CLUSTAL format seed alignment for MF_00155

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

COXZ_CHESB      -----MTSPANPSE------------VTRDRRNRGVAFVCAGVFVAMVGMSFAAVPLYRL
COXZ_RHILO      -----MSKKP-----------------AGKNSNRIVAAVCLAFFTGMIGMAYAAVPLYKM
COXZ_BRUME      -----MTDQGE-NE------------KKQRRSNATIAVACLSFFVCMIGAAYASVPLYRI
COXZ_BRUO2      -----MTDQGE-NE------------KKQRRSNATIAVACLSFFVCMIGAAYASVPLYRI
COXZ_BRUSU      -----MTDQGE-NE------------KKQRRSNATIAVACLSFFVCMIGAAYASVPLYRI
COXZ_RHIEC      -----MSDKAA-AP------------RKQGRNNGAVVMMCLSFVFGMGAMSYAAVPLYRI
COXZ_RHIL3      -----MSENAG-TP------------KKQGRNNGAVVMMCLSFVFGMGAMSYAAVPLYRI
COXZ_AGRFC      -----MEAETA-RA------------GSQRVSNRSILVLCLVFFCAMIGMAYAAVPLYSL
COXZ_RHIME      -----MADNGQ-AD------------RKE-RSNGVIVGTCLAFVAGMIGMAYAAVPLYDM
COXZ_RHOPS      -----MPEVQPSAL--PKP-------APRLGRDAAVASICGFVVALMVGASFAAVPFYDW
COXZ_RHOPB      -----MTEQPTNRN--DVP-------RRGLGRDATVASICGLVVALMVGASYAAVPFYNW
COXZ_BRADU      -----MDHEPTISR--DQSRTARKGVGKGLGRDVLVASICGGVVALMVGASYAAVPFYNW
COXZ_BRASO      MDATDQGKSTSTTA--AQAAPGKAAPRRGIGRDALVGGICGAVVVLMIGASYAAVPFYNW
COXZ_NITHX      -----MTDAPQHPQQPATGTPATPKAAPRVGRDVRIGATCGLLVALMVGAAYAAVPFYNW
COXZ_RHOS1      -----MSLSPHQ----------------------KTAGGLVLVVAVMGAASFAAVPFYNW
COXZ_CERS4      -----MSLSPHQ----------------------KTAGGLVLVVAVMGAASFAAVPFYNW
COXZ_RUEST      -----MALNGPQ----------------------KTVVQLVGVVVLMGGLAWASVPFYDW
COXZ_RUEPO      -----MALNGPQ----------------------KTVVQLVSVVVVMGGLAWASVPFYDW
COXZ_ROSDO      -----MALRGPA----------------------KTVAQTVSVVIFMGALAWASVPLYDW
COXZ_PARDP      -----MSGGKPRSN-------------------TRTVAMLAGVVVLMGALSWAAVPFYSW
COXZ_EHRRG      -----MTQKA-----------------------KNTIYLLILIILSMLCLVYASVPLYSI
COXZ_EHRRW      -----MTQKA-----------------------KNTIYLLILIILSMLCLVYASVPLYSI
COXZ_EHRRU      -----MTQKA-----------------------KNTIYLLILIILSMLCLVYASVPLYSI
COXZ_RICCN      -----MSKKSN----------------------KNLAFSLLGLIISMVLLSFASVPIYNL
COXZ_RICFE      -----MSKKSN----------------------KNLAFSLLGLIISMVLLSFASVPIYNL
COXZ_RICPR      -----MSKKSN----------------------KNLAFSLLGLMMSMVLLSFASVPIYNL
COXZ_RICBR      -----MSKKSN----------------------KSLAFSLLGLIVSMVLLSFAAVPLYNL
                                                          ..  *    :*:**:*  

COXZ_CHESB      FCQVTGYGGTTQRVE-QYSDTILDRT-INVRFDANTS-GVPWEFKPKQREITLRIGETTE
COXZ_RHILO      FCQATGYGGTTQRVEKQYAGRVLDRE-ITVRFDANIA-GVPWEFQPVQRSMTMKIGETVQ
COXZ_BRUME      FCQVTGYGGTTQRVE-QYSDTILDKT-IKVRFDANIANGLPWDFKPMQREVTVRIGETTM
COXZ_BRUO2      FCQVTGYGGTTQRVE-QYSNTILDKT-IKVRFDANIANGLPWDFKPMQREVTVRIGETTM
COXZ_BRUSU      FCQVTGYGGTTQRVE-QYSDTILDKT-IKVRFDANIANGLPWDFKPMQREVTVRIGETTM
COXZ_RHIEC      FCQVTGYNGTTQRVE-QMSSVVLDRK-MRVTFDANVAPGLQWNFKPVEREVNPKIGETIQ
COXZ_RHIL3      FCQVTGYNGTTQRVD-QVSSVVLDRT-MRVTFDANVAPGLQWDFKPVEREVNPKIGETIQ
COXZ_AGRFC      FCRVTGYNGTTQRVE-QYSDVILDKT-INVTFDANTSNGLNWDFRPVDKMVKPKIGETIK
COXZ_RHIME      FCRVTGYNGTTQRVE-QASDLILDEK-IKVTFDANVAAGLPWEFVPVQRDIDVRIGETVQ
COXZ_RHOPS      FCRTTGFNGTTQVAGSAPSSEPLARK-VSVRFDSNIN-GLPWKFEPEQREVEVAIGQVVT
COXZ_RHOPB      FCRATGFNGTTQVATAAPIAAPLPRK-ITVRFDSNVN-GLPWKFTPEQTEIEIPIGQVVT
COXZ_BRADU      FCRATGFNGTTQVATAAPATGPIARK-IAVRFDSNVAPGLPWKFEPEQSEIEVNIGQVTT
COXZ_BRASO      FCRATGFNGTTQVATAAPSAAPLARR-IGVRFDANVAGGLPWKFEPEKTEIEVAIGEVVT
COXZ_NITHX      FCRATGFNGTTQVAKVAPSAAPLART-VAVRFDSNISGGLPWKFEPEQTEINVRIGEVAT
COXZ_RHOS1      FCRVTGFAGTTAVAT-EAPAEVLDRT-VKVRFDASREAGMPWEFRPLQREMELKIGETGL
COXZ_CERS4      FCRVTGFAGTTAVAT-EAPAEVLDRT-VKVRFDASREAGMPWEFRPLQREMKLKIGETGL
COXZ_RUEST      FCRVTGFGGVTQVAE-TGSDQVLDQT-IKVRFDASKDRGMPWEFKPVERIMELKIGETGL
COXZ_RUEPO      FCRVTGFGGATGVAE-AGSDTILDKT-IKVRFDASKERGMPWEFRPVQTEMELRIGETGL
COXZ_ROSDO      FCRVTGFGGVTGVSD-VAPEDILDQT-ITIRFDGSLNNHMPWEFKPVVREMDVRIGESGL
COXZ_PARDP      FCKVTGFAGTTNVAE-AASDTVLDEK-IRVRFDANADSNLGWTFRPMQREMELKIGENAI
COXZ_EHRRG      FCKVTGYGGTVRTATVT--QSKLGKTTIKIRFNADINKELPWKFYPEIPYTTVKPGEQKL
COXZ_EHRRW      FCKVTGYGGTVRTATAT--QSKLGKTTIKIRFNADINKELPWKFYPEIPYTTVKPGEQKL
COXZ_EHRRU      FCKVTGYGGTVRTTTVT--QSKLGKTTIKIRFNADINKELPWKFYPEIPYTTVKPGEQKL
COXZ_RICCN      FCKVTGYGGTTAKETVSVYSKVKGTKPIIIEFDANVDKDLPWRFIPRQQRVQIVPGQNTL
COXZ_RICFE      FCKVTGYGGTTAKETVSVYSKVKGTKPIIIEFDANVDKDLPWRFIPRQQRVQIVPGQNTL
COXZ_RICPR      FCKVTGYGGTTIKETVSVYSKVKGTKAIIIEFDANVDPNLPWHFIPRQKRVQIVPGQNTL
COXZ_RICBR      FCKVTGYGGTTNRETVSIYSKVKGTRPIIIEFDANVDKNLPWRFIPRQQRVQIVPGQNTL
                **:.**: *..                : : *:..    : * * *         *:   

COXZ_CHESB      IAYVARNNAPTTTTGTATYNVAPALAGAYFNKIECFCFTKQSLEPGQTYEMPVQFFVDPE
COXZ_RHILO      AHYQATNKFDRPVTGRATFNVQPELAGPYFNKVECFCFTDTSLKPGETVDMPVLFYVDPD
COXZ_BRUME      IKYEAHNLFGEETYGRASFNVAPGRAGAYFNKVECFCFTDNTLKPGEDLELPVVFFVDPE
COXZ_BRUO2      IKYEAHNLFGEETYGRASFNVAPGRAGAYFNKVECFCFTDNTLKPGEDLELPVVFFVDPE
COXZ_BRUSU      IKYEAHNLFGEETYGRASFNVAPGRAGAYFNKVECFCFTDNTLKPGEDLELPVVFFVDPE
COXZ_RHIEC      VNFVAENKSNETQRGQAVFNVTPGEAGAYFNKVQCFCFTETDLKPGEKLEMPVVFYIDPE
COXZ_RHIL3      VNFTAENRSNETQRGQAVFNVTPGEAGVYFNKVQCFCFTETDLKPGEKLDMPVVFYIDPE
COXZ_AGRFC      VTFKATNRSPVATTGTAVFNVTPMEAGAYFNKVECFCFTETTLQPGETLEMPVVFFVDPD
COXZ_RHIME      IMYRAKNLASTPTTGQATFNVTPMAAGAYFNKVQCFCFTETTLEPGEEMEMPVVFFVDPE
COXZ_RHOPS      VYYSVTNTSKRATTGQAAYNVTPLTVGSYFTKINCFCFTEQTLAAGETREMPVVFYVDPA
COXZ_RHOPB      VFYTVTNLSAHETTGQAAYNVAPLTVGAYFQKINCFCFTEQTFAAGETREMPVVFYVDPA
COXZ_BRADU      VFYTVTNQAARTTAGQAAYNVAPLTVGSYFQKINCFCFTEQTMAPGEKREMPVVFYVDPS
COXZ_BRASO      VYYTVTNQSARTTMAQAAYNVTPLTSGAYFQKINCFCFTEQTMAPGETREMPVVFYVDPA
COXZ_NITHX      VYYTVTNHAATATTGQAAYNVTPLTVGSYFTKINCFCFTEQTLAPGEKREMAVVFYVDPS
COXZ_RHOS1      AFYEAYNPTDRTVAGTASYNVTPDAAGGYFAKIACFCFTEQVLAPGERVEMPVTFYVDPA
COXZ_CERS4      AFYEAYNPTDRTVAGTASYNVTPDAAGGYFAKIACFCFTEQVLAPGERVEMPVTFYVDPA
COXZ_RUEST      AFYEAYNPTDRPVAGQASYNVAPFSAGYYFDKIQCFCFNEQVLQPGERVMMPVTFFVDPE
COXZ_RUEPO      AFYEAYNPTDRPVAGQASYNVAPYSAGGYFDKIACFCFEEQVLQPGERVQMPVTFFVDPE
COXZ_ROSDO      AFYEAYNPTDRPVAGSASYNVTPYQAGGFFNKIQCFCFEEQVLQPGERVQMPVTFYVDPE
COXZ_PARDP      AFYEAINNTDEPVTGTASYNVAPDAAGYFFNKIECFCFTEQTLQPGERVEMPVSFFVDAD
COXZ_EHRRG      IFYRAENLTNEYVSGMAVYNVTPYKVGKYFNKVACFCFTKQTLSPYQKTIMPVSFFIDPN
COXZ_EHRRW      IFYRAENLTNEYVSGMAVYNVTPYKVGKYFNKVACFCFTKQTLSPYQKTIMPVSFFIDPN
COXZ_EHRRU      IFYRAENLTNEYVSGMAVYNVTPYKVGKYFNKVACFCFTKQTLSPYQKTIMPVSFFIDQV
COXZ_RICCN      VFYETENLSDNDIIGTSVYNVTPNKAGKYFVKIHCFCFEEQLLKAGERVLMPVTFYIDKD
COXZ_RICFE      VFYETENLSNNDIIGTSVYNVTPNKAGKYFVKIHCFCFEEQLLKADEKVLMPVTFYIDKD
COXZ_RICPR      VFYEAENLSNKDIIGTSIYNVTPNKAGKYFVKIHCFCFEEQLLKAREKVLMPVTFYIDND
COXZ_RICBR      VFYETENLSDNDIIGTSIYNVTPNKAGKYFVKIHCFCFEEQLLKAGEKVLMPVTFYIDKD
                  : . *       . : :** *   * :* *: **** .  : . :   :.* *::*  

COXZ_CHESB      IVNVPELKNLKTITLSYTFYP---NNQESA--EGPAEGAAK-----TQKLGG
COXZ_RHILO      IVNVPELKDVKTITLSYTMFPVEKNKPVAS--SEPVQGTSKIISDTEANLGG
COXZ_BRUME      FVNDPDLKDVKTITLSYTFFPIDKPKPVVN--AKAVGSTRN---------GG
COXZ_BRUO2      FVNDPDLKDVKTITLSYTFFPIDKPKPVVN--AKAVGSTRN---------GG
COXZ_BRUSU      FVNDPDLKDVKTITLSYTFFPIDKPRPVVN--AKAVGSTRN---------GG
COXZ_RHIEC      IVKAVESKDIHTVTLSYTFYPKEGPKPVASNEGGTVKIEKKL----------
COXZ_RHIL3      IVKAVESKNIHTVTLSYTFYPKEGPKPVASNEGGAEKIEKKL----------
COXZ_AGRFC      IATARETKSVHTLTLSYTFYPAKTEKPVASLPVKTESGDSKL----------
COXZ_RHIME      IVKPVETQGIKTLTLSYTFYPREPSKPVAQVKAKA---ENKL----------
COXZ_RHOPS      FAADNENDTVKNITLSYTFYPVREPPPKPLASGEPDQRKGNL----------
COXZ_RHOPB      LAADPENDGLNSITLSYTFYPVRAPTPKPVAAGEPDSRKGAL----------
COXZ_BRADU      IADDHENDGLSTITLSYTFYPVKDPVVKPLASGEGDKRKGNL----------
COXZ_BRASO      ITADHENDGLNTITLSYTFYPVRDAAPKPVAAGEPDKPRGSL----------
COXZ_NITHX      FAADSENDGVRTITLSYTFFPVKDAAPKPVAASEPDRPGGSI----------
COXZ_RHOS1      IIDDPDGRYVRQITLSYTFHETALTEEQA-ALAAESATDVN-----------
COXZ_CERS4      IIDDPDGRYVRQITLSYTFHETALTEEQA-ALAAESATDVN-----------
COXZ_RUEST      IIEDPEAKYVHTITLSYTFHEIDLPEGYA-ALDTGDTSGAETELN-------
COXZ_RUEPO      IVNDRDAKYVHTITLSYTFYEIDLPEGYA-ALDAGEKTNTN-----------
COXZ_ROSDO      IVDDRDGKHVHTITLSYTFYEIDLPEEYADAQDIEENSDTSLN---------
COXZ_PARDP      LVNDRDAGRIRDITLSYTFHRTDPPAPKQAALDAKTEPTVN-----------
COXZ_EHRRG      IETDPETSDVKLITLSYTFFKYKETTK-------------------------
COXZ_EHRRW      IETDPETSDVKLITLSYTFFKYKENTK-------------------------
COXZ_EHRRU      YIN-------------------------------------------------
COXZ_RICCN      FELDPEMQDIKVLTLSYSFFKVREMSSLRGNYVSN-----------------
COXZ_RICFE      FELDPEMQDIKVLTLSYSFFKVREIASLRGNTKY------------------
COXZ_RICPR      FERDPEMENIKVITLSYSFFKIREL---------------------------
COXZ_RICBR      FENDPEMRDVKVLTLSYSFFKVRDVKK-------------------------