAMDLFRFSIIHLMVLFIILFIDKWLLL------------------------
CYOE_PSYIN       ----ETSYGALNLFKYSILHLTLLFIALFADKFLM-------------------------
CYOE_VESOH       ----DDKMVAWSTFMYSINYLMLLFIALLFDHYWLISPWEIL------------------
COXX_METPP       ----YSEALARRTFRFSIWHLSLLFAALLLDHYLGPLLRGTP------------------
COXX_LEPCP       ----YSEALARQTFRFSIWHLSLLFAALLVDHYTQDLLTL--------------------
COXX_POLSJ       ----YSDALARKTFRFSLIHLSVLFAALLLDHYLV-------------------------
COXX_BORA1       ----YSDERSRRLFRYSILYLALLFGALLVDHWVGVLSA---------------------
COXX_JANMA       ----YTDMIARKMFAYSIIYLSLLFAALLVDHYLRF------------------------
COXX_PARXL       ----YSDDLARKTFRYSIVYLSLLFAALLIDHYARV-LIGA-------------------
COXX_RALSO       ----YSDALAQKTFRYSIVYLSLLFAALLIDHYFKFGPQGAAL-----------------
COXX_POLAQ       ----YSDALAKKTFRFSITYLSLLFAALLIDHYFL-------------------------
COXX_AROAE       ----YSDAFARRTFRFSILYLFLLFAALLMDHYLPL------------------------
COXX_THIDA       ----YSDALARRTFRYSIWYLAALFAIMLLDHYFPIPV----------------------
COXX_NITEC       ----YTDQIAREAFRYSIIYLALLFTALLVDHYFYF------------------------
COXX_NITMU       ----YSDQLARSAFRYSILYLAGLFAVLLVDHYIRF------------------------
COXX1_CHRVO      ----YADALARRLFAWSIWYLTWLFAALLLDHYYLIPLN---------------------
COXX_DECAR       ----YSDALARRTFRYSILYLTLLFAALFADRLIVL------------------------
COXX_ACICJ       ---LTRDAPAKAAFKFSILYLFLIFGALVLDHLV--------------------------
COXX_GRABC       ---LTKDAPARAAFKYSLIYLAVLFLALAVDRFV--------------------------
COXX_GLUOX       ---LTKDKPARFAFRYSLVYLFLLFCGLLVDRVLIG------------------------
COXX_GLUDA       ---LTGDRPARRAFRYSLAYLFLLFCGLLADHFLIMR-----------------------
COXX_RHIL3       -----KMIPAKKLFGFSIFYLFAVFSALMIDRLAPVLVSHAGGWF---------------
COXX_AGRFC       -----KMLPAKKMFAYSVLYLFAIFSGLLADHFAPALKAVISGVL---------------
COXX_SINMW       -----RMVPAKKLFAFSIVYLFAIFSALLVDY--AIARIWFGGVI---------------
COXX2_RHILO      -----AMKPAKALFAYSLLYLFAIFAAYLADSVVERALAMGGA-----------------
COXX_CHESB       -----ALRPEKALFGYSVLYLFAIFAALLCDGLVERFGA---------------------
COXX1_RHILO      ------LKPAKALFAYSIVYLFAVFAALLADTIAMRALMSVGA-----------------
COXX_OCHA4       -----MLAAARKLFRFSLLYLSGLFAVLLVEALVMKALIAFGGF----------------
COXX_BART1       -----TILMAKKTFFFSLLYLAAVFGALLIESLVRYFIDL--------------------
COXX_BARBK       -----TVPIAKKTFFFSLFYLGAIFGILLIEFLIWHFIIR--------------------
COXX_NITHX       -----ALRATRRLFAFSILYLFALFAVLLLDVLAKAVAPLIW------------------
COXX_RHOPB       -----ALRASRSLFKFSILYLFALFAVLLLEVIVRGVIGALA------------------
COXX_AZOC5       -----AVTAAKKLFGFSILYLFLLFATLLAEALVRGM-----------------------
COXX_BEII9       -----ADRHAKALFGFSILYLFLLFAEIVVERLVPIVVAMGAWLTSGMFPGFFH------
COXX_METS4       -----ADKAAMGLFGFSILYLFLLFSALLAEQGLGLFRPVSQLFG---------------
COXX_METRJ       -----ERRAAMGMFGFSILYLFALFSALLAEQSFGLFRPVLG------------------
COXX_PARL1       -----QDKAAKRLFGYSILYLFLIFSLLLVEKMLGLGGTAFALAL---------------
COXX_DINSH       -----KYATEKRFFKFSLLYLALHFTALLAEAILTRSGLWTFGG----------------
COXX_RHOS5       -----RYRTEKGFFRFSLYYLFLHFGAILAEAALKPYGLGGW------------------
COXX_ROSDO       -----EYRVEKKFFRLSLWYLFAHFGAILLESALRPFGLGGW------------------
COXX_RUEST       -----NFKIERSFFKLSLLYLFLHFGAILAEALLKPYGLGGW------------------
COXX_PARDP       -----GYRVEKRYFRLSLYYTFLHFLALLVQ-----HWVGGW------------------
COXX_JANSC       -----GYAVEKKVFKFSLLYLFLHFGALLLDAIWRLI-----------------------
COXX_CAUSK       GKPVGDAKHARNLFAFSILYLFALFAALLAEAVLGLPILNLHVLELPL------------
COXX_HYPNA       GAPAGDMKLARTAFLFSILYLFALFGAVLVEHAAGLHFPVFGA-----------------
COXX_MARMM       AVRAGD-KAARDLFAYSIGYLTVLFAALIVEHAFGAYVAIPGVSP---------------
COXX_ERYLH       -----TMKPEKRLFGFSILYLFALFAALVADRYLTPLIESAA------------------
COXX_NOVAD       -----GMLPEKRLFGYSVLYLFVLFGMLVGDRLATVQGWQ--------------------
COXX_SPHAL       -----RMQPEKRLFAFSIAYLFILFGAVVADHWWPL------------------------
COXX_SPHWW       -----RMKAERRLFGFSILYLFLIFGLVVADKVLA-------------------------
COXX_NEOSM       -------KKCMKLFYYSVLYLFLLFGVFILDAALSTALGMLI------------------
COXX_ANAMM       ---------M-GLFKYSIYYLFLLFAVVIACVH---------------------------
COXX_ANAPZ       ---------M-GLFSFSIYYLFLIFSAIALCS----------------------------
COXX_EHRRW       ------------MFTYSIIYLFILFTCIMLSSF---------------------------
COXX_WOLTR       ------------MFSYSISYLFFLFASIILCSIDLF------------------------
COXX_RICPR       -----------RFFTYSIFYLCFIFILLSSTSTIHSLRDIIFG-----------------
COXX_RICBR       -----------RFFAYSIFYLFFIFLLLDFCRV---------------------------
COXX_ORITB       -----------KMFKYSIIYLFNIFLYLIIEYCIKRFIFLN-------------------
COXX_PELUB       ---------AKTIFGYSILYLFLIFVIFLIDKIL--------------------------
COXX_LEPIC       -------QSARKFFFFSILHLFIINITIVVDHLI--------------------------
COXX_LEPBP       -------VLAKRFFFFSILHLFLVSIAIVIDSKI--------------------------
COXX_PROMT       -------DRAKGLFRWSILYMFGVCFLLVISRLQVSIVFNDQLIALIKDFSTGFS-----
COXX_PROMA       -------QRAKGLFRWSILYMFGICLLLVVSRSTLADQFHNQAIYLFTNMGSVFSIA---
COXX_SYNSC       -------VNAKALFRWSILYLFGVCLLLILSRTDLASGFTHQVIQLLSLPTGVH------
COXX_PROMP       -------EKAKGLFRWSILYMFGICLLLLISRTQLSVDFEHQSMQMFLSLKAYFNY----
COXX_SYNR3       -------QRAKGLFRWSILYLFGICLLLLLARTTMAADFSNQLISLLTLPPASAF-----
COXX_FRASN       -------IKPMRLFHMSITYLTLLFAALAAAALL--------------------------
COXX_ACIC1       -------PRPMRLFHMSISYLTLLFVAVALAPYLP-------------------------
COXX_NOCSJ       -------IQPMRLFHSSNLYLSLLFVAVALDPLLAG------------------------
COXX_CUTAK       -------LKPMGLFHWSNTYLSLLFLAIAVDPLIHL------------------------
COXX_THEFY       -------LKTMGFFHLSNAYLALLFVAVTIDPLLANALR---------------------
COXX_ARTS2       --------GAMKVFHGSISYLTLLFIALAVDPFVGSAIMG--------------------
COXX_RENSM       --------SAMKVFHGSISYLTLLFVALAVDPFVGMPLMG--------------------
COXX_CLAMS       ---------PMRVFHASISYLSLLFLAVGIDPLLPF------------------------
COXX_LEIXX       ---------PMRVFHGSIAYLTLIFLAVAIDPLLPF------------------------
COXX_TROWT       ---------AMHIFSLSNTYLSLVFLSVGIDGVVSQLL----------------------
COXX_KINRD       TLEQLKRISPMGVFHGSITYLTLLSAAVAVDPFVRVGWPF--------------------
COXX_STRGG       ------KLKEMRLFHWSITYVSLLFLAVAVDPFLR-------------------------
COXX_CORDI       -------VKPLKLFILSNNYLAVYFVGLSIDAVLGWETIGGHLGWTTTFF----------
COXX_CORJK       -------VKPMQLFFLSNNYLSILFVALSVDAVLGWQTLAHAVLG---------------
COXX_MYCLE       -------VKPLRLFLQSNNYLAVVFCALAVDSVLALPTLF--------------------
COXX_MYCGI       -------VKPLRLFLQSNNYLAVVFVALAVDSALALPTLLHV------------------
COXX_NOCFA       -------VKPLRLFLQSNNYLAVVFCGLAVDSVLGWDTIGSFFG----------------
COXX_RHOJR       -------VKPLRLFLQSNNYLAVVFVGLAVDSVLGLQTVGSLLS----------------
COXX1_SACEN      -------YNPMKLFHLSNSYLALLFVAIAVDSAVGLPSFVA-------------------
COXX2_SACEN      -------TKPLKLFHLSNTYLMIVCVALAVDSALSLPVLGWPF-----------------
COXX_SALTO       -------VKPMRLFHWSTTYLTVVFAAVALDALI--------------------------
COXX_SYNY3       -------DLARGLFKFSIFYLMLLCLAMVIDSLPVTHQLVAQMGTLLLG-----------
COXX_SYNP2       -------SLAKSMFKYSILYMMLLCTAMVVDSLPAVHDVTALVTTTLASLT---------
COXX_MICAN       -------DIARSLFKYSILYMMLLCTAMVIDSLPMTSHLIATIASLFSCS----------
COXX_TRIV2       -------PTARELFLYSISYMMLLCLGMVIDSLPLTHHLINAVINQLHLIS---------
COXX_TRIEI       -------DVARSLFKYSIYYMMLLCLVMVIDSLPFTHGITTALADSWQTFIGGAIAILF-
COXX_THEEB       -------ERARRLFKFSILYMMLLCAAMVGDRL-----LLPHLSAGLNALGALLK-----
COXX_ACAM1       -------QMARSVFKFSILYMMLLCAGMGVDSLPWTQQIWHHSTHILQAWIPSIG-----
COXX_SYNJA       -------ERATSLFTFANLYLLLLCGAMGLDRWSLTHTLWDQALASLQGVYASLGALANH
COXX_SYNE7       -------PLARSLFKFSIFYLMLLCGAIAMDCLPGAPSLSQAIAAWPGF-----------
COXX_GLOVI       -------KESRSLFKRSIFYLMLLFVAMGIDSIFLFA-----------------------
COXX_DEIRA       -------KVAVPLYLYSMLYLALLFLAGAIDRAVLS------------------------
COXX_SYMTH       -------DWAHRTYGWSLLYLFVIFLAMMLDVTRA-------------------------
COXX_SULTO       ------D-EAWESFKLSSPYLAIILLTLIIVKLI--------------------------
COXX_SULAC       ------E-ESWISYKFSAPYLAIVMIAAVISFIL--------------------------
COXX_METS5       ------E-EAWRSFKFSSPYLAILLILIILTRLI--------------------------
COXX_SACS2       ------E-EAMKSFIFSNIYLMLILLSIIIIKLI--------------------------
COXX2_PICTO      ------KKDFKKAFHFSNMYMLMLLIGIMLILVKF-------------------------
COXX1_MAGSA      ------R-WAGWNFAASMPYLLLLFIAVFADKHW--------------------------
COXX2_MAGSA      ------K-AAMGNFFASLIQLVLLLTAVMVEPLLAG------------------------
COXX1_CENSY      ------D-FAWKAYKVTAPYLTIIFAAVALDAAFHYPFPFPF------------------
COXX_THEAC       ------RKNSLKLFIYSSPYLAIIFVLVLIFRFL--------------------------
COXX_THEVO       ------RKSSLKLFIYSSPYLAIIFVLVLIFKYL--------------------------
COXX1_PICTO      ------KKASMRLFIYTAPYLTFVFFIVMIIHIIEIIK----------------------
COXX2_CENSY      ------EKAAWVLFKFSSPYLAVLFIALMVDAGLRA------------------------
COXX_DESAP       ------RRKAWVLFKFSSPYLAVLFLSMMVDVWLR-------------------------
COXX_PYRNV       ------DRAMWRMYKASSPILTLFLLALVFS-----------------------------
COXX_PYRAR       ------DEAMWKMYKASSPVLTLFLLALIANA----------------------------
COXX2_PYRAE      ------EEAMWKMYKASSPMLTLFLIALMIQRYRL-------------------------
COXX1_PYRCJ      ------EGAMWKMYKSSAPVLTIFLVAVMLA-----------------------------
COXX2_PYRCJ      ------DDAFWKMFKASSPALALFLIALVLH-----------------------------
COXX_CALMQ       ------NESFRTMFKATSPILLLFLLAVIISRI---------------------------
COXX_KORCO       ------RGEARRMYKVASPVEGVIFLAIALDGIFRILWSS--------------------
COXX_ARCFU       ------RVKARKMYKLASMTLGLVYFSLLLGVFL--------------------------
COXX_AERPE       ------RREALKLFKFASPIIAVVFIILPLERTLVYTLLLG-------------------
COXX_HYPBU       ------PNYSRTAFKKTNMMLGLVFLVMMLEKVVSYIIS---------------------
COXX_THEPD       ------REKAYRAFKLVNIFMGLFFVLLVLT-----------------------------
COXX_FLAPJ       --KNKTDKSAKTLMLVSVAYISLIQVVYILDKFLR-------------------------
COXX_FLAJ1       --QLRTPKAARTLMLVSVSYISLLQIVFIVDKFLR-------------------------
COXX_GRAFK       --KEKTAEAAKKLMFASVSYITLLQIVYVLDKFIREWI----------------------
COXX_CYTH3       --KECSVKAALLLMFGSFLYLPIVQIAFVLDKIY--------------------------
COXX_GEOMG       -------RAEGALFSSLNLFPLLMVLALYLQR----------------------------
COXX_GEOSL       -------RSEATLFSCLNAFPPLMALALLLR-----------------------------
COXX_DESAG       -------ASPVRGFHAVNVSMLFVMLLLVVDRLVTSGIIT--------------------
COXX_DESVV       -------RKRRVALHIADAVLCAVMVVLLIDRLAIPVSLF--------------------
COXX_SOLUE       -ALERTLVRARGVLITSVLYLPLIYGLMLLDRPGL-------------------------
COXX_KORVE       PSSPHSKKYARQLLLASVTYLPLLFAVMMLDRTI--------------------------
COXX_SALRD       -HGERTGQKAKRVLKASVLYIPGLVALLLVDWFL--------------------------
COXX_OPITP       -QPATRDRAARKLFFASIGYLPLVLGALVIDRLFLVS-----------------------
COXX_ANADE       -----GGRWARTFFLGTLVHLTVLFVALFLSR----------------------------
COXX_ANADF       -----GGRWARNFFLATILYLTLLFVALFLGAR---------------------------
COXX_MYXXD       -----GNTWARQTFFFSLIYLTGLFAALALDRVPRE------------------------
COXX_SORC5       -----GARWARQVFFASMVYLVLLFAALMIGA----------------------------
COXX_GEOUR       ------NRRFQRAFQASIFYLLGLLSAVIIDICSRP------------------------
COXX_AQUAE       ------KEESMKLFFFSIIYLAVLFGTMIVDMVK--------------------------
CYOE_ECOLI       ------RIWARKLFGFSIIAITALSVMMSVDFMVPDSHTLLAAVW---------------
CYOE_PHOLL       ------RIWARKLFIFSIVAITSLSVMMSIDPHVP-SEAFLTYVR---------------
COXX_METFK       ------QIWAKKLFMFSIITITALSVMMSIDFKEPHKDGVWVAARMPSIIEHQVKVD---
CYOE_PSE14       ------TVWARKLFVFSIFTITALSVMMSVDFQVTKELLVTYAF----------------
CYOE_CHRSD       ------QVWAKKVFIFSIFTITALSIMMSIDFQVTETEVLMTSLR---------------
CYOE2_SHEWM      ------NQWARQVFGCSIVTITALSIAMAMDFQLVVQTPLLTLSN---------------
CYOE1_PSEA6      ------VVWARQVFGFSILTITALSIGMAFDFQALPPSLLVMLS----------------
CYOE2_SHELP      ------LRWSRQVFGFSILTIAILSLTMALDFQVAGQAPLLAMLG---------------
CYOE1_PSEHT      ------SGWARQVFAFSIINITALSIAMAVDYQSIAPQLLALN-----------------
CYOE_MARMS       ------NGWARQVFFFSIITVTALSVTMALDFNEVSPNLLVFAAH---------------
CYOE2_PSEA7      ------RLWARKLFAFSIVAITALSVMMSIDFQVAPATHLVASLP---------------
COXX2_CHRVO      ------RAWARQVFFFSIITITSLSVMMAVDGQTPPHSRAVMTADAGHYG----------
CYOE_ACIAD       ------QLWAKRLFLFSVILITLLSLSFSFTYQSPAPNLPLF------------------
CYOE2_VIBPA      ------VVWSKSVFKVSLLVVMGISGVLGVELIPLAL-----------------------
COXX_PARUW       ------QQWAQQMFRFSLVIISVLSLTIPFDLVN--------------------------
CYOE_BLOFL       ----NDLKWAKKMFILSIVIITSLNVLLSLDSIFIFY-----------------------
CYOE_BLOPB       ----HDSLWAKKMFLLSLIIIISLNLLLSLDHILFSTKNILL------------------
CYOE_BAUCH       ----NDILWSKKMFIFSIIAITSLSLMMSLDSIFSR------------------------
CYOE_WIGBR       ----NI-IWGRKIFLFSIVIITAISILISIDYKKNI------------------------
CYOE_BUCCC       ----TIKIWSRIMFFFSIFIIFMISFLMSLNNF---------------------------
CYOE_BUCAI       -----DKKNARKLFYFSIIVIVFFNFLISIDVFF--------------------------
CYOE_BUCAP       -----DRKFSSKLFYYSIAVVILFNFLISIDFIF--------------------------
CYOE_BUCBP       -----SKLWAKNIFRWSIIVIFLLNIIMLFGFV---------------------------
CYOE_FRATH       ------RVFAKTVFKFSIIVITAICLTMG-------------------------------
COXX1_BACVZ      ----DDTQWSKGMFFYSIVYFSLLFLILMADSFINAVLRT--------------------
COXX1_BACSU      ----DDVKWAKDMFVYSLIYFCLLFFIMMIDSFMMFLIR---------------------
COXX_BACLD       ----NIMKWATLMFVYSLNYLTIFFVAMVVFTLFKIG-----------------------
COXX_BACP2       ----DVMKWSTLMFVYSLNYLTIFFVAMIIITLF--------------------------
COXX_GEOTN       ----DDIKWAKLMFVYSLNYLTILFVAMVIATIW--------------------------
COXX2_BACCN      ----DDIKWSVQMFVYSLNYLTILFVSMIVVTFF--------------------------
COXX_BACPE       ----DDIKWARLMFVYSLNYLTILFVLMVIVHF---------------------------
COXX_LISIN       ----DSIKWAKWMFVYSLNYMTILFVAMVVISIFL-------------------------
COXX1_LYSSC      ----DDMKWANRMFIYSLNHMTILFVSIIIFAVFS-------------------------
COXX_OCEIH       ----EDKKWANTIFIFSLNYLIILFPLMIIVKLPIFS-----------------------
COXX_STAS1       ----DQTKWATKMFIYSLNYLVVFFVLVVVISLIQMF-----------------------
COXX1_BACCN      ----DSEKWAKSLFIFSLFHMTILFSTVIIYSLVGIFFGS--------------------
COXX2_LYSSC      ----DQVKWATKMFVFSLFHMTILFTTVIVYSLVGVIFKLY-------------------
COXX_BACSK       ----EPKKWATLMFVFSLNYLTILFTVIIGFSLLSPLF----------------------
COXX_EXIS2       ----AEIKWASKMFFFSLFYFTAWIVTVVLVSL---------------------------
COXX_BDEBA       ------TERWLAFFMWLNVSMLVFIIIPVIDKWNFLFIHHN-------------------
COXX_RHOBA       ------DKTARKMLRWSLVVLPAVLLVMTLRASL--------------------------
                                                                             

CYOE_XYLFT       --------
CYOE_ALCBS       --------
CYOE_METCA       --------
CYOE_NITOC       --------
CYOE_ALKEH       --------
CYOE_COXBU       --------
CYOE_LEGPL       --------
CYOE_HAHCH       --------
CYOE_MARHV       --------
CYOE_PSEU5       --------
CYOE_SACD2       --------
CYOE_SHEON       --------
CYOE_SHEAM       --------
CYOE_COLP3       --------
CYOE_IDILO       --------
CYOE2_PSEA6      --------
CYOE_PHOPR       --------
CYOE1_VIBPA      --------
CYOE_VIBVY       --------
CYOE2_PSEHT      --------
CYOE_PSYIN       --------
CYOE_VESOH       --------
COXX_METPP       --------
COXX_LEPCP       --------
COXX_POLSJ       --------
COXX_BORA1       --------
COXX_JANMA       --------
COXX_PARXL       --------
COXX_RALSO       --------
COXX_POLAQ       --------
COXX_AROAE       --------
COXX_THIDA       --------
COXX_NITEC       --------
COXX_NITMU       --------
COXX1_CHRVO      --------
COXX_DECAR       --------
COXX_ACICJ       --------
COXX_GRABC       --------
COXX_GLUOX       --------
COXX_GLUDA       --------
COXX_RHIL3       --------
COXX_AGRFC       --------
COXX_SINMW       --------
COXX2_RHILO      --------
COXX_CHESB       --------
COXX1_RHILO      --------
COXX_OCHA4       --------
COXX_BART1       --------
COXX_BARBK       --------
COXX_NITHX       --------
COXX_RHOPB       --------
COXX_AZOC5       --------
COXX_BEII9       --------
COXX_METS4       --------
COXX_METRJ       --------
COXX_PARL1       --------
COXX_DINSH       --------
COXX_RHOS5       --------
COXX_ROSDO       --------
COXX_RUEST       --------
COXX_PARDP       --------
COXX_JANSC       --------
COXX_CAUSK       --------
COXX_HYPNA       --------
COXX_MARMM       --------
COXX_ERYLH       --------
COXX_NOVAD       --------
COXX_SPHAL       --------
COXX_SPHWW       --------
COXX_NEOSM       --------
COXX_ANAMM       --------
COXX_ANAPZ       --------
COXX_EHRRW       --------
COXX_WOLTR       --------
COXX_RICPR       --------
COXX_RICBR       --------
COXX_ORITB       --------
COXX_PELUB       --------
COXX_LEPIC       --------
COXX_LEPBP       --------
COXX_PROMT       --------
COXX_PROMA       --------
COXX_SYNSC       --------
COXX_PROMP       --------
COXX_SYNR3       --------
COXX_FRASN       --------
COXX_ACIC1       --------
COXX_NOCSJ       --------
COXX_CUTAK       --------
COXX_THEFY       --------
COXX_ARTS2       --------
COXX_RENSM       --------
COXX_CLAMS       --------
COXX_LEIXX       --------
COXX_TROWT       --------
COXX_KINRD       --------
COXX_STRGG       --------
COXX_CORDI       --------
COXX_CORJK       --------
COXX_MYCLE       --------
COXX_MYCGI       --------
COXX_NOCFA       --------
COXX_RHOJR       --------
COXX1_SACEN      --------
COXX2_SACEN      --------
COXX_SALTO       --------
COXX_SYNY3       --------
COXX_SYNP2       --------
COXX_MICAN       --------
COXX_TRIV2       --------
COXX_TRIEI       --------
COXX_THEEB       --------
COXX_ACAM1       --------
COXX_SYNJA       LGAMGSLG
COXX_SYNE7       --------
COXX_GLOVI       --------
COXX_DEIRA       --------
COXX_SYMTH       --------
COXX_SULTO       --------
COXX_SULAC       --------
COXX_METS5       --------
COXX_SACS2       --------
COXX2_PICTO      --------
COXX1_MAGSA      --------
COXX2_MAGSA      --------
COXX1_CENSY      --------
COXX_THEAC       --------
COXX_THEVO       --------
COXX1_PICTO      --------
COXX2_CENSY      --------
COXX_DESAP       --------
COXX_PYRNV       --------
COXX_PYRAR       --------
COXX2_PYRAE      --------
COXX1_PYRCJ      --------
COXX2_PYRCJ      --------
COXX_CALMQ       --------
COXX_KORCO       --------
COXX_ARCFU       --------
COXX_AERPE       --------
COXX_HYPBU       --------
COXX_THEPD       --------
COXX_FLAPJ       --------
COXX_FLAJ1       --------
COXX_GRAFK       --------
COXX_CYTH3       --------
COXX_GEOMG       --------
COXX_GEOSL       --------
COXX_DESAG       --------
COXX_DESVV       --------
COXX_SOLUE       --------
COXX_KORVE       --------
COXX_SALRD       --------
COXX_OPITP       --------
COXX_ANADE       --------
COXX_ANADF       --------
COXX_MYXXD       --------
COXX_SORC5       --------
COXX_GEOUR       --------
COXX_AQUAE       --------
CYOE_ECOLI       --------
CYOE_PHOLL       --------
COXX_METFK       --------
CYOE_PSE14       --------
CYOE_CHRSD       --------
CYOE2_SHEWM      --------
CYOE1_PSEA6      --------
CYOE2_SHELP      --------
CYOE1_PSEHT      --------
CYOE_MARMS       --------
CYOE2_PSEA7      --------
COXX2_CHRVO      --------
CYOE_ACIAD       --------
CYOE2_VIBPA      --------
COXX_PARUW       --------
CYOE_BLOFL       --------
CYOE_BLOPB       --------
CYOE_BAUCH       --------
CYOE_WIGBR       --------
CYOE_BUCCC       --------
CYOE_BUCAI       --------
CYOE_BUCAP       --------
CYOE_BUCBP       --------
CYOE_FRATH       --------
COXX1_BACVZ      --------
COXX1_BACSU      --------
COXX_BACLD       --------
COXX_BACP2       --------
COXX_GEOTN       --------
COXX2_BACCN      --------
COXX_BACPE       --------
COXX_LISIN       --------
COXX1_LYSSC      --------
COXX_OCEIH       --------
COXX_STAS1       --------
COXX1_BACCN      --------
COXX2_LYSSC      --------
COXX_BACSK       --------
COXX_EXIS2       --------
COXX_BDEBA       --------
COXX_RHOBA       --------