CLUSTAL format seed alignment for MF_00156

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

PANB_ECOK1       ------------------------------------------------MKPTTIASLQKC
PANB_ECOUT       ------------------------------------------------MKPTTIASLQKC
PANB_ECOL6       ------------------------------------------------MKPTTIASLQKC
PANB_ECOL5       ------------------------------------------------MKPTTIASLQKC
PANB_SHIBS       ------------------------------------------------MKPTTIASLQKC
PANB_SHISS       ------------------------------------------------MKPTTIASLQKC
PANB_SHIFL       ------------------------------------------------MKPTTIASLQKY
PANB_SHIF8       ------------------------------------------------MKPTTIASLQKY
PANB_ECOLI       ------------------------------------------------MKPTTISLLQKY
PANB_ECO57       ------------------------------------------------MKPTTIASLQKC
PANB_SHIDS       ------------------------------------------------MKPTTIASLQKC
PANB_SALTY       ------------------------------------------------MKPTTISLLQKC
PANB_SALPA       ------------------------------------------------MKPTTISLLQKC
PANB_SALCH       ------------------------------------------------MKPTTISLLQKC
PANB_SALTI       -----------------------------------------------MSKPTTIAVLQKC
PANB_YERPA       ------------------------------------------------MKTTTMSQLRQW
PANB_YERPN       ------------------------------------------------MKTTTMSQLRQW
PANB_YERPP       ------------------------------------------------MKTTTMSQLRQW
PANB_YERPE       ------------------------------------------------MKTTTMSQLRQW
PANB_YERPS       ------------------------------------------------MKTTTMSQLRQW
PANB_YERE8       ------------------------------------------------MKATTMSHLRQW
PANB_PECAS       ------------------------------------------------MKPTTISHLRQW
PANB_SODGM       --------------------------------------------------MTTISHLRKW
PANB_BAUCH       ------------------------------------------------MNITTISHLRKY
PANB_PHOLL       ------------------------------------------------MKPMTMTDLNQL
PANB_PHOPR       ------------------------------------------------MKKITINDLMTW
PANB1_ALIF1      ------------------------------------------------MKKISIHDLMKW
PANB_VIBVU       ------------------------------------------------MKKITINDLIKW
PANB_VIBVY       ------------------------------------------------MKKITINDLIKW
PANB_VIBPA       ------------------------------------------------MKKMTINDLIKW
PANB_VIBCH       ------------------------------------------------MKKITINDLMKW
PANB2_ALIF1      ------------------------------------------------MKKITISDLNNW
PANB_SHEON       ------------------------------------------------MSKVTSSTLLKY
PANB_SHESA       ------------------------------------------------MSKVTSSTLLKY
PANB_SHESM       ------------------------------------------------MSKVTSSTLLKY
PANB_SHESR       ------------------------------------------------MSKVTSSTLLKY
PANB_SHESW       ------------------------------------------------MSKITSSTLLKY
PANB_SHELP       ------------------------------------------------MSKITSSTLLKF
PANB_SHEAM       ------------------------------------------------MSKVTTSTLMKF
PANB_SHEFN       ------------------------------------------------MSKVTSSTLIKF
PANB_SHEDO       ------------------------------------------------MSKVTSSTLLKF
PANB_COLP3       ------------------------------------------------MAKITTASLLNM
PANB_AERHH       ------------------------------------------------MSKITTTNLLKM
PANB_AERS4       ------------------------------------------------MSKITTASLLKM
PANB_PSEA6       ------------------------------------------------MKKVTTSTLLKM
PANB_PSYIN       ------------------------------------------------MAKISVSRLTKM
PANB_PSET1       ------------------------------------------------MSKITVSTLNKM
PANB_IDILO       ----------------------------------------------MATTKTSIATLQKM
PANB_BUCAI       ------------------------------------------------MESITISQLKNW
PANB_BUCAP       ------------------------------------------------MESITISKIQNW
PANB_WIGBR       ------------------------------------------------MKKTNIYDLYKL
PANB2_PSEAE      ------------------------------------------------MPDVTLTTLQGL
PANB2_PSEAB      ------------------------------------------------MPDVTLTTLQGL
PANB_PSEPK       ------------------------------------------------MPEVTLTTLNGL
PANB2_PSEE4      ------------------------------------------------MPEVTLTTLNGL
PANB_PSE14       ------------------------------------------------MPNITVTSLLAM
PANB_PSEU2       ------------------------------------------------MPNITVTSLLAM
PANB_PSESM       ------------------------------------------------MPNITVTSLLAM
PANB2_PSEF5      ------------------------------------------------MPDITLTTLQSL
PANB_PSEPF       ------------------------------------------------MPAITLTTLQSL
PANB_PSEU5       ------------------------------------------------MPDVTLTTLQGL
PANB_MARHV       -------------------------------------------------MAVTINTLREY
PANB2_HAHCH      -------------------------------------------------MSITLSTLLDL
PANB_ALCBS       -------------------------------------------------MSITIRTLQKR
PANB_PSYA2       --------------------------------------------------MTTLSTLNKF
PANB_PSYCK       --------------------------------------------------MTTLSTLNKF
PANB_ACIAD       --------------------------------------------------MISLSDLRKF
PANB_CHRSD       ------------------------------------------------MKTVTLSRLNAF
PANB_SACD2       ----------------------------------------MVYTATPLEKKVTVNTLRKM
PANB_NEIMB       --------------------------------------------------MITVNTLQKM
PANB_NEIMF       --------------------------------------------------MITVNTLQKM
PANB_NEIMA       --------------------------------------------------MITVNTLQKM
PANB_NEIG1       --------------------------------------------------MITVNTLQKM
PANB_CHRVO       ------------------------------------------M-------KITVNTLHKL
PANB_BURMA       ---------------------------------MTYLQESSRP-------AVTVPKLQAM
PANB_BURPS       ---------------------------------MTYLQESSRP-------AVTVPKLQAM
PANB_BURP0       ---------------------------------MTYLQESSRP-------AVTVPKLQAM
PANB_BURP1       ---------------------------------MTYLQESSRP-------AVTVPKLQAM
PANB_BURTA       ---------------------------------MTYLQESSRP-------AVTVPKLQAM
PANB_BURCA       ---------------------------------MTYLQESSRP-------AVTVPKLQAM
PANB1_BURCH      ---------------------------------MTYLQESSRP-------AVTVPKLQAM
PANB1_BURCM      ---------------------------------MTYLQESSRP-------AVTVPKLQAM
PANB2_BURL3      ---------------------------------MTYLQESSRP-------AVTVPKLQAM
PANB_PARXL       ---------------------------------MTYLQEASRN-------AVTVPKLQAM
PANB_CUPNH       ---------------------------------MSYLLDPSRK-------TITIPKLQAM
PANB_CUPPJ       ---------------------------------MSYLLDPSRK-------TVTITRLQAM
PANB_CUPMC       ---------------------------------MSYLLDPSRK-------TVTIPKLQAM
PANB_RALSO       --------------------------------MSSYLQESTRK-------AVTVTSLQGM
PANB_NITEU       ----------------------------------MDQSAAKR---------MTITTLQNA
PANB_NITEC       ----------------------------------MDRPVTKR---------ITVLTLQNI
PANB_NITMU       ----------------------------------------MR---------ITQDVFQKM
PANB_DECAR       ---------------------------------MSAQVATRR---------LTQADLAKL
PANB_METFK       ---------------------------------------------------MNLLTLQQM
PANB_AZOSB       ---------------------------------MSYLQDDKP---------VTLFELGKM
PANB_AROAE       ---------------------------------MSYLQDDKP---------VTLFEIGKM
PANB_THIDA       ----------------------------------------MP---------VTLSTLKAL
PANB_ACIAC       ---------------MTAPTPTPANAATPYGTLPPASPLPQRR-------PVSLPRLAQM
PANB_ACISJ       -------------------MTDSPTAGTPYGTLPPASPLPQRR-------PVSLPRLAQM
PANB_VEREI       ------------------MPASAAPCAAPYGTPSPAAPEGAHTAAAGRGAPVSLPRLAQL
PANB_POLNA       ---------------MSQAPS-ESLSATAYGTLPPASTPSARK-------PLSLPRLREM
PANB_POLSJ       -----------MTPANAPAPSPATPSATPYGTLPPAATPSARK-------PLSLPRLREM
PANB_RHOFT       -----------------MSASAESTNATPYGTLPPTAAASARK-------PISLPRLLEM
PANB1_ZYMMO      ----------MNQHGRSAEPGVASEGIAPYGDAHRGIAAKRKK--------TTTARISQM
PANB2_METPP      ----------------------------MSSHSSPADTPSARK-------PVTLHTLREM
PANB_XANAC       ---------------------------------MSSHADSKP---------WTVPALAQA
PANB_XANC5       ---------------------------------MSSHADSKP---------WTVPALAQA
PANB_XANOM       ---------------------------------MSSHADSNP---------WTVPALAQA
PANB_XANOR       ---------------------------------MSSHADSNP---------WTVPALAQA
PANB_XANCP       ---------------------------------MSSHADSKP---------WTVPALAQA
PANB_XANC8       ---------------------------------MSSHADSKP---------WTVPALAQA
PANB_XYLFA       ---------------------------------MSIYTNSKP---------WTVPALAEA
PANB_XYLFT       ---------------------------------MSIYTNSKP---------WTVPALAEA
PANB_RUTMC       ---------------------------------------------------MNIEALNNF
PANB_VESOH       ---------------------------------------------------MNIEALKVF
PANB_ALKEH       --------------------------------------MYTGD-PPQTRRPVTVGRLQRM
PANB_HALHL       --------------------------------------MSSGDRKHASGGAVTVSRMRAM
PANB_NITOC       ------------------------------------------------MGRLTLTKLQKM
PANB_HYDCU       ---------------------------------------------------MTLTKLHKM
PANB_METCA       -----------------------------------------------MTDPVTLPDLLAM
PANB_ANADE       -----------------------------------------MSSHPPPRKHVNIHELRRM
PANB_MYXXD       -----------------------------------------------MKDKVTIHTLKRF
PANB_MAGMM       -----------------------------------------------MKKRVRVPDLVRM
PANB_CAMJE       -------------------------------------------------MRKSMISFLEK
PANB_CAMJJ       -------------------------------------------------MRKSMISFLEK
PANB_CAMJR       -------------------------------------------------MRKSILSFLEK
PANB_AQUAE       -------------------------------------------------MAINLQTLFKK
PANB_BACAN       --------------------------------------------------MKTKTDFLKM
PANB_BACAH       --------------------------------------------------MKTKTDFLKM
PANB_BACCZ       --------------------------------------------------MKTKTDFLKM
PANB_BACHK       --------------------------------------------------MKTKTDFLKM
PANB_BACCR       --------------------------------------------------MKTKTDFLKM
PANB_BACC1       --------------------------------------------------MKTKTDFLKM
PANB_GEOKA       --------------------------------------------------MKAKTDFFHM
PANB_GEOTN       --------------------------------------------------MKTKADFFRM
PANB_BACSU       --------------------------------------------------MKTKLDFLKM
PANB_BACLD       --------------------------------------------------MKTKTDFLKM
PANB_LISIN       --------------------------------------------------MKKPVDFFAM
PANB_LISW6       --------------------------------------------------MKRPVDFYAM
PANB_LISMF       --------------------------------------------------MKRPVDFFAM
PANB_LISMO       --------------------------------------------------MKRPVDFFAM
PANB_DESHY       --------------------------------------------------MKTTKDFWVM
PANB_BACHD       --------------------------------------------------MKTTASFKKM
PANB_BACSK       --------------------------------------------------MKTTKTFKQM
PANB_STAA3       --------------------------------------------------MKTVSQLIDM
PANB_STAA8       --------------------------------------------------MKTVSQLIDM
PANB_STAAS       --------------------------------------------------MKTVSQLIDM
PANB_STAAW       --------------------------------------------------MKTVSQLIDM
PANB_STAAN       --------------------------------------------------MKTVSQLIDM
PANB_STAAM       --------------------------------------------------MKTVSLLIDM
PANB_STAAB       --------------------------------------------------MKTVSQLIDM
PANB_STAAC       --------------------------------------------------MKTVSQLIDM
PANB_STAAR       --------------------------------------------------MKTVSQLIDM
PANB_STAES       --------------------------------------------------MKTLNHLNKM
PANB_STAEQ       --------------------------------------------------MKTLNHLNKM
PANB_STAHJ       --------------------------------------------------MKNLAKLVEM
PANB_STAS1       --------------------------------------------------MKTLNQLQDL
PANB_OCEIH       --------------------------------------------------MKALKDFMRM
PANB_BRUA2       --------------------------------------MSAPV----TRKRLTPKVIQAM
PANB_BRUAB       --------------------------------------MSAPV----TRKRLTPKVIQAM
PANB_BRUME       --------------------------------------MSAPV----TRKRLTPKVIQAM
PANB_BRUSU       --------------------------------------MSAPV----TRKRLTPKVIQAM
PANB_AGRFC       --------------------------------------MSAHA----KQKRLTTASIRQM
PANB_RHIEC       --------------------------------------MSAIG----SQKRLTPPRISAM
PANB_RHIL3       --------------------------------------MSAAG----IQKRITPARISAM
PANB_RHIME       --------------------------------------MSVQT----TKRRLSPASIEAL
PANB_BORBR       --------------------------------------MSVPT----AAKRITTRQLRMR
PANB_BORPA       --------------------------------------MSVPT----AAKRITTRQLRMR
PANB_BORPE       --------------------------------------MSVPT----AAKRITTRQLRMR
PANB_MAGSA       --------------------------------------MSTEV----RIKRITTRDIRAR
PANB_RHORT       -------------------------------------MSVVQP----AGRRLTVRDIASR
PANB_GRABC       --------------------------------------MSSVV----RSGRISVPALRAR
PANB1_PSEAE      --------------------------------------MSSHR----PQHRLSVPDIQRR
PANB1_PSEAB      --------------------------------------MSSHR----PQHRLSVPDIQRR
PANB2_BURCH      --------------------------------------MSAHT----RITRKTVTAIRST
PANB2_BURCM      --------------------------------------MSAHT----RITRKTVTAIRST
PANB1_BURL3      --------------------------------------MSAHT----RTTRKTVTAIRST
PANB1_PSEE4      ----------------------------------------MST----LHHRLTITDLAAL
PANB1_PSEF5      --------------------------------------MSSHT----RTQRLSVPQLVAM
PANB1_HAHCH      --------------------------------------MSTHV----DRKRITIPQIRSM
PANB_BARHE       --------------------------------------MTIH----KAVKRITASEIRSR
PANB_BARQU       --------------------------------------MSIH----QTIKRITAAEIRSR
PANB_BARBK       --------------------------------------MSVH----KSIKRITASEIQAK
PANB_RHOP2       --------------------------------------MSVQ----TTIKRKTAPDIRAR
PANB_RHOPS       --------------------------------------MSVQ----SAIKRKTAPDIRAR
PANB_RHOPA       --------------------------------------MSVQ----STIRRKTAPDIRAR
PANB_NITHX       --------------------------------------MSVQ----SAIRRRTAPDIRAR
PANB_NITWN       --------------------------------------MSVQ----SAIRRRTAPDIRAR
PANB_RHOP5       --------------------------------------MSVQ----STIKRKTAPEILAR
PANB_RHOPB       --------------------------------------MSVQ----SAIKRKTAPEIRAR
PANB3_BRADU      --------------------------------------MSVQ----SAIRRKTAPDLRIR
PANB_HYPNA       --------------------------------------MSKQ----TQTTRKTVKDIAAA
PANB_MARMM       --------------------------------------MSAQSKSPTKARRITAPDIRAR
PANB_CAUVC       --------------------------------------MSAHRE--ETVRRLAAPDIAAR
PANB2_ZYMMO      --------------------------------------MSAIP---SSNKRRTIPELRAR
PANB_ERYLH       ----------------------------MSTTFKLDTSTSRANPTPAPMKRLTVPKIRAR
PANB_NOVAD       ----------------------------MSTTFQLDTSTSRANPTPAPMKRLTIPAIRQR
PANB_SPHAL       -------------------------MSTLPKTLTLDTSTSRANPTPQPMKRLTVPRIRQR
PANB_RHOS1       --------------------------------------MSVN----SPVRPVMAADILAR
PANB_RHOS4       --------------------------------------MSVN----SPVRPVMAADILAR
PANB_RUEPO       --------------------------------------MSAT----ARKTAPNAQDIRAR
PANB_RUEST       --------------------------------------MSAS----SQKTALTAEDIRAM
PANB_ROSDO       --------------------------------------MSAT----ARQTAPMPVDIKSR
PANB_CHESB       --------------------------------------MSAT----GGAKSFTPPDIAKA
PANB_PARDP       --------------------------------------MSATP---DRKGQLGPGDIRAR
PANB_RHILO       --------------------------------------MATKLP--TTDIRIGAELIRRR
PANB_ANAMM       -------------------------------------------------MLLNILDIQAK
PANB_PELUB       -------------------------------------------------MNKKILNFIKK
PANB_HELPY       -----------------------------------------MSMQTAPIKKITLNHLQAK
PANB_HELPH       -----------------------------------------MSMQTAPIKKITLNHLQAK
PANB_HELPJ       -----------------------------------------MSMQTAPIKKITLSHLQAK
PANB_HELAH       -----------------------------------------MSMQTAKTKKITLNHLQAK
PANB_HELHP       ----------------------------------------------MLDKKMSIATLKAK
PANB_CAMFF       ------------------------------------------------MKKVTINDLFMM
PANB_WOLSU       ------------------------------------------------MKNITVSSIKKK
PANB_SULDN       -----------------------------------------------MAKKMTITSIKKS
PANB_BDEBA       -------------------------------------------------MKTILD-FHDK
PANB_COXBU       -----------------------------------------------MIAMNTPD-FQRM
PANB_FRATT       -------------------------------------------------MKSVLG-FKKA
PANB_FRAT1       -------------------------------------------------MKSVLG-FKKA
PANB_FRATH       -------------------------------------------------MKSVLG-FKKA
PANB_FRATO       -------------------------------------------------MKSVLG-FKKA
PANB_FRATW       -------------------------------------------------MKSVLG-FKKA
PANB_FRATN       -------------------------------------------------MKSVLG-FKKA
PANB_LEGPH       --------------------------------------------------MKIHD-FKIK
PANB_LEGPA       --------------------------------------------------MKIHD-FKMK
PANB_LEGPL       --------------------------------------------------MKIHD-FKIK
PANB_LEPIC       -------------------------------------------------MKNIHKIFSPE
PANB_LEPIN       -------------------------------------------------MKNIHKIFSPE
PANB_LEPBJ       -------------------------------------------------MKNIHKIFSPE
PANB_LEPBL       -------------------------------------------------MKNIHKIFSPE
PANB_HYPBU       ---------------------------------------------MAGREKVTVRDIVRA
PANB_STAMF       ------------------------------------------------MKKITIRDILKM
PANB_AERPE       ----------------------------------------------MPGDKVTARRILKM
PANB_SULAC       ----------------------------------------------MSAGKVSIRDFLKK
PANB_SULTO       ------------------------------------------------MEKVTIRDFLKK
PANB_SACS2       ------------------------------------------------MKKVTIRDFIKK
PANB_PYRFU       ------------------------------------------------MREITPKRIMEM
PANB_PYRHO       ------------------------------------------------MREITPKRIREM
PANB_PYRAB       ------------------------------------------------MREITPRKIIEM
PANB_THEKO       ------------------------------------------------MREITPRKIIEM
PANB_PYRAE       -----------------------------------------------MSARRRVTDFVKG
PANB_PYRAR       ----------------------------------------------MPDKKRRVTDFVKG
PANB_PYRIL       ------------------------------------------------MRRKTVLDFAKG
PANB_PYRCJ       ----------------------------------------------MEKRKVTIRHFLEA
PANB_THEMA       ---------------------------------------------------MNVEKLKKM
PANB_DEIRA       -------------------------------------------MASPARVKRSLPDLTHP
PANB_DEIGD       -------------------------------------------------MKRSVPDLMN-
PANB_THET2       -------------------------------------------------MRRTVKDFRNA
PANB_THET8       -------------------------------------------------MRRTVKDFRNA
PANB1_METPP      --------------------------------------MSDAAAAPPERKKRTITEIRDS
PANB_ENTFA       -------------------------------------------------MKNTAVTFKES
PANB_CLONN       -------------------------------------------------MKNTVTTFQKA
PANB_CLOAB       -------------------------------------------------MKNTTETFKNS
PANB_CLOD6       -------------------------------------------------MKNTIQTFKNA
PANB_HUNT2       -----------------------------------------------MNDKFTTASFLES
PANB_DEHM1       -------------------------------------------------MRTTISQLKEM
PANB_DEHMC       -------------------------------------------------MRTTISQLKEM
PANB_CARHZ       ------------------------------------------------MDRVTVSSLKEM
PANB_SYNWW       ------------------------------------------------MARVTVSVLKDK
PANB_SYNAS       ------------------------------------------MSTQSKGRKITTSVIRGM
PANB_DESPS       -------------------------------------------------MRKTVVDIIAM
PANB_MOOTA       ---------------------------------------------MAQRSRVTLPQLQAM
PANB_DESVH       -------------------------------MSTHTPPSSATPTSGQGVRPLTTADIRKA
PANB_DESVV       -------------------------------MSTHTPPSSATPTSGQGVRPLTTADIRKA
PANB_DESAG       -------------------------------MSTHAE-----------TRAITAADIRAA
PANB_SYNFM       -----------------------------------------------MKNRVTVPEIIAS
PANB_CENSY       -----------------------------------------------------------M
PANB_MYCTU       --------------------MSEQ--TIYGANTPGGSG---------PRTKIRTHHLQRW
PANB_MYCBO       --------------------MSEQ--TIYGANTPGGSG---------PRTKIRTHHLQRW
PANB_MYCBP       --------------------MSEQ--TIYGANTPGGSG---------PRTKIRTHHLQRW
PANB_MYCUA       -------------MSEQISEQSEQ--NVYGACPPVPAGESSPSAASAPRTKVRTHHLQKW
PANB_MYCPA       --------------------MSEH--NVYGAAQPAQPGQP-----AQPRTRIRTHHLQKM
PANB_MYCA1       --------------------MSEH--NVYGAAQPAQPAQP-----AQPRTRIRTHHLQKM
PANB_MYCLE       --------------------MSEQNVNVYGADPSTSSIQS------IQRTKIRTKHLQKM
PANB_MYCSJ       --------------------MSEQ--TVYGAASDQ--------PTPKPRVKVRTTHLQKW
PANB_MYCSK       --------------------MSEQ--TVYGAASDQ--------PTPKPRVKVRTTHLQKW
PANB_MYCSS       --------------------MSEQ--TVYGAASDQ--------PTPKPRVKVRTTHLQKW
PANB_MYCVP       --------------------MSEQ--PVYGAAAE----------APKPRVKVRTHHLHKW
PANB_NOCFA       ------------------MSVSDSETPAYGAAQPAQ-----------PRRKTRIPHLRQM
PANB_RHOJR       -------------MSDSKSSASTSEDRLYGSAPSHDV----------PKRKTRTHHLQAM
PANB_LEIXX       ----------------------------MPSVPSEAPASPS-PKR------VRTRHFQAA
PANB_SACEN       ---------------MTAAHDRSENQPGRPGGETTAPYGSA-PRRR----RVRTRHLLEL
PANB_PAEAT       ----------MAPSNLPESTTPAEVPAPYGTGPAAAAQAAS-AAGRKPISRVRIHHLQQA
PANB_ARTS2       ----------MATSNSSDSSMSAEVPAPYGNGPANAPATPS-DTAKKPVARIRTHHLQQA
PANB_NOCSJ       --------------MTSGRAMSPEETAPYGTGPARAESAPD-APA--PIKRIRTHHLREM
PANB_FRAAA       MDSSGTVRNQTSDDHSRPADAAGTAATLYGAPAETRSP---------RRSRFTVRDVAAA
PANB_FRACC       MDASDTPTHPAPH-------PADPAATPYGAPTTPPRP---------LRSRFTVRDVAAA
PANB_ACIC1       ----------------------------MSAAADVPR-------------RVTIHDLQLR
PANB_STRAW       ----------------MTQLSAAQ----KPSDSSKALYGGK------GTRRITIRDITTA
PANB_STRCO       ----------------MTQLSAAQTPQPKPADGNRALYGGK------INRRITVRDITAA
PANB_THEFY       ----------------MSSHTPAP-----------ALYGGS------ANRRVTVQDLAAA
PANB_CORGL       -----------------------------MSGIDAK--------------KIRTRHFREA
PANB_CORGB       ---------------------------MPMSGIDAK--------------KIRTRHFREA
PANB_COREF       -----------------------------MSGIDAK--------------KIRTRHIHEA
PANB_CORDI       ---------------------------------MTR--------------PVRLQDLRDY
PANB_CORJK       ----------------MTATSGTSSSTPTGYLVPTK--------------KVRIADLKAR
PANB_TROW8       -----------------------------MSRKPSP--------------TRRTRIHRFH
PANB_TROWT       --------------------------MICMSRKPSP--------------TRRTRIHRFH
PANB_BACFR       --------------------------MAGYISDDTR--------------KVTTHRLIEM
PANB_BACFN       --------------------------MAGYISDDTR--------------KVTTHRLIEM
PANB_BACTN       --------------------------MAGYISDDTR--------------KVTTHRLVEM
PANB_PORGI       --------------------------MSTYQPEDTR--------------KVTTHRLIEM
PANB_CYTH3       ---------------------------MSTAKSDIK--------------KVTTHQLQEM
PANB_GRAFK       ---------------------------MSVAKKEYK--------------RITVKSLVDM
PANB_SALRD       ----------------------------------MP--------------RVTTKTVQEM
PANB_CHLCH       --------------------------MPHRDQPKTA--------------HVTTRRLLDM
PANB_CHLPD       --------------------------MNTSNQHKAG--------------HVTTRKLLDM
PANB_PELLD       --------------------------MNKNSQQKAA--------------HVTTRRLYDM
PANB_CHLTE       --------------------------MNQPSGNKLP--------------HVTTRRMLDM
PANB_RHOBA       ---------------------------MTESEKRKS--------------RITTRTLQRM
PANB_GEOSL       ---------------------------------MNR--------------AKTILDIQKM
PANB_GEOMG       ---------------------------------MNR--------------KKTIIDIQKM
PANB_PELCD       ---------------------------------MQK--------------RKTVLDIQRM
PANB_PELPD       ------------------------------MSDMRK--------------KVTIPDILKM
PANB_KORVE       --------------------------MSIATGDFRS--------------KVTSSTLLDK
PANB2_BRADU      ----------------------------------------MSHSSEQPLERVTIPALQQW
PANB1_BRADU      ----------------------------------------MSRVSEQPVDRITIPLLQRW
PANB_NOSS1       -------------------------------------------------MPVTTQQLIQW
PANB_TRIV2       -------------------------------------------------MPVTTQQLIQW
PANB_SYNP6       -------------------------------------------------MPITPRHLRQW
PANB_SYNE7       -------------------------------------------------MPITPRHLRQW
PANB_SYNY3       -------------------------------------------------MAITPTQLLDW
PANB_TRIEI       -------------------------------------------------MAVTTKQLIQW
PANB_THEEB       ----------------------------------------------MVRRSVTLPQLQAK
PANB_SYNJA       ------------------------------------------------MAALSIHHFRQA
PANB_SYNJB       ------------------------------------------------MAALSIHHFRQA
PANB_GLOVI       -------------------------------------------------MGLSIHSLRKL
PANB_PROM0       ---------------------------------------------------MLPSDLVNY
PANB_PROMS       ---------------------------------------------------MLPSDLVNY
PANB_PROM9       ---------------------------------------------------MLPSDLVKY
PANB_PROM5       ---------------------------------------------------MLPSELVKY
PANB_PROMP       ---------------------------------------------------MLPSELVKY
PANB_PROM1       ---------------------------------------------------MQTTDLVRF
PANB_PROMT       ---------------------------------------------------MQTTELVRF
PANB_PROM3       ---------------------------------------------------MRPSELTQL
PANB_PROMM       ---------------------------------------------------MRPSELTQL
PANB_PROMA       ---------------------------------------------------MLPKELVRF
PANB_SYNPX       ---------------------------------------------------MRPADLIRQ
PANB_SYNS9       ---------------------------------------------------MRPFDLIRF
PANB_SYNSC       ---------------------------------------------------MRPSDLTRF
PANB_SYNS3       ---------------------------------------------------MRPAELIRF
PANB_HALSA       --------------------------------------------------MPTVNSVRRA
PANB_HALMA       --------------------------------------------------MPTVRDLQAM
PANB_NATPD       ---------------------------------------------------MRAKDIRAK
                                                                             

PANB_ECOK1       KQDK---KRFATITAYDYSFAKLFAEEGLNVMLVGDSLGMTVQGHDSTLPVTVADIAYHT
PANB_ECOUT       KQDK---KRFATITAYDYSFAKLFAEEGLNVMLVGDSLGMTVQGHDSTLPVTVADIAYHT
PANB_ECOL6       KQDK---KRFATITAYDYSFAKLFAEEGLNVMLVGDSLGMTVQGHDSTLPVTVADIAYHT
PANB_ECOL5       KQDK---KRFATITAYDYSFAKLFADEGINVMLVGDSLGMTVQGHDSTLPVTVADIAYHT
PANB_SHIBS       KQDK---KRFATITAYDYSFAKLFADEGLNVMLVGDSLGMTVQGHDSTLPVTVADIAYHT
PANB_SHISS       KQDK---KRFATITAYDYSFAKLFADEGLNVMLVGDSLGMTVQGHDSTLPVTVADIAYHT
PANB_SHIFL       KQDK---KRFATITAYDYSFAKLFADEGLNVMLVGDSLGMTVQGHDSTLPVTVADIAYHT
PANB_SHIF8       KQDK---KRFATITAYDYSFAKLFADEGLNVMLVGDSLGMTVQGHDSTLPVTVADIAYHT
PANB_ECOLI       KQEK---KRFATITAYDYSFAKLFADEGLNVMLVGDSLGMTVQGHDSTLPVTVADIAYHT
PANB_ECO57       KQEK---KRFATITAYDYSFAKLFAEEGLNVMLVGDSLGMTVQGHESTLPVTVEDIAYHT
PANB_SHIDS       KQEK---KRFATITAYDYSFAKLFADEGLNVILVGDSLGMTVQGHDSTLPVTVADIAYHT
PANB_SALTY       KQEK---KRFATITAYDYSFAKLFADEGINVMLVGDSLGMTIQGHDSTLPVTVEDIAYHT
PANB_SALPA       KQEK---KRFATITAYDYSFAKLFADEGINVMLVGDSLGMTIQGHDSTLPVTVEDIAYHT
PANB_SALCH       KQEK---KRFATITAYDYSFAKLFADEGINVMLVGDSLGMTIQGHDSTLPVTVEDIAYHT
PANB_SALTI       KQEK---KRFATITAYDYSFAKLFADEGINVMLVGDSLGMTIQGHDSTLPVTVEDIAYHT
PANB_YERPA       KQEK---RKFATLTAYDASFAQLFAEQGIQVLLVGDSLGMTLQGFDSTLPVTVADMAYHT
PANB_YERPN       KQEK---RKFATLTAYDASFAQLFAEQGIQVLLVGDSLGMTLQGFDSTLPVTVADMAYHT
PANB_YERPP       KQEK---RKFATLTAYDASFAQLFAEQGIQVLLVGDSLGMTLQGFDSTLPVTVADMAYHT
PANB_YERPE       KQEK---RKFATLTAYDASFAQLFAEQGIQVLLVGDSLGMTLQGFDSTLPVTVADMAYHT
PANB_YERPS       KQEK---RKFATLTAYDASFAQLFAEQGIQVLLVGDSLGMTLQGFDSTLPVTVADVAYHT
PANB_YERE8       KLEK---RKFATLTAYDASFAQLFAEQGIEVLLVGDSLGMTLQGFDSTLPVTTADVAYHT
PANB_PECAS       KQEQ---RKFATITAYDASFSRLFFEQGIRVMLVGDSLGMTVQGHDSTLPVTTHDIVYHT
PANB_SODGM       KQQQ---RKFTSITAYDAAFARLFAEQGIKVMLVGDSLGMTMQGHDSTLPVTLEDMVYHT
PANB_BAUCH       KQRQ---QKFAAITAYDAAFASLFEQNGIQVMLVGDSLGMTIQGNDSTLPVTLEDMIYHT
PANB_PHOLL       KKEK---RKFATITAYDASFAHLFAEQGIDVMLVGDSLGMTVQGADTTIPVTVEDIVYHT
PANB_PHOPR       KHEG---RKFASITAYDASFAQLFEQQEVPVLLVGDSLGMVLQGKPDTLPVSVSDIAYHT
PANB1_ALIF1      KQEG---KKFATVTAYDASFAQLFEQQEVPVLLVGDSLGMVLQGKSDTLPVTTEEIAYHT
PANB_VIBVU       KQEG---RKFATSTAYDASFAQLFESQEMPVLLVGDSLGMVLQGKNDTLPVTVEDIAYHT
PANB_VIBVY       KQEG---RKFATSTAYDASFAQLFESQEMPVLLVGDSLGMVLQGKNDTLPVTVEDIAYHT
PANB_VIBPA       KQEG---RKFATSTAYDASFAQLFESQEMPVLLVGDSLGMVLQGENDTLPVTVDDIVYHT
PANB_VIBCH       KQEG---RKFATSTAYDASFAQLFESQEMPVLLVGDSLGMVLQGETDTLPVTVDDIAYHT
PANB2_ALIF1      KEVG---EKFASITAYDASFAKIFEEQSMPVIIVGDSLGSVIQGKPTTLDVSIEELVYHT
PANB_SHEON       KQEG---RKFTALTAYDASFASAFDGEGIDVLLVGDSLGMVLQGHDDTLPVTTADIAYHT
PANB_SHESA       KQEG---RKFTALTAYDASFASAFDGEGIDVLLVGDSLGMVLQGHDDTLPVTTAEIAYHT
PANB_SHESM       KQEG---RKFTALTAYDASFASAFDGEGIDVLLVGDSLGMVLQGHDDTLPVTTADIAYHT
PANB_SHESR       KQEG---RKFTALTAYDASFASAFDGEGIDVLLVGDSLGMVLQGHDDTLPVTTAEIAYHT
PANB_SHESW       KQEG---RKFTALTAYDASFAGAFDSEGVDVLLVGDSLGMVLQGHDDTLPVTTAEIAYHT
PANB_SHELP       KQEG---KKFTALTAYDASFAGAFDSEGIDVLLVGDSLGMVLQGHDDTLPVTVEDIVYHT
PANB_SHEAM       KQEG---KKFTALTAYDASFAAAFDSEGVDVLLVGDSLGMVLQGHEDTLPVTVQDIAYHT
PANB_SHEFN       KQEG---KKFTALTAYDASFAGAFDSEGVDVLLVGDSLGMVLQGHNDTLPVTIADIAYHT
PANB_SHEDO       KQEG---TKFTSITAYDASFAAAFDSEGIDAILVGDSLGMVLQGHDDTLPVTTADVAYHT
PANB_COLP3       KQQG---KKISTITAYDASFAKLFDQAGIHAILIGDSLGMVLQGQDSTLPVTIEDMAYHT
PANB_AERHH       KQEG---QRITAITAYDATFAKLFDDEGAHVLLIGDSLGMVLQGGQDTLGVSMDEMVYHT
PANB_AERS4       KQDD---QKITAITAYDASFAKLFDDEGAHVLLIGDSLGMVLQGGQDTLAVSVDEMVYHT
PANB_PSEA6       KQQS---EKISALTAYDASFSKLFDEQGIDVLLIGDSLGMVLQGCDDTLGVSIDDVAYHT
PANB_PSYIN       KQDN---QKITCMTAYDASFAAIFDQAGIQVLLVGDSLGMVLQGHDSTLPVTVDDIRYHT
PANB_PSET1       KAEK---NKITALTAYDASFAKLFHDNGVEVILVGDSLGMVLQGGDDTLGVTNQDIAYHT
PANB_IDILO       KREG---TKISSLTAYDSSFAKLMTEQGVDFILVGDSLGNVVQGRDSTVPVTVDDMIYHT
PANB_BUCAI       KINK---KKFAAITAYDFSFSRLFSNCGIPVILIGDSLGMTIQGHTSTLPVKIEDIAYHT
PANB_BUCAP       KKNQ---IKFAAITAYDFSFSRLFEKEGIPIMLVGDSLGMTIQGHNSTLPVKIQDIKYHT
PANB_WIGBR       KEQN---KKFASITAYDATFANLFFKKGIRTILVGDSLGMTIQGHSSTVPVKIDEMMYHT
PANB2_PSEAE      KQSG---EKIAMLTCYDATFAHTASQAGVDVLLVGDSLGMVLQGHDSTLPVSNEEMAYHT
PANB2_PSEAB      KQSG---EKIAMLTCYDATFAHTASQAGVDVLLVGDSLGMVLQGHDSTLPVSNEEMAYHT
PANB_PSEPK       KAKG---EKITMLTCYDATFAKAASQAGVEVLLVGDSLGMVLQGHDSTLPVTTAEMAYHT
PANB2_PSEE4      KAKG---EKITMLTCYDATFAKAASEAGVEVLLVGDSLGMVLQGHDSTLPVSNDDMAYHT
PANB_PSE14       KQKG---EKITMLTCYDATFAHTASQAGVEVLLIGDSLGMVLQGHDSTLPVTTAETAYHV
PANB_PSEU2       KQKG---EKITMLTCYDATFAHTASQAGVEVLLIGDSLGMVLQGHDSTLPVTTAETAYHV
PANB_PSESM       KHKG---EKITMLTCYDATFAHTACQAGVEVLLIGDSLGMVLQGHDSTLPVTTAETAYHV
PANB2_PSEF5      KQKG---EKITMLTCYDATFAHTCCEAGVEVLLVGDSLGMVLQGHDSTLPVSTADMAYHV
PANB_PSEPF       KQKG---EKITMLTCYDATFAHACNEAGVEVLLVGDSLGMVLQGHDSTLPVTTAEMAYHV
PANB_PSEU5       KQKG---EKIVMLTCYDATFAKTACDAGVEMLLIGDSLGMVLQGHDSTLPVTVADMAYHT
PANB_MARHV       KQKG---EAFSALTSYDATFAQVVSEAGVDVILIGDSLGMVLQGHDSTLPVTMDQMVYHT
PANB2_HAHCH      KKKS---EKFAVMTAYDATFAYEMDQAGVEVILVGDSLGMVLQGHDSTIPVRLEDMVYHT
PANB_ALCBS       KQDG---GKFSVLTAYDACFSRLISEAGVEAILVGDSLGNVIQGQTSTVPVTLEQMVYHT
PANB_PSYA2       KKDG---TKFTCLTCYDAMFARMMEKAQIDTILIGDSLGMVVQGHDSTLPVTVDDMAYHT
PANB_PSYCK       KKDG---TKFTCLTCYDAMFARMMEKAQIDTILIGDSLGMVVQGHDSTLPVTVDDMAYHT
PANB_ACIAD       KTEG---RKFSCLTCYDASMAKAMEFAEIDSILIGDSLGMVIQGHDSTLPVTVDDMAYHT
PANB_CHRSD       KHAQ---EPFSCLTAYDASFAQHADAAGIDVLLVGDSLGMVLQGHASTLPVTLDDILYHT
PANB_SACD2       KADK---EKFITVALYDAPMAAMAQKCGVEVVLIGDSLGMTVLGYDSTVPVTMEQMIYHI
PANB_NEIMB       KAAG---EKIAMLTAYESSFAALMDDAGVEMLLVGDSLGMAVQGRKSTLPVSLRDMCYHT
PANB_NEIMF       KAAG---EKIAMLTAYESSFAALMDDAGVEMLLVGDSLGMAVQGRKSTLPVSLRDMCYHT
PANB_NEIMA       KAAG---EKIAMLTAYESSFAALMDDAGVDVLLVGDSLGMAVQGRQSTLPVSLRDMCYHT
PANB_NEIG1       KAAG---EKIVMLTAYESSFAALMDDAGVDVLLVGDSLGMAVQGRQSTLPVSLRDMCYHT
PANB_CHRVO       AEEG---RKITMLTCYDASFASLLDEAGVEILLVGDSLGPVMQGVDSTLPVSEEDMLYHI
PANB_BURMA       REAG---EKIAMLTSYDASFAALLDRANVDVQLIGDSLGNVLQGQATTLPVTLDDIAYHT
PANB_BURPS       REAG---EKIAMLTSYDASFAALLDRANVDVQLIGDSLGNVLQGQATTLPVTLDDIAYHT
PANB_BURP0       REAG---EKIAMLTSYDASFAALLDRANVDVQLIGDSLGNVLQGQATTLPVTLDDIAYHT
PANB_BURP1       REAG---EKIAMLTSYDASFAALLDRANVDVQLIGDSLGNVLQGQATTLPVTLDDIAYHT
PANB_BURTA       REAG---EKIAMLTCYDASFAALLDRANVDVQLIGDSLGNVLQGQTTTLPVTLDDIAYHT
PANB_BURCA       RDAG---EKIAMLTCYDASFSALLDRAGTDVLLIGDSLGNVLQGHTTTLPVSIDDIAYHT
PANB1_BURCH      RDAG---EKIAMLTCYDASFSALLDRAGTDVLLIGDSLGNVLQGHTTTLPVSIDDIAYHT
PANB1_BURCM      RDAG---EKIAMLTCYDASFAALLDRSGVDVLLIGDSLGNVLQGHTTTLPVSLDDIAYHT
PANB2_BURL3      RDAG---EKIAMLTCYDASFSALLDRSGVDVLLIGDSLGNVLQGHTTTLPVSLDDIAYHT
PANB_PARXL       RDAG---EKIAMLTCYDASFAALLDRAGVDVLLIGDSLGNVLQGQTTTLPVSLADIAYHT
PANB_CUPNH       RDAG---EKIAMLTAYDSSFAALLDYCGVEMILVGDSLGNVMQGQQTTLPVTLEQMAYHT
PANB_CUPPJ       RDAG---EKIAMLTAYDSSFAALLDYCGVEVILVGDSLGNVMQGQQTTLPVTLEHMAYHT
PANB_CUPMC       REAG---EKIAMLTAYDSSFSALLDLCGVEVILVGDSLGNVMQGQQTTLPVTLEHMVYHT
PANB_RALSO       RAAG---ERIAMLTAYDASFAALMERSGVDVVLVGDSLGNVVQGQKTTLPVTLDHIVYHT
PANB_NITEU       CEQG---EKIAVLTCYDATFAAVLEEAGVDILLVGDSLGNVVQGKSSTLPVTLDEMIYHV
PANB_NITEC       YREK---GKIAALTCYDATFAAVLENAGVDILLVGDSLGNVIQGQASTLPVTLDEMIYHV
PANB_NITMU       RDDG---EKIAIVTCYDASFAALLERAGVDILLVGDSLGNVIQGEETTLPVTLDDMIYHT
PANB_DECAR       YQAG---EKIAQFTCYDASFARLLDGAGVDSILIGDSLGNVIQGHDTTLPVTVADIAYHT
PANB_METFK       KERG---EKIAVLTSYDASFAALSDKAGVDVLLVGDSLGMTMQGHANTLAVSLRDMEYHT
PANB_AZOSB       RAEG---RKIAMLTCYDASFAALLERNGVDVLLVGDSLGNVLQGQKSTLPVTLEQMAYHT
PANB_AROAE       RAEG---RKISMLTCYDASFASLLERAGVDILLVGDSLGNVVQGQKSTLPVTLEHMIYHT
PANB_THIDA       RQKG---EKIAVLTCYDASFARVFDAAGVDVLLVGDSLGMVIQGHASTLPVKLAEMAYHT
PANB_ACIAC       REAG---EKITMLTAYDATFAAVADAAGVECLLVGDSLGMVCQGLPSTVGVSLDTMAYHT
PANB_ACISJ       REAG---EKITMLTAYDATFAAVADAAGVECILVGDSLGMVCQGLPSTVGVTLEHMAYHT
PANB_VEREI       RAAG---EKITMLTAYDATFAALADAAGVECILVGDSLGMVCQGLPSTVGVQLDTMAYHS
PANB_POLNA       HAHG---EKITMLTAYDATFAAVADAAGVECILVGDSLGMVCQGLSSTVGVTLETMRYHT
PANB_POLSJ       HAQG---EKITMLTAYDATFAAVADAAGVECILVGDSLGMVCQGLTSTVGVTLETMRHHT
PANB_RHOFT       HARG---EKLTMLTAYDATFAAVADAAGVECILVGDSLGMVCQGLSSTMGVTLQAMCYHI
PANB1_ZYMMO      RVDG---EKIAVLTAYDATFAAAADAAGVDCIMVGDSLGMVCQGRTTTVGVSLEDMLYHT
PANB2_METPP      HARG---EKIAMITAYDASFAALVDTAGVDCILVGDSLGMVLKGQSSTLSVTMEQIGYHT
PANB_XANAC       KREG---RKLVMLTAYDAGFARTFDANGVDLILVGDSLGMVVQGHDSTLPVTTADMVYHT
PANB_XANC5       KREG---RKLVMLTAYDAGFARTFDAHGVDLILVGDSLGMVVQGHDSTLPVTTADMVYHT
PANB_XANOM       KRAG---RKLVMLTAYDASFARTFDANGVDLILVGDSLGMVMQGHDSTLAVTTADMVYHT
PANB_XANOR       KRAG---RKLVMLTAYDASFARTFDVNGVDLILVGDSLGMVMQGHDSTLAVTTADMVYHT
PANB_XANCP       KRDG---RKLVMLTAYDAGFARTFDANGVDLILVGDSLGMVVQGHESTLPVTTADMVYHT
PANB_XANC8       KRDG---RKLVMLTAYDAGFARTFDANGVDLILVGDSLGMVVQGHESTLPVTTADMVYHT
PANB_XYLFA       KRNG---SKIVMLTAYDAGFARILDANGVDLVLVGDSLGMVVQGHDSTLPVSVHDMVYHT
PANB_XYLFT       KRNG---SKIVMLTAYDAGFARILDANGVDLILVGDSLGMVVQGHDSTLPVSVHDMVYHT
PANB_RUTMC       KQSG---EKITCLTAYDASFASVFDVCGIDIILIGDSLGNVIQGGENTLNVSMDDMVYHT
PANB_VESOH       KESG---EKITCLTAYDASFASVFDACGIDIILVGDSLGNVIQGDKNTLDVSMSDMIYHM
PANB_ALKEH       KADG---QKVVALTAYDYTFAVAEDQAGVDVILVGDSLGMVVQGRDTTVPVTVEEMVYHT
PANB_HALHL       KREG---RPLACLTAYDYGFAAACERAGVDLLLIGDSLGMVVQGHETTLPVTVDDMVYHT
PANB_NITOC       KRQG---EKITMLTAYDASFAALLEAAGVEVLLVGDSLGMVIQGQESTLSVTMDDMVYHC
PANB_HYDCU       KQAG---EKIVCLTAYEASQAYWAVEAGVEVILVGDSLGMVVQGHQTTLPVTLNDMVYHT
PANB_METCA       KRRG---EKIACLTAYDASSAALQDEAGIEVILVGDSLGNVIQGQPTTLSVTLDHMVYHT
PANB_ANADE       KEAG---ERIAMVTAYDATAARLVAAAGVDAVLVGDSLGMAVQGHESTLPVTLDQMVYHS
PANB_MYXXD       KQIG---QKICMVTAYDATFAHILEEAGADVLLIGDSLGMVIQGHDSTLPVTMDQMVYHT
PANB_MAGMM       KQQG---EPIVALTAYDYTLARLVDAADVDLVLVGDSLGMVVQGHETTLPVTLDEMIYHT
PANB_CAMJE       KAKN---EKITMVSAYDYHSARILDNSDIDIILVGDSLAMTVLGMQDTLSVTMDEMLIFT
PANB_CAMJJ       KAKN---EKITMVSAYDYHSAKILDNCDIDIILVGDSLAMTVLGMQDTLSVTMDEMLIFT
PANB_CAMJR       KGKN---EKITMVSAYDYHSAKILDNCDIDIILVGDSLAMTVLGMQDTLSVTMDEMLIFT
PANB_AQUAE       KREG---KKITMVSTYDYWSAKLCDEVGIDCILVGDSLGTVVKGEGDTLSVTLEEIIYHT
PANB_BACAN       KEQG---EPITMLTAYDYPSAKLAEEAEVDMILVGDSLGMVVLGYDSTVPVTVEDMIHHT
PANB_BACAH       KEQG---EPITMLTAYDYPSAKLAEEAEVDMILVGDSLGMVVLGYDSTVPVTVEDMIHHT
PANB_BACCZ       KEQG---EPITMLTAYDYPSAKLAEEAEVDMILVGDSLGMVVLGYDSTVPVTVEDMIHHT
PANB_BACHK       KEQG---EPITMLTAYDYPSAKLAEEAEVDMILVGDSLGMVVLGYDSTVPVTVEDMIHHT
PANB_BACCR       KEQG---EPITMLTAYDYPSAKLAEEAEVDMILVGDSLGMVVLGYDSTVPVTVEDMIHHT
PANB_BACC1       KEQG---EPITMLTAYDYPSAKLAEEAEVDMILVGDSLGMVVLGYDSTVPVTVEDMIHHT
PANB_GEOKA       KQAG---EPIVMVTAYDFPSAKLAEQAGVDMILVGDSLGMVVLGYDSTIPVTVDDMIHHT
PANB_GEOTN       KQAD---EPIVMVTAYDFPSAKLVEQAGVDMILVGDSLGMVVLGYDSTIPVTVDDMIHHT
PANB_BACSU       KESE---EPIVMLTAYDYPAAKLAEQAGVDMILVGDSLGMVVLGLDSTVGVTVADMIHHT
PANB_BACLD       KQEG---EPIVMLTAYDYPAAKLAEQAGVDMILVGDSLGMVVLGLDSTVSVTVADMIHHT
PANB_LISIN       KENG---EKITMITAYDYPSAKNVEQAEADMILVGDSLGMVVLGYDSTVPVTMNDMIHHT
PANB_LISW6       KESG---EKITMITAYDYPSAKNVEQAAADMILVGDSLGMVVLGYDSTVPVTIDDMIHHT
PANB_LISMF       KENG---EKITMITAYDYPSAKNVEQAEADMILVGDSLGMVVLGYDSTVPVTMDDMIHHT
PANB_LISMO       KENG---EKITMITAYDYPSAKNVEQAEADMILVGDSLGMVVLGYDSTVPVTIDDMIHHT
PANB_DESHY       KNEG---KKIVMITAYDYPSAKQAEQAGADIILVGDSLGNVVLGYDSTVYVTMEDMIHHG
PANB_BACHD       KQQK---EKIAMMTAYDAPSARLVEDADVDMILVGDSLGMVVLGYDSTIPVTLDDMIHHT
PANB_BACSK       KRDG---EPIAMLTAYDAPSARLAERAGVDMILVGDSLGMVVLGYDSTVPVSVDDMVLHT
PANB_STAA3       KQKQ---TKISMVTAYDFPSAKQVEAAGIDMILVGDSLGMTVLGYESTVQVTLADMIHHG
PANB_STAA8       KQKQ---TKISMVTAYDFPSAKQVEAAGIDMILVGDSLGMTVLGYESTVQVTLADMIHHG
PANB_STAAS       KQKQ---TKISMVTAYDFPSAKQVEAAGIDMILVGDSLGMTVLGYESTVQVTLADMIHHG
PANB_STAAW       KQKQ---TKISMVTAYDFPSAKQVEAAGIDMILVGDSLGMTVLGYESTVQVTLADMIHHG
PANB_STAAN       KQKQ---TKISMVTAYDFPSAKQVEAAGIDMILVGDSLGMTVLGYESTVQVTLADMIHHG
PANB_STAAM       KQKQ---TKISMVTAYDFPSAKQVEAAGIDMILVGDSLGMTVLGYESTVQVTLADMIHHG
PANB_STAAB       KQKQ---TKISMVTAYDFPSAKQVEAAGIDMILVGDSLGMTVLGYESTVQVTLADMIHHG
PANB_STAAC       KQKE---TKISMVTAYDFPSAKQVEAAGIDMILVGDSLGMTVLGYESTVQVTLADMIHHG
PANB_STAAR       KQKQ---TKISMVTAYDFPSAKQVEAAGIDMILVGDSLGMTVLGYESTVQVTLADMIHHG
PANB_STAES       KASQ---QKISMVTAYDYPSAKQAQQAEIDMILVGDSLGMTVLGYDSTVQVTLNDMIHHG
PANB_STAEQ       KASQ---QKISMVTAYDYPSAKQAQQAEIDMILVGDSLGMTVLGYDSTVQVTLNDMIHHG
PANB_STAHJ       KQDK---TKISMITAYDFPSAKQAQDANIDMILVGDSLGMTVLGYETTTQVTLEDMIHHG
PANB_STAS1       KVNK---EKISMVTAYDYPSAKQVEAADIDIILVGDSLGMTVLGYDSTVQVTVADMIHHT
PANB_OCEIH       KHEG---EKISMLTAYDYPSAKQAEAAEIDMILVGDSLGMTVLGYESTVDVTLDDMKHHA
PANB_BRUA2       KG----ECPIVSLTAYTTPVARLLD-PHCDLLLVGDSLGMVLYGMESTLAVTLDMMIMHG
PANB_BRUAB       KG----ECPIVSLTAYTTPVARLLD-PHCDLLLVGDSLGMVLYGMESTLAVTLDMMIMHG
PANB_BRUME       KG----ECPIVSLTAYTTPVARLLD-PHCDLLLVGDSLGMVLYGMESTLAVTLDMMIMHG
PANB_BRUSU       KG----ECPIVSLTAYTTPVARLLD-PHCDLLLVGDSLGMVLYGMESTLAVTLDMMIMHG
PANB_AGRFC       KG----EARIVCLTAYTTPIARLLD-PHCDLLLVGDSLGMVLYGMETTVGVTLDMMIAHG
PANB_RHIEC       KG----GKPIVCLTAYTTPMARLLD-DHCDLLLVGDSLGMVLYGMETTIGVTLDMMIAHG
PANB_RHIL3       KG----GKPIVCLTAYTTPMARLLD-EHCDLLLVGDSLGMVLYGMETTIGVTLDMMIAHG
PANB_RHIME       KG----ERPIVSLTAYTTPIARLLD-PHVDFLLVGDSLGMVLYGLDTTVGVTLDMMIAHG
PANB_BORBR       TP----DEPIVALTAYTAPIAGLLD-AHCDLLLVGDSLGMVIYGMETTLPVTVDMMIQHG
PANB_BORPA       TP----DEPIVALTAYTAPIAGLLD-AHCDLLLVGDSLGMVIYGMETTLPVTVDMMIQHG
PANB_BORPE       TP----DEPIVALTAYTAPIAGLLD-AHCDLLLVGDSLGMVIYGMETTLPVTVDMMIQHG
PANB_MAGSA       K----GAEPLVVLTAYTAPIARLLD-PICDILLVGDSLGMVVYGMETTLAVTLEMMINHG
PANB_RHORT       KSP--AAEPVVCLTAYTAPMARLLD-PHVDLLLVGDSLGMVIYGLPTTHGVTVEMMIAHG
PANB_GRABC       KG----GTPIVALTAYTAPMAGHLD-PHVDVLLVGDSLGMVIYGFETTLPVTLEMMIAHA
PANB1_PSEAE      KG----AGSLVALTAYSTPMARLLD-PHADLLLVGDSLGMVLYGMPSTLGVSLEMMVAHT
PANB1_PSEAB      KG----AGSLVALTAYSTPMARLLD-PHADLLLVGDSLGMVLYGMPSTLGVSLEMMVAHT
PANB2_BURCH      KG----IGSLVSLTAYSAPMAKLVD-EVADVIIVGDSVGMVLYGMPDTLRVTLDMMIAHG
PANB2_BURCM      KG----IGSLVSLTAYSAPMAKLVH-DVADVIIVGDSVGMVLYGMPDTLRVTLDMMIAHG
PANB1_BURL3      KG----IGSLVSLTAYSAPMAKLVD-EVADVIIVGDSVGMVLYGMPDTLRVTLDMMIAHG
PANB1_PSEE4      KG----RQKIAALTAYSTPIARLID-PLVDFILVGDSTAMVAYGRPSTLAMRLDETISHT
PANB1_PSEF5      KG----RQKIVSLTAYTSHMARLMD-PFVDFILIGDSTAMVGYGRTSTLDMSLAEIIAHT
PANB1_HAHCH      KG----KGSIVSLTAYTTPMAQMMD-EFVDLIIVGDSTGMVAYGFNSTMSVTLDMMINHG
PANB_BARHE       KGQ----EPIVSLTAYQAYSARIAD-PYCDLLLVGDSVGMVVHGFETTLPVSLDMMILHG
PANB_BARQU       KGQ----EPIVSLTAYQAYSARIAD-PYCDFLLVGDSVGMVVHGFETTLPVSLDMMILHG
PANB_BARBK       KKQ----EPIVSLTAYQAYSARIAD-PHCDFLLVGDSVGMIVHGFDTTLPVDVDMMILHG
PANB_RHOP2       KGG----DPIVMLTSYHAHTASLVD-RYCDVILVGDSLGNVMHGFETTIPVTLEMMILQG
PANB_RHOPS       KGG----DPIVMLTSYHAHTASLVD-RYCDVILVGDSLGNVMHGFETTVPVTLEMMILQG
PANB_RHOPA       KGG----DPIVMLTSYHAHTASLVD-RYCDAILVGDSLGNVMHGFETTVPVTLEMMILQG
PANB_NITHX       KNG----DPIVMLTSYHAHTAALVD-RHCDVILVGDSLGNVMHGFETTVPVTLDMMILQG
PANB_NITWN       KNG----DPIVMLTSYHAHTAALVD-RYCDVILVGDSLGNVMHGFETTVPVTLDMMILQG
PANB_RHOP5       KGG----EPVVMLTSYHAHTAALVD-RYCDVILVGDSLGNVMHGFETTVPVTLDMMILQG
PANB_RHOPB       KGG----DPVVMLTSYHAHTAALVD-RYCDVILVGDSLGNVMHGFETTVPVTLDMMILQG
PANB3_BRADU      KNG----EPIVMLTSYHAHTAALVD-RHCDAILVGDSLGNVMHGFETTVPVTLEMMILQG
PANB_HYPNA       KGA----TPLVMLTAYDAPTAAILD-PHCDILLVGDSLGMVVHGLPSTVGVTMEMMILHG
PANB_MARMM       KGG----EPLVCLTAYDAPMARILD-PHCDLLLVGDSVGMVVHGLDSTVGVTLDMMILHG
PANB_CAUVC       KGG----VPIVCLTAYTAPVAAALD-DACDVLLVGDSVGMVVHGLPNTVGVTMEMMILHG
PANB2_ZYMMO      KGK----SPIVALTAYSALTARFVD-PYADFILVGDSLAMVEHGMATTIGASLDMMILHG
PANB_ERYLH       KKDGKTEEPLVMLTAYTARQAQLLD-AHCDLLLVGDSLGQVIYGLPSTIPVTLRMMADHA
PANB_NOVAD       KKDGVTAQPVVMLTAYTARQAQLLD-AHCDLLLVGDSLGQVIYGLPSSVPVTLDMMAAHG
PANB_SPHAL       KGG----EPIVMLTAYTVRMAQLLD-PHCDMLLVGDSLAQVIYGLPHTVGVTMEMMALHG
PANB_RHOS1       KGG----EPIVCLTAYTTPMARLVD-AHCDLTLVGDSLGMVVHGLPTTLGVTMEMMILHG
PANB_RHOS4       KGG----EPIVCLTAYTTPMARLVD-AHCDLTLVGDSLGMVVHGLPTTLGVTMEMMILHG
PANB_RUEPO       KGG----VPLVSLTAYTTPMARLMD-GHCDFVLVGDSVGMVLHGLNSTLGVTMEMMILHG
PANB_RUEST       KGR----TPIVSLTAYTTPMAQLMD-EHCDFVLVGDSVGMVLHGLPSTLGVTMEMMILHG
PANB_ROSDO       KGG----EPIVSLTAYTTPMAQMMD-AHCDIVLVGDSLGMVLHGLPSTLEVTMEMMILHG
PANB_CHESB       KGK----APIVCLTAYTTPIARLLD-PHCDVVLVGDSVGMVMHGLPSTLGVTLDMMIMHG
PANB_PARDP       KGG----EPVVCLTAYTTPMARLVD-AHCDIALVGDSLGMVLHGLPSTIGVSMEMMILHG
PANB_RHILO       KGG----VPLVCLTAYTYPVARLLD-PHVDLLLVGDSVSMVLHGHATTLGASLGMMIAHG
PANB_ANAMM       KGL----EKIACLTAYTFPMARILD-EHCDLILVGDSVGQTVYGMESTLSVTLDMMIAHG
PANB_PELUB       KNK----TKIISLTAYSKNIASIID-RHCDLVLVGDSLGSVLYSFSSTKKVTLDMMIEHS
PANB_HELPY       KNQ----EKIIAITAYDALFAQIFD-PLVDVILVGDSLNMSFFNQNDTLSASVEMMLYHT
PANB_HELPH       KNQ----EKIIAITAYDALFAQIFD-PLVDVILVGDSLNMSFFNQNDTLSASVKMMLYHT
PANB_HELPJ       KNQ----EKIIAITAYDALFAQIFD-PLVDVILVGDSLNMSFFNQNDTLSASVKMMLYHT
PANB_HELAH       KNH----EKIIAITAYDALFAQMFD-PIVDVILVGDSLNMSFFNQNDTLSASLEMMLYHT
PANB_HELHP       KGI----EKITAITAYDALMARIFD-GEVDVILVGDSLKMSFGGENETLGASMQEMIYHT
PANB_CAMFF       KNR----EKIVMITAYDALFARLFD-DYVDMILVGDSLNMSFGGKNETIGLSVDDMIYHT
PANB_WOLSU       KNQ----EKITMITAYDALFARLFD-GEVDILLVGDSLAMSFGGEEDTLPIGMDEMIYHT
PANB_SULDN       KGV----HPLVMITAYDALFARLLE-PSADMILVGDSLNMSFAGRDDTLSATLSQMIYHT
PANB_BDEBA       KSKK---QKISMITCYDYSFARIVADSDIDCILVGDSLAMVMLGHSTTLDVSASVMAHHT
PANB_COXBU       KKDN---KKISMVTCYDYWSACIISQSNVDCILVGDSLAMVMYGHSTTLPATVEIMAQHI
PANB_FRATT       KVT----EKISMVTCYDYTLAKIINSTDIDCILVGDSGGMVLLGKKNTTYTTLDDMQFMT
PANB_FRAT1       KVT----EKISMVTCYDYTLAKIINSTDIDCILVGDSGGMVLLGKKNTTYTTLDDMQFMT
PANB_FRATH       KVTQ---EKISMVTCYDYTLAKIINSTDIDCILVGDSGGMVLLGKKNTTYTTLDDMQFMT
PANB_FRATO       KVTQ---EKISMVTCYDYTLAKIINSTDIDCILVGDSGGMVLLGKKNTTYTTLDDMQFMT
PANB_FRATW       KVTQ---EKISMVTCYDYTLAKIINSTDIDCILVGDSGGMVLLGKKNTTYTTLDDMQFMT
PANB_FRATN       KANR---EKISMVTCYDYTLAKIINSTDIDCILVGDSGGMVLLGKKNTTYTTLDDMQFMT
PANB_LEGPH       KQEQ---KKISMLTCYDYPSACIVAESNIDCVLVGDSVAMAVHGHPTTIMATIEMMELHT
PANB_LEGPA       KQEQ---KKISMLTCYDYPSACIVAESNIDCVLVGDSVAMAVHGHPTTIMATIEMMELHT
PANB_LEGPL       KQEQ---KKISMLTCYDYPSACIVAESNIDCVLVGDSVAMAVHGYPTTIMATIEMMELHT
PANB_LEPIC       KKGK---EKISVVTCYDFSFARILNETEIDSILVGDSLGMVFQGNTSTLPVTLEEMIYHT
PANB_LEPIN       KKGK---EKISVVTCYDFSFARILNETEIDSILVGDSLGMVFQGNTSTLPVTLEEMIYHT
PANB_LEPBJ       KKGK---EKISVVTCYDFSFARILGETPIDSILVGDSLGMVFQGNSSTLPVTLEEMIYHT
PANB_LEPBL       KKGK---EKISVVTCYDFSFARILGETPIDSILVGDSLGMVFQGNSSTLPVTLEEMIYHT
PANB_HYPBU       KQRG---ERIVMVTAYDYITAKLVDEAGVDMILVGDSLGMVVLGLPSTHQVTLEDMERHT
PANB_STAMF       KGK----KKIVMVTAYDYPFAKLVDEAGVDIILVGDSAGMVVHGLPSTIPVTMDMMLLHV
PANB_AERPE       KGS----RPIVAVTAYDYPTAWIADEAGVDVILVGDSLGMVVLGYPSTLQVTLDDMVRHT
PANB_SULAC       KGK----EKITMLTAYDYPTAKIMSMTNLDGILVGDSLSMVVLGYENTLKVSMKEMLVHL
PANB_SULTO       KEKK---EKIIMLTAYDYPSAKIISQTNLDGILVGDSLGMVVLGKENTLKVTMRDMLIHL
PANB_SACS2       KSMK---EKITMLTAYDYPTAKIISNTTLDSILVGDSLGMVVLGYTNTLNVTMRDMISHT
PANB_PYRFU       KGK----EKITMITAYDYPSALLADKAGFDIVFVGDSLGMVVYGEQNTLNVTMDQMIFHT
PANB_PYRHO       KGK----EKITMITAYDYPSALLADKAGFDIVFIGDSLGMVVYGEPSTLNVTMEQMIFHT
PANB_PYRAB       KGK----EKIAMITAYDYPSALLADKAGFDIVFVGDSLGMVVYGEPNTLNVSMEQMVFHT
PANB_THEKO       KGK----EKIAMVTAYDYPSALLADKAGMDIVFVGDSLGMVVYGEPNTLNVSMEQMVFHT
PANB_PYRAE       KGP------YVWVTAYDYPTAKIVDEAGVDGILVGDSLGMVVLGLPNTLGVTLADMIRHT
PANB_PYRAR       GGP------YVWVTAYDYPTAKLVDEAGVDGILVGDSLGMVVLGLPNTLGVTLADMVRHT
PANB_PYRIL       RGP------YVWITAYDYPTAKAVDEAGVDGILVGDSLGMVLLGLPNTLGVTMEDMVRHT
PANB_PYRCJ       KGS----RKLAMVTAYDYPTARLVDEAGVDGILVGDSLGMVVLGYENTLRVTLRDMVAHV
PANB_THEMA       KGK----EKIVMVTAYDAPSARIARDAGIDVILVGDSLGNNVLGYENTIPVTMEEMLIHV
PANB_DEIRA       ELT-SSGAPLVMVTAYDYPGARHAEAAGVDLILVGDSLGNVVLGYDSTAPVTLADMIHHG
PANB_DEIGD       -----ASEPLVMVTAYDYPGARHAEAAGVDLILVGDSLGNVVLGYDSTAPVTLDDMIHHA
PANB_THET2       K-----GQRLVYLTAYDYPTARLAEAAGVDAILVGDSLGMVVLGYPSTVPVTLEEMLHHT
PANB_THET8       K-----GQRLVYLTAYDYPTARLAEAAGVDAILVGDSLGMVVLGYPSTVPVTLEEMLHHT
PANB1_METPP      K---KSGEKMVYTSVPDYTSAKWAELAGVDVAVVGDSLAMVAHGHSSTVPATMDMMVMHA
PANB_ENTFA       KLRN---EKLTMLTAYDYSTAKIIDEAGINGILVGDSLGMVCLGHEDTLSVTMEDMIHHT
PANB_CLONN       KNNG---EKLTMLTAYDYSTAKLIDESGINGILVGDSLGMVCLGYEDTLSVTMEDMIHHT
PANB_CLOAB       KFKK---EKLVMLTAYDYSTAKIIDSCDINGILVGDSLGMVCLGYENTLSVTMEDMIHHT
PANB_CLOD6       KYEG---KKLSMLTAYDYSIAKIMDECDINGILIGDSLGMVIKGEENTLSVTIDEIIYHT
PANB_HUNT2       KKQG---RKITMLTAYDYPTAKILDEAGVDSILVGDSLGMVVLGYEDTTRVTMDDMVHHT
PANB_DEHM1       KQNK---QKIAMLTAYDYPTAQILDKAGIPAILVGDSLGMVVLGYDSTVSVTMEDMLHHL
PANB_DEHMC       KQNK---QKIAILTAYDYPTAQILDKAGIPAILVGDSLGMVVLGYDSTVSVTMEDMLHHL
PANB_CARHZ       KEAG---QKIAMITAYDYPSALFAEEAGAEVLLVGDSLGMVVLGYDSTVPVTMEEMLHHV
PANB_SYNWW       KKRK---EKISMLTAYDYSLAGMVDEAGIDMILVGDSLGNVVLGYDNTLAVTMDDMIHHS
PANB_SYNAS       KKKG---EKITMLTAYDYAMASLLDEVGVEMLLVGDSLGMVVLGYESTLPVTMNDMLHHT
PANB_DESPS       KAAG---QKISMLTAYDASMSALLDQAGIDILLVGDSLGMTVLGYDSTVPVTMADMVHHM
PANB_MOOTA       KERG---ERITMVTAYDYPSSLLADRAGMDMILVGDSLGMVVLGYSSTVPVTMDEMIHHT
PANB_DESVH       KGR----QRLAMLTAYDYTSARIVDGAGADLILVGDSLGMVMLGREDTLSVTLDEMLHHC
PANB_DESVV       KGR----QRLAMLTAYDYTSARIVDGAGADLILVGDSLGMVMLGREDTLSVTLDEMLHHC
PANB_DESAG       KNT----RRLAMLTAYDYPTASIADEGGMDMLLVGDSLAMVVLGHEDTLSVTLDEMIHHC
PANB_SYNFM       KGK----RKLSELTAYDYPTALWADQSGIDMLLVGDSLAMVVLGHDDTLSVGMTEMLHHT
PANB_CENSY       KGS----EKITVVACYDYSMAALCD--GADMLLVGDSAGMVVLGYDSTTRVTMDEMCLFT
PANB_MYCTU       KAD---GHKWAMLTAYDYSTARIFDEAGIPVLLVGDSAANVVYGYDTTVPISIDELIPLV
PANB_MYCBO       KAD---GHKWAMLTAYDYSTARIFDEAGIPVLLVGDSAANVVYGYDTTVPISIDELIPLV
PANB_MYCBP       KAD---GHKWAMLTAYDYSTARIFDEAGIPVLLVGDSAANVVYGYDTTVPISIDELIPLV
PANB_MYCUA       KAE---GHKWAMLTVYDYSTARAFDDAGIPVLLVGDSAANVVYGYDTTVPISIDELIPLV
PANB_MYCPA       KAE---GHKWAMLTAYDYSTARIFDEAGIPVLLVGDSAANVVYGYDTTVPVSIDELIPLV
PANB_MYCA1       KAE---GHKWAMLTAYDYSTARIFDEAGIPVLLVGDSAANVVYGYDTTVPVSIDELIPLV
PANB_MYCLE       KAE---GHKWAMLTAYDYSTARVFDEAGIPVLLVGDSAANVVYGYDTTVPVSADELLPLV
PANB_MYCSJ       KAE---GHKWAMLTAYDFSTARAFDDAGIPVLLVGDSAANVVYGYDTTVPITIDELIPLV
PANB_MYCSK       KAE---GHKWAMLTAYDFSTARAFDDAGIPVLLVGDSAANVVYGYDTTVPITIDELIPLV
PANB_MYCSS       KAE---GHKWAMLTAYDFSTARAFDDAGIPVLLVGDSAANVVYGYDTTVPITIDELIPLV
PANB_MYCVP       KAE---GHKWAMLTAYDYSTAAVFDEAEIPVLLVGDSAANVVYGYDTTVPVTLDELIPLV
PANB_NOCFA       KAD---GERWAMLTAYDYSSARLFEEAGIPVLLVGDSAANVVYGYDTTVPITVDELIPLV
PANB_RHOJR       KAE---GERWAMLTAYDYSSARIFEEAGIPVLLVGDSAANVVYGYETTVPVTIDELLPLV
PANB_LEIXX       KEE---GSRFTGLTSYDTLTAQIFDEAGIDFLLVGDSAANTVLGYDTTLPMTVDELIPLT
PANB_SACEN       KQR---GEAWPMLTSYDMYTARIFDEAGIPVLLVGDSAANNVYGYDTTVPVTVEELIPLV
PANB_PAEAT       KDN---GEHFAMLTAYEQYTAEIFDQAGIEVLLVGDSASNNVYGNETSLPVTVDELLPLT
PANB_ARTS2       KDK---GEHFAMLTAYEQYTAEIFDEAGIEVLLVGDSASNNVFGNETSLPVTVDELLPLC
PANB_NOCSJ       KQR---GEKFAMLTAYEQYAAQTFDEAGIEVLLVGDSASNNVFANETSLPVTVDELIPLA
PANB_FRAAA       KSR---GERWSMLTAYDFTTATVFDEAEIPVLLVGDSAANVVYGYDTTVPVTVDELIPLV
PANB_FRACC       KNR---GEKWSMLTAYDATTAAVFDEAEIPVLLVGDSAANVVYGYDTTVPITVDELLPLV
PANB_ACIC1       KRQ---HRRWAMLTCYDALTARIFEEAGIDVLLVGDSAANTVLGYPDTLGVDVDELLILN
PANB_STRAW       KER---GEKWPMLTAYDAMTASVFDEAGIPVMLVGDSAGNCHLGYETTVPVTLDEMTMLS
PANB_STRCO       KER---GEKWPMLTAYDAMTASVFDESGIPVMLVGDSAGNCHLGYETTVPVTLDEMTMLS
PANB_THEFY       KER---GERWPMLTAYDALTARIFDEAGIPVLLVGDSAAMVVFGYDSTIPVTLDDMIPLT
PANB_CORGL       KVN---GQKVSVLTSYDALSARIFDEAGVDMLLVGDSAANVVLGRDTTLSITLDEMIVLA
PANB_CORGB       KVN---GQKVSVLTSYDALSARIFDEAGVDMLLVGDSAANVVLGRDTTLSITLDEMIVLA
PANB_COREF       KAN---GTKISVLTSYDAMTAAIFDEAGIDMLLVGDSAANVVLGRETTLSITLDEMIVLA
PANB_CORDI       KKN---NRPWAMLTTYDYSTTRAFVDAGIEVFLVGDSAANTMLGYSGTNQVSFEEMVMLT
PANB_CORJK       KGT---GEPFAMLTAYDYSTAVAFAEAGVEIMLVGDSAANVVFGYDATQRISMDEMVYLT
PANB_TROW8       KGSC--GRKLVGLTCYDFSTARVLSDCELDFLLVGDSASGVIYGYENTGSVCLDEIIYLA
PANB_TROWT       KGSC--GRKLVGLTCYDFSTARVLSDCELDFLLVGDSASGVIYGYENTGSVCLDEIIYLA
PANB_BACFR       KQR---GEKISMLTSYDYTMAQIVDGAGIDVILVGDSASNVMAGNVTTLPITLDQMIYHG
PANB_BACFN       KQR---GEKISMLTSYDYTMAQIVDGAGIDVILVGDSASNVMAGNVTTLPITLDQMIYHG
PANB_BACTN       KQR---GERISMLTSYDYTMAQIVDGAGMDVILVGDSASNVMAGNVTTLPITLDQMIYHA
PANB_PORGI       KSR---GEKISMLTAYDYSMAKLVDEAGMDVILVGDSASNVMAGNVTTLPITLDQMIYHG
PANB_CYTH3       KNR---GEKISMLTAYDYSMAKILDAAGVDVILVGDSASNVMAGHETTLPITLDQMIYHA
PANB_GRAFK       KSN---GEKISMLTAYDFTMAQIVDGAGIDVILVGDSASNVMAGHETTLPITLDQMIYHA
PANB_SALRD       KEE---GVPIAALTAYDYTSARLLDRAGADVLLVGDSAANVMAGHETTLPMTLDQMIYHA
PANB_CHLCH       KQQ---GEKISMLTAYDYTMARILDRAGVDVLLVGDSASNVFSGHSTTLPITIEEMIYHA
PANB_CHLPD       KQQ---GEKISVLTAYDYTMARILDRAGIDVILVGDSASNVFSGHATTLPITIEEMIYHA
PANB_PELLD       KQN---GEKISVLTAYDYTMARILDRAGIDVILVGDSASNVFSGHNTTLPITVDELIYHA
PANB_CHLTE       KER---GEKIAMLTAYDYTMARILDRSGVDAILVGDSASNVFAGHSTTLPMTVDEMIYHA
PANB_RHOBA       RDR---GERITMLTAYDFPTAKILDEAGVDVLLVGDTVGMVVQGHSTTLPVTMDQMIYHA
PANB_GEOSL       KAT---GEKITVLTSYDYPFTRIMDECGIDMILVGDSVGVVFAGHDNTLPVTVDDMLYHT
PANB_GEOMG       KAA---GEKITVLTSYDYPFTRVMDECGIDMILIGDSVGVVFSGYDNTLPVTMDEMIYHT
PANB_PELCD       KAE---GEKIAMLTAYDYPFARLMDLEGIDMVLVGDSVGPVVAGYDHTLPVTMDEMIYHC
PANB_PELPD       KQE---RRRITMMTAYDYPFARLVDSGGVDAILVGDSLGVVFSGHDNTLSVTMDEMIYHT
PANB_KORVE       KSK---HDPITCLTAYDYSTARLVDEAGIDMILVGDSLAQTMLGYENTLPVTMDEMLHHT
PANB2_BRADU      KDKG---RRVVMTTAYDAVAARIAD-PIVDIILVGDSVGNVCLGFDNTLPVSVAMMNHHL
PANB1_BRADU      KQDG---RRLVMTTAYDAVAAPIPD-PSIDISLVGDSGGNVCLGFENTPPVSVAMMNHHL
PANB_NOSS1       KQQG---RSIVALTAWDYTIAQILDGAGVDLILVGDSMA-VMLGYKTTLPITLEEMLHHA
PANB_TRIV2       KQQG---RSIVALTAWDYTIAQILDAAGVDLILVGDSMA-VMLGYKTTLPITLEEMLHHA
PANB_SYNP6       KQQG---RPIVALTAWDFAIASILDEAGIDLVLVGDSLAMVALGHPTTLPLSLEDMIHHV
PANB_SYNE7       KQQG---RPIVALTAWDFAIASILDEAGIDLVLVGDSLAMVALGHPTTLPLSLEDMIHHV
PANB_SYNY3       KRQQ---RPIVALTAWDTAIASVLDAAGVEIILVGDSLGMVALGYETTLPVSLDTMIHHT
PANB_TRIEI       KQKG---RPIVALTAYDYTIAQLLDNAGVDLILVGDSLGMVTLGYETTLPVTLEEMIHHA
PANB_THEEB       KALG---EPITMLTAWDYLWARLLDAAGVDVILVGDSLGMVALGYPTTLPVTLDQMIHHA
PANB_SYNJA       KQAG---QPLVALTAADYATAQILDRAGIDLILVGDSLAMTSLGHSSTLPLTLEQMIHHA
PANB_SYNJB       KQAG---QPLVALTAADYATAQILDQAGIDLILVGDSLAMTHLGYTSTLPLTLEQMLHHA
PANB_GLOVI       KERA---QPIVALTATEYAMARILDQAGVDLLLVGDSLSMVALGHTSTLPVTVDELLHHC
PANB_PROM0       KKKS---RKIIALTAWDSISGSIAEQANVDLVLVGDSLAMVCLGYQSTLPITLENIIYHT
PANB_PROMS       KKKS---RKIIALTAWDSISGSIAEQANVDLVLVGDSLAMVCLGYKSTLPLTLENIIYHT
PANB_PROM9       KEQS---QKIIALTAWDSISGSIAEQANVDLVLVGDSLAMVCLGYKSTLPLTLENIIYHT
PANB_PROM5       KKNS---QKIIALTAWDSISGSLAEQSGADIVLVGDSLAMVCLGYKSTLPVTLENMIYHT
PANB_PROMP       KKKS---QKIIALTAWDSISGSLAEHSGADIVLVGDSLAMVCLGYKSTLPVTLENMIYHT
PANB_PROM1       KKLG---KQITVLTAWDAISSSIVEAAGADVVLVGDSLGMVVLGHSTTLPVTLDQMLHHT
PANB_PROMT       KKLG---KQISVLTAWDAISSSIVEAAGADVVLVGDSLGMVVLGHSTTLPVTLDQMLHHT
PANB_PROM3       KQDG---RAISILTAWDGLSAALVEAAGADVVLVGDSLAMVALCHATTLPVTVEQMLHHT
PANB_PROMM       KQDG---RAISILTAWDGISAALVEAAGADVVLVGDSLAMVALCHATTLPVTVEQMLHHT
PANB_PROMA       KELG---NQITILTAWDSLSSAIVEAAGADVVLVGDSLAMFIHGHTTTLPVTLEQMLHHT
PANB_SYNPX       KQNG---RTITILTAWDSLSAALVEAAGADAVLVGDSLAMVALGHATTLPVTLDQMRHHT
PANB_SYNS9       KQSG---RPITMLTAWDCLSAALVEAAGADVVLVGDSLGMVALGHATTLPVTLDQMLHHT
PANB_SYNSC       KQKG---QPIAVLTAWDSLSAALAEAAGADVLLIGDSLAMVALGHATTLPVSLDQMLHHT
PANB_SYNS3       KQSG---RAITMLTAWDALSAALVEEAGADVVLVGDSLAMVVLGHATTLPVTLEHMLHHT
PANB_HALSA       GNTDEETDPVTMLTAYDAPTASVVDDAGVDMILVGDSVGNAKLGYDTTLPVSVDEIASAT
PANB_HALMA       AGE----EPITMLTAYDAVTASIVDDTGVDVILVGDSMGNAVLGHDDTLPVTLDEMASRV
PANB_NATPD       AGD----EPITMLTAYDAPTAEIAEAAGVDVLLVGDSVGNTRLGYDSTLPVTVDEMASHT
                              :                  .:**:          :            

PANB_ECOK1       AAV----RRGAPN-----CLLLADLPFMAYA-TPEQAFENAATVMRAG-ANMVKIEGG-E
PANB_ECOUT       AAV----RRGAPN-----CLLLADLPFMAYA-TPEQAFENAATVMRAG-ANMVKIEGG-E
PANB_ECOL6       AAV----RRGAPN-----CLLLADLPFMAYA-TPEQAFENAATVMRAG-ANMVKIEGG-E
PANB_ECOL5       AAV----RRGAPN-----CLLLADLPFMAYA-TPEQAFENAATVMRAG-ANMVKIEGG-E
PANB_SHIBS       ASV----RRGAPN-----CLLLADLPFMAYA-TPEQAFENAATVMRAG-ANMVKIEGG-E
PANB_SHISS       ASV----RRGAPN-----CLLLADLPFMAYA-TPEQAFENAATVMRAG-ANMVKIEGG-E
PANB_SHIFL       AAV----RRGAPN-----CLLLADLPFMAYA-TPEQAFENAATVMRAG-ANMVKIEGG-E
PANB_SHIF8       AAV----RRGAPN-----CLLLADLPFMAYA-TPEQAFENAATVMRAG-ANMVKIEGG-E
PANB_ECOLI       AAV----RRGAPN-----CLLLADLPFMAYA-TPEQAFENAATVMRAG-ANMVKIEGG-E
PANB_ECO57       TAV----RRGAPN-----CLLLADLPFMAYA-TPEQAFENAATVMRAG-ANMVKIEGG-E
PANB_SHIDS       TAV----RRGAPN-----GLLLADLPFMAYA-TPEQAFENAATVMRAG-ANMVKIEGG-E
PANB_SALTY       RAV----RRGAPN-----CLLLSDLPFMAYA-TPEQACENAAIVMRAG-ANMVKIEGG-A
PANB_SALPA       RAV----RRGAPN-----CLLLSDLPFMAYA-TPEQACENAAIVMRAG-ANMVKIEGG-A
PANB_SALCH       RAV----RRGAPN-----CLLLSDLPFMAYA-TPEQACENAAIVMRAG-ANMVKIEGG-A
PANB_SALTI       RAV----RRGAPN-----CLLLSDLPFMAYA-TPEQAFENAAIVMRAG-ANMVKIEGG-A
PANB_YERPA       RAV----RRGAPH-----CLLLADMPFMSYA-TPELAFTHAAELMRAG-ANMVKLEGG-S
PANB_YERPN       RAV----RRGAPH-----CLLLADMPFMSYA-TPELAFTHAAELMRAG-ANMVKLEGG-S
PANB_YERPP       RAV----RRGAPH-----CLLLADMPFMSYA-TPELAFTHAAELMRAG-ANMVKLEGG-S
PANB_YERPE       RAV----RRGAPH-----CLLLADMPFMSYA-TPELAFTHAAELMRAG-ANMVKLEGG-S
PANB_YERPS       RAV----RRGAPH-----CLLLADMPFMSYA-TPELAFTHAAELMRAG-ANMVKLEGG-S
PANB_YERE8       RAV----RRGAPH-----CLLLADMPFMSYA-TPEQTFANAAELMRAG-ANMVKLEGG-S
PANB_PECAS       QCV----RRGAPL-----ALVLSDMPFMTYA-TPEQTFSQAAELMRAG-ANMVKLEGG-S
PANB_SODGM       RCV----RRGAPS-----CLLLADLPFMSYA-TPAQTFENAAALMRAG-ANMVKLEGG-A
PANB_BAUCH       RCV----RRGAPY-----CLLIADLPFMCYA-TLYQAYDNAAALMRAG-ANIVKLEGGGC
PANB_PHOLL       RCV----RAGTPY-----TFIIADMPFMSYA-TPEQSCENAAKLMRAG-ANMVKLEGG-S
PANB_PHOPR       RCV----RAGSPN-----TLLMADMPFMSYS-TPEQACESAAELMRAG-ANMVKLEGG-A
PANB1_ALIF1      RCV----RAGSPN-----SLLMADMPFMSYA-TPEQACENAGKLMQAG-ANMVKIEGG-E
PANB_VIBVU       RCV----RAGSPN-----CLLMADMPFMSYA-TPEQACENAAQLMRAG-ANMVKIEGG-D
PANB_VIBVY       RCV----RAGSPN-----CLLMADMPFMSYA-TPEQACENAAQLMRAG-ANMVKIEGG-D
PANB_VIBPA       RCV----RAGSPN-----CLLMADMPFMSYA-TPEQACENAAKLMRAG-ANMVKIEGG-D
PANB_VIBCH       RCV----RKGSPN-----CLLMADMPFMSYA-TPEQACENAAKLVRAG-ANMVKIEGG-D
PANB2_ALIF1      KCV----RAGSPN-----AFIISDLPFMSYH-TPEAACGSAAKLMKAG-ANMVKIEGG-S
PANB_SHEON       RCV----RRGIER-----SLLIADMPFMSYA-TPEQAMENATTLMQAG-ANMVKLEGG-H
PANB_SHESA       RCV----RRGIER-----SLLIADMPFMSYA-TPEQAMENATALMQAG-ANMVKLEGG-H
PANB_SHESM       RCV----RRGIER-----SLLIADMPFMSYA-TPEQAMENATALMQAG-ANMVKLEGG-H
PANB_SHESR       RCV----RRGIER-----SLLIADMPFMSYA-TPEQAMENATALMQAG-ANMVKLEGG-H
PANB_SHESW       RCV----RRGIER-----ALLIADMPFMSYA-TPEQAMINATELMQAG-ANMVKVEGG-H
PANB_SHELP       RCV----RRGIKR-----SLLIADMPFMSYA-TPEQAMTNATALMQAG-ANMVKLEGG-H
PANB_SHEAM       RCV----RRGISR-----ALLIADLPFMSYA-TVEQTMTTATALMQAG-ANMVKLEGG-E
PANB_SHEFN       ACV----KRGVAR-----ALLIADMPFMSYS-TPEQTMNNAAILMQAG-ASMVKLEGG-H
PANB_SHEDO       ACV----RRGISR-----ALLIADMPFMSYA-TPEQAMTNATTLMQAG-ANMVKLEGG-H
PANB_COLP3       RCV----KRGVEE-----TLIIADMPFMSYA-NEEQALANAALLMQAG-ASMVKIEGG-A
PANB_AERHH       RCV----VRGTTN-----ALVVTDMPFMSYA-TPEQTYQNAARLMAAG-ARMVKMEGG-D
PANB_AERS4       RCV----ARGASN-----ALIIADMPFMSYA-TPEQTYQTAARLMAAG-ARMVKMEGG-D
PANB_PSEA6       RAV----RKGVER-----AFVIADMPFMSYS-TPEQTYLNAAKLMAAG-ASMVKLEGG-R
PANB_PSYIN       AAV----VSTAKS-----AFIIADLPFMSYS-TPEMSYENAAILMRAG-ANMVKMEGG-E
PANB_PSET1       RCV----RAGSRE-----LFVIADMPFMTYS-SPNDTCKNAAELMRAG-ANMVKLEGG-E
PANB_IDILO       QCV----RRGASN-----AFVIADMPFMTYS-TPEQAYDVAAALMQAG-ANMVKLEGG-H
PANB_BUCAI       KAV----RKGAPN-----TFLISDLPFMSYY-DTKQALKNTAKIIRSG-ANMIKMEGG-K
PANB_BUCAP       KAV----RRGAPN-----SFLLSDLPFMSYY-SIEETLKNTAKIIQSG-ANMIKIEGG-K
PANB_WIGBR       KCV----RRGAPS-----CLIISDLPFMSYN-NINDALNNSKKLIQSG-ANIVKLEGG-L
PANB2_PSEAE      ACV----KRGNKG-----SLIVTDLAFESSH-SVAQTLADAVRLMQAG-AHMVKLEGG-V
PANB2_PSEAB      ACV----KRGNKG-----SLIVTDLAFESSH-SVAQTLADAVRLMQAG-AHMVKLEGG-A
PANB_PSEPK       ASV----KRGNDG-----ALILTDLPFMAHA-TPEQAFANSATLMQAG-AHMVKIEGA-A
PANB2_PSEE4      ASV----KRGNNG-----ALILTDLPFMAHA-TPELAFTNAAQLMRAG-AHMVKIEGA-A
PANB_PSE14       ACV----KRGNQG-----AMILADLPFMANA-TLEQTFINSATLMQAG-AHMIKVEGA-A
PANB_PSEU2       ACV----KRGNQG-----AMILADLPFMANA-TLEQTLINSATLMQAG-AHMIKVEGA-A
PANB_PSESM       ACV----KRGNQG-----ALILADLPFMANA-TLEQTFINSTTLMQAG-AHMIKVEGA-A
PANB2_PSEF5      AAV----KRGNNG-----ALILADLPFMSYA-TTEQALSSSAQLMQAG-AHMLKIEGA-A
PANB_PSEPF       ASV----KRGNSD-----ALILADLPFMANA-TLEQTMTNSALLMQAG-AHMVKVEGA-L
PANB_PSEU5       ASV----KRGNRG-----AMIVADLPFMANA-TTEQTLNNSALLMQAG-AHMIKLEGT-A
PANB_MARHV       SCV----ARGNKG-----ALIMADMPFMSYG-TVADALDNAAELMRAG-AHMVKLEGT-D
PANB2_HAHCH      ASV----RRGARN-----AFIIADMPFMSYG-TPDQAMAGAKQLMQAG-AHMVKLEGG-A
PANB_ALCBS       QCV----ARGNQG-----SLIIADIPFMGAA-TLERTLNAATALMQAG-ANMVKLEGS-A
PANB_PSYA2       ANV----ARSNKQ-----ALILADLPFMSYV-TLPEAIANSRKLMQVG-AHVIKIEGG-S
PANB_PSYCK       ANI----ARSNKQ-----ALILADLPFMSYV-TLPEAVVNSRKLMQAG-AHVIKIEGG-C
PANB_ACIAD       AAV----RRGNQH-----SFIMTDLPFMSYA-TLPDALNNAKKVMQAG-AQMIKIEGG-A
PANB_CHRSD       RCV----ARGKQR-----SLLMVDLPFMSNA-DTGQLLRDAGALMRAG-AELVKIEGA-G
PANB_SACD2       EAV----ARGNSR-----SLIIGDLPFMTYA-TVEQTMINATRVMQAG-AHMVKMEGG-A
PANB_NEIMB       ECV----ARGAKN-----AMIVSDLPFGAYQQSKEQAFAAAAELMAAG-AHMVKLEGG-V
PANB_NEIMF       ECV----ARGAKN-----AMIVSDLPFGAYQQSKEQAFAAAAELMAAG-AHMVKLEGG-V
PANB_NEIMA       ECV----ARGAKN-----AMIVSDLPFGAYQQSKEQAFAAAAELMAAG-AHMVKLEGG-V
PANB_NEIG1       ECV----ARGAKN-----AMIVSDLPFGAYQQSKEQAFAAAAELMAAG-AHMVKLEGG-V
PANB_CHRVO       RCV----ARGAKN-----ALILGDMTFGAYQESPQQAFAHAARLLQAG-AHMVKLEGG-A
PANB_BURMA       ACV----ARAQPR-----GLVVADLPFGTYG-TPADAFASAVKLMRAG-AQMVKLEGG-E
PANB_BURPS       ACV----ARAQPR-----GLVVADLPFGTYG-TPADAFASAVKLMRAG-AQMVKLEGG-E
PANB_BURP0       ACV----ARAQPR-----GLVVADLPFGTYG-TPADAFASAVKLMRAG-AQMVKLEGG-E
PANB_BURP1       ACV----ARAQPR-----GLVVADLPFGTYG-TPADAFASAVKLMRAG-AQMVKLEGG-E
PANB_BURTA       ACV----ARAQPR-----ALIVADLPFGTYG-TPADAFASAVKLMRAG-AQMVKFEGG-E
PANB_BURCA       ACV----ARAQPR-----ALVVADLPFGTYG-TPVDAFANAVKLMRAG-AQMVKLEGG-E
PANB1_BURCH      ACV----ARAQPR-----ALVVADLPFGTYG-TPVDAFANAVKLMRAG-AQMVKLEGG-E
PANB1_BURCM      ACV----ARAQPR-----ALIIADLPFGTYG-TPAEAFASAVKLMRAG-AQMIKLEGG-E
PANB2_BURL3      ACV----ARAQPR-----ALIMADLPFGTYG-TPAEAFASSVKLMRAG-AQMVKLEGG-E
PANB_PARXL       ASV----ARARPA-----ALIVADLPFGTYG-TPEDAFRSSVELMRAG-AQMVKLEGG-E
PANB_CUPNH       ECA----ARGNQT-----SLLLTDLPFGTYP-TPEAAFASAVTLMKAG-AQMVKLEGG-D
PANB_CUPPJ       ECV----ARANQT-----ALLVTDLPFGTYG-TPEMAFASAVTLMRAG-AHMVKLEGG-D
PANB_CUPMC       ECV----SRGNQT-----ALLVSDLPFGTYP-TPEKAFESAAALMRAG-AQMVKLEGG-D
PANB_RALSO       ECV----ARGTTK-----ALLMSDLPFGTYG-TPEQAFHSAVRVMQAG-AQMVKLEGG-E
PANB_NITEU       RCV----ERGTHR-----VFIMADMPFGTFQVSPQEAFGNAVRLMAAG-AQMVKIEGG-Q
PANB_NITEC       CCV----ERGTHS-----VFILADMPFGTFQVSPQEAFRNAVRLMAAG-AQMVKVEGG-R
PANB_NITMU       LCV----KRGAST-----AFIMTDMPFGTSQVSPEETFRNAAELMAAG-ANMVKIEGG-S
PANB_DECAR       AAV----KRGCDR-----AFIVADMPFGSYQESPEQAFRNAATLMAAG-AQMVKLEGG-A
PANB_METFK       RCV----ANGTQH-----AFIVTDMPFGSFQKTPEQAFENAVLLMAAG-AQMVKVEGG-A
PANB_AZOSB       ECV----VRGSSR-----PFVVTDMPFGSYQESPEQAMRNAARLMAAG-AEMVKLEGG-A
PANB_AROAE       ECV----VRGSTR-----PFIVTDMPFGAYHESPSQAMHNAASLLAAG-AQMVKLEGG-T
PANB_THIDA       RCV----AAGTTR-----AFIVADLPFGSYQPSPERAYTAAARLMAAG-AHMIKLEGG-A
PANB_ACIAC       ASV----ARGLHRVQG-TAWLIADLPYGSYAEGPEQAMRSACTLMQAG-AHMVKLEGG-G
PANB_ACISJ       ASV----ARGLHRVQG-TAWLIADLPYGSYAESREQALRSACQLMQAG-AHMVKLEGG-G
PANB_VEREI       ACV----ARGLHRVQG-SAWLVADLPYGSYAESREQALRSACVLMQAG-AQMVKLEGG-G
PANB_POLNA       ECV----TRGLRRSQG-VAWVIGDLPFGTYHESKEQALRSAVVLMQAG-AHMVKLEGG-G
PANB_POLSJ       ECV----ANGLRRSHA-TAWLIGDLPFGTYHESKEQALRNAVALMQAG-AHMVKLEGG-G
PANB_RHOFT       ESV----ARGLRRAQA-TAWLIGDLPYGSYHESREQALRSAAALMQAG-SHMVKLEGG-G
PANB1_ZYMMO      RCV----SQGIARADG-SALIIADLPFGSYQQSNEQAIASAVQLMQAG-AHMVKLEGGDW
PANB2_METPP      RST----SRGTK-----AAFLIADMPFGSYQENPVQALRNAGTLMAAG-AQMVKLEGG-G
PANB_XANAC       ASV----ARALDR-----ALLVADLSFQADA-TPERALDAATQLLQAG-AEMVKIEGA-G
PANB_XANC5       AAV----ARALDR-----ALLVADLSFQADA-TPERALDAATQLLQAG-AEMVKIEGA-G
PANB_XANOM       AAV----ARALDR-----ALLVADLSFQADA-TPERALDAATQLLQAG-AEMVKIEGA-G
PANB_XANOR       AAV----ARALDR-----ALLVADLSFQADA-TPERALDAATQLLQAG-AEMVKIEGA-G
PANB_XANCP       AAV----ARVLER-----ALLVADLSFQADA-TPERALDAATQLLQAG-AEMVKIEGA-G
PANB_XANC8       AAV----ARVLER-----ALLVADLSFQADA-TPERALDAATQLLQAG-AEMVKIEGA-G
PANB_XYLFA       ACV----ARGVRQ-----AMLVVDLPFQADA-SPERALEAATPLLRVG-AQMIKIEGA-G
PANB_XYLFT       ACV----ARGVRH-----AMLVVDLPFQADA-SPERALEAATALLRVG-AQMIKIEGA-G
PANB_RUTMC       KAV----TKGAQN-----ALRISDMPYQSYT-NSEQALTNAKLLIIAG-AQMVKFEGG-C
PANB_VESOH       QAV----AKGTQN-----ALRIADMPYQSYT-YAEQTLTNAKRLIMAG-AQMVKLEGG-C
PANB_ALKEH       RCV----TAARPS-----ALVMADMPFMSYA-TLEDGLRNAARLMQEGGAQMIKLEGA-G
PANB_HALHL       RCV----ARACRR-----ALVVADLPFMSHT-GVEQGLHNAGRLMKEGGAQMVKLEGG-A
PANB_NITOC       RNV----SRGSQC-----TFILSDMPFMSYA-TPNQAMDNAARLMREGGAQMVKLEGG-R
PANB_HYDCU       QMV----QRKNHQ-----AWCIADIPFMSDM-NLSSVLDSAARLMKEGQANMVKLEGG-Q
PANB_METCA       ACV----QRAARR-----ALVLADLPFLSYC-TPEQAVRSAARLIRDGGAQVVKLEGG-R
PANB_ANADE       AMVRRGLARGDGR-----AHLVADMSFGSYQASADEAVKAAMRLVAEGGAEAVKLEGG-A
PANB_MYXXD       AAV----ARGARR-----AHVVADLPFMSYQVSNQEAVRNAGRLVAEGGAGSIKLEGG-A
PANB_MAGMM       RAV----ARGCQR-----ALVVLDMPFGSTQNGPERTFEQAARAMKESGAAAIKLEGG-Q
PANB_CAMJE       KAV----SRGAK-----KSFVLADMPFMSYQSSDRDAILNASRFIKESHANGVKVEGGI-
PANB_CAMJJ       KAV----SRGAK-----KSFVLADMPFMSYQSSDRDAILNASRFIKESHANGVKVEGGI-
PANB_CAMJR       KAV----SRGAK-----KSFVLADMPFMSYQSSDRDAILNASRFIKESHANGVKVEGGI-
PANB_AQUAE       KCV----MRGVK-----NAFVIADMPFMSYQVSMEKAVENCGRVIKETKAKAVKLEGGE-
PANB_BACAN       KAV----RRGAK-----ETFIVTDMPFMSYHVSLQDTMVNARRIVQESGAHALKVEGAG-
PANB_BACAH       KAV----RRGAK-----ETFIVTDMPFMSYHVSLQDTMVNARRIVQESGAHALKVEGAG-
PANB_BACCZ       KAV----RRGAK-----ETFIVTDMPFMSYHVSLQDTMVNARRIVQESGAHALKVEGAG-
PANB_BACHK       KAV----RRGAK-----ETFIVTDMPFMSYHVSLQDTMVNARRIVQESGAHALKVEGAG-
PANB_BACCR       KAV----RRGAK-----ETFIVTDMPFMSYHVSLQETMVNARRIVQESGAHALKVEGAG-
PANB_BACC1       KAV----RRGAK-----ETFIVTDMPFMSYHVSPQDTMVNARRIVQESGAHALKVEGAG-
PANB_GEOKA       KAV----RRGAP-----NTFIVTDMPFMSYHASKEEALQNARRIMQESGANAVKVEGAD-
PANB_GEOTN       KAV----RRGAP-----NTFIVTDMPFMSYHASKEEALQNARRIMQQSGANAVKVEGAD-
PANB_BACSU       KAV----KRGAP-----NTFIVTDMPFMSYHLSKEDTLKNAAAIVQESGADALKLEGGE-
PANB_BACLD       KAV----KRGAK-----DTFVVTDMPFMSYHCSLESALKNAAAIVQESGADALKLEGGD-
PANB_LISIN       KAV----KRGAP-----NTFVVTDMPFMTYHGSVDETIQNARKIIQESGAHAVKLEGAG-
PANB_LISW6       KAV----KRGAP-----NTFVVTDMPFMTYHGSVDETIQNARQIIQESGAHAVKLEGAG-
PANB_LISMF       KAV----KRGAP-----DTFVVTDMPFMTYHGSVDETIQNARKIIQESGAHAVKLEGAG-
PANB_LISMO       KAV----KRGAT-----DTFIVTDMPFMTYHGSVNETIQNARKIIQESGAHAVKLEGAG-
PANB_DESHY       KAA----KRGAP-----NTFIVADMPFMSCHLSIRDTLLNGARLIQETGAQAVKVEGAD-
PANB_BACHD       KAV----KRGAK-----NTFIVTDMPYLTYHGSFNETLVGAKRLMQEAGADALKLEGNG-
PANB_BACSK       KAV----KRGAP-----NTFVVTDMPFLTYHSSFSETAGHVRRLLQEAGADAVKLEGGT-
PANB_STAA3       RAV----RRGAP-----NTFVVVDMPIGAVGISMTQDLNHALKLYQETNANAIKAEGA--
PANB_STAA8       RAV----RRGAP-----NTFVVVDMPIGAVGISMTQDLNHALKLYQETNANAIKAEGA--
PANB_STAAS       RAV----RRGAP-----NTFVVVDMPIGAVGISMTQDLNHALKLYQETNANAIKAEGA--
PANB_STAAW       RAV----RRGAP-----NTFVVVDMPIGAVGISMTQDLNHALKLYQETNANAIKAEGA--
PANB_STAAN       RAV----RRGAP-----NTFVVVDMPIGAVGISMTQDLNHALKLYQETNANAIKAEGA--
PANB_STAAM       RAV----RRGAP-----NTFVVVDMPIGAVGISMTQDLNHALKLYQETNANAIKAEGA--
PANB_STAAB       RAV----RRGAP-----NTFVVVDMPIGAVGISMTQDLNHALKLYQETSANAIKAEGA--
PANB_STAAC       RAV----RRGAP-----NTFVVVDMPIGAVGISMTQDLNHALKLYQETNANAIKAEGA--
PANB_STAAR       RAV----RRGAP-----NTFVVVDMPIGAVGISMTQDLNHALKLYQETNANAIKAEGA--
PANB_STAES       KAV----KRGAS-----DTFIVVDMPIGTVGLSDEEDLKNALKLYQNTNANAVKVEGA--
PANB_STAEQ       KAV----KRGAS-----DTFIVVDMPIGTVGLSDEEDLKNALKLYQNTNANAVKVEGA--
PANB_STAHJ       KAV----RRGAD-----DTFVVVDLPIGTVGVSDEHDLKNAITLYQETNANALKAEGA--
PANB_STAS1       KAV----RRGAP-----NTYLIVDVPFGAVGVNDQYDLEIAVKLYKETDANAIKAEGA--
PANB_OCEIH       RAV----RRGAK-----DTYVVVDMPFGTIGIDASTDTAFAIELYRDTHANAIKIEGA--
PANB_BRUA2       QAV----MRGTS-----HACVIVDMPFGSYQESKEQAFRNAARVMQETGCDGVKLEGG-E
PANB_BRUAB       QAV----MRGTS-----HACVIVDMPFGSYQESKEQAFRNAARVMQETGCDGVKLEGG-E
PANB_BRUME       QAV----MRGTS-----HACVIVDMPFGSYQESKEQAFRNAARVMQETGCDGVKLEGG-E
PANB_BRUSU       QAV----MRGTS-----HACVIVDMPFGSYQESKEQAFRNAARVMQETGCDGVKLEGG-E
PANB_AGRFC       RAV----MRGVE-----HACVIVDLPFGTYQESKEQAFRNAVRLMQETGCDGVKLEGG-E
PANB_RHIEC       KAV----MRGVA-----KACVVVDMPFGSYQESKEVAFRNAVRILQETGCDAVKLEGG-E
PANB_RHIL3       KAV----MRGVG-----KACVVVDMPFGSYQESKEIAFRNAVRILQETGCDAVKLEGG-E
PANB_RHIME       QAV----MRGSE-----RCCVVVDLPFGAYQESKEQAFRSAARILKETGCSAVKLEGG-A
PANB_BORBR       RAV----MRGSQ-----RACVAVDMPFGSYQEDERQAYRNAARIMAETGASCVKLEGG-A
PANB_BORPA       RAV----MRGSQ-----RACVAVDMPFGSYQEDERQAYRNAARIMAETGASCVKLEGG-A
PANB_BORPE       RAV----MRGSQ-----RACVAVDMPFGSYQEDERQAYRNAARIMAETGASCVKLEGG-A
PANB_MAGSA       AAV----VRSSS-----RACVVVDMPFGSYQESKEQAFRNCARVMAETGCAAVKLEGG-R
PANB_RHORT       QAV----VRGSS-----HALVVVDMPFGSYQESPAQAFRNAARILSETGAAAVKLEGG-R
PANB_GRABC       AAV----VRGSS-----RACVVVDLPWGTYRESPEQAYRNAARLLAETGAGAVKLEGG-Q
PANB1_PSEAE      LAV----MRGSR-----RACVVADLPFASYQESPRQAFRNAARLLADSGAQAVKLEGG-E
PANB1_PSEAB      LAV----MRGSR-----RACVVADLPFASYQESPRQAFRNAARLLADSGAQAVKLEGG-E
PANB2_BURCH      AAV----VRGAA-----QACVVVDLPFSTFQESPAQAYRSAARLLAETGAQAVKLEGG-C
PANB2_BURCM      AAV----VRGAA-----QACVVVDLPFSTFQESPAQAYRSAARLLAETGAQAVKLEGG-C
PANB1_BURL3      AAV----VRGAA-----QACVVVDLPFSTYQESPAQAYRSAARLLAETGAQGVKLEGG-T
PANB1_PSEE4      RAV----VDCTR-----HACVIADMPFGSYQASPEQAFRNCAQVLSETGCDAVKLESN-R
PANB1_PSEF5      RAV----VAGSR-----LACVIADMPFGSYQESPQQAYRNCAEVMARTGCAALKLEGG-R
PANB1_HAHCH      AAV----TRGVS-----KACVIVDMPFGSFQESPQQAYRNAARVLVETQAQGVKMEGG-A
PANB_BARHE       QAV----MRGSK-----RALVVVDMPFGSYEESPEQAFSNASRILAETGCSAVKLEGG-V
PANB_BARQU       QAV----MRGAK-----KALVVIDMPFGSYEESPEQAFSNASRILAETGCGAVKLEGG-V
PANB_BARBK       KAV----MRGSQ-----RALVVVDMPFGSYEKSPEQAFSNASRILADTGCGAVKLEGG-I
PANB_RHOP2       HAV----MRGSQ-----HALVVVDMPFGSYEASKEQAFHSAARILKETHCGAVKLEGG-V
PANB_RHOPS       HAV----MRGSQ-----HALVVVDMPFGSYEASKEQAFHSAARILKETQCGAVKLEGG-V
PANB_RHOPA       HAV----MRGSQ-----HALVVVDMPFGSYEASKEQAFHSAARILKETHCGAVKLEGG-V
PANB_NITHX       RAV----MRGSQ-----QALVVVDMPFGSYEASKEQAFHSAARILKETLCGAVKLEGG-V
PANB_NITWN       RAV----MRGSQ-----QALVVVDMPFGSYEASKEQAFHSAARLLKETLCGAVKLEGG-V
PANB_RHOP5       RAV----MRGSK-----EALVVVDMPFGSYEASKEQAFHSAVRIMKESLCGAVKLEGG-V
PANB_RHOPB       RAV----MRGSK-----EALVVVDMPFGSYEASKEQAFHSAVRIMKESLCGAVKLEGG-V
PANB3_BRADU      CAV----MRGSS-----QALVVVDMPFGSYEGSKEQAFQSAVRIMKETLCGAVKLEGG-A
PANB_HYPNA       QAV----MRGAS-----QAMVVVDMPFGSYETNADQAFLNAVRIMKETGCQAIKIESG-A
PANB_MARMM       QAV----MRGAR-----QALVAVDMPFGSYEQSPEQAFANAARVMAETGCQAIKIESG-T
PANB_CAUVC       QAV----MRGSK-----KAMVVVDMPFGSYEASHEEAYANAVRIMKETGAQAVKVESG-P
PANB2_ZYMMO      QSV----MRGSE-----KAAVVIDMPFGSYEASPQEAYHNAVRILSETGCSAVKLEGG-S
PANB_ERYLH       AAV----VRGSY-----HSVVVVDMPFGSYEQSPQQAFESASFLLKESGAAAVKLEGG-E
PANB_NOVAD       AAV----VRGSY-----HAAVVVDMPFGSYEASPQQAFESASRLLKETGCAAVKLEGG-E
PANB_SPHAL       AAV----VRGSY-----HAAVIVDMPFGSYEGSPQQAFDNAARLLKETGAAAVKVEGG-K
PANB_RHOS1       QAV----ARGTS-----RSMLVVDMPFGSYEESPAQAFANARRLMAETGCAAVKLEGG-Q
PANB_RHOS4       QAV----ARGTS-----RSMLVVDMPFGSYEESPAQAFANARRLMAETGCAAVKLEGG-Q
PANB_RUEPO       QAV----ARGLD-----RAMLVIDMPFASYEEGPAQAFRNAARLMAETGAGAVKLEGG-V
PANB_RUEST       AAV----ARGLK-----RAMMVIDMPFGSYEQSPAQAFANAARLMAETGAAAVKLEGG-E
PANB_ROSDO       RAV----SRGLS-----RAMMVIDMPFGSYEQSPEQAFESAARLMRETGAGAVKLEGG-Q
PANB_CHESB       KAV----RRGLE-----RALMVVDMPFGSYEEGPEQAFRNAARVMAETGCAAVKLEGG-E
PANB_PARDP       KAV----ARGCS-----RACIVVDMPFGSYEEGPEQAFRNAARLMAETGCQAVKLEGG-R
PANB_RHILO       QAV----MRGSA-----RACVVVDMPAGSYEDSAAQAVASARRIVDETGCQAVKLEGG-V
PANB_ANAMM       KAV----VKARS-----KALVVVDMPFASYY-TPELAYKNASRILSETGCDAVKLEGG-V
PANB_PELUB       KSV----RMGVK-----KSLMVVDMPHNTYR-NSKEALSNAKKIISKTKCDAIKLEGG-K
PANB_HELPY       KAV----CAGAK-----TPFIITDMPFGSYK-DEKTALKNAIRVYKETQASAIKLEGG-K
PANB_HELPH       KAV----CAGAK-----TPFIITDMPFGSYK-DEKTALKNAIRVYKETQASAIKLEGG-K
PANB_HELPJ       KAV----CAGAK-----TPFIITDMPFGSYK-DEKTALKNAIRVYKETQASAIKLEGG-K
PANB_HELAH       KAV----CMGAK-----TPFIITDMPFGSYK-DEKTALKNAIKVYKETQASAIKLEGG-K
PANB_HELHP       KAV----CKGAK-----HSFIIADMPFGSYA-TPNMALKNALRFYKNTAADALKLEVG-I
PANB_CAMFF       KAV----QNGAK-----KAFLVVDMPFGSAC-TPQIALKNAIKIYKKTGCDAVKIEGT-K
PANB_WOLSU       KAV----CRGAE-----KSLVVIDMPFGSYD-TKEKALHNAIRAYKESGASAVKLEGG-I
PANB_SULDN       NAV----AKGAK-----NSFIICDMPFGTYT-NRDDALKNSIKVFQESSADALKIEGG-E
PANB_BDEBA       AAV----VRGAG-----DKFVIADLPFMSYRKGLTANMTAVEKVMK-AGAHAVKLEGA-A
PANB_COXBU       QAV----SRGAP-----NKFIIGDMPFCSYRKDLTTSMNAVERLMQ-AGAQAIKLEGADA
PANB_FRATT       QAV----ANGAT-----DKFIVADLPFMSYRQSLETTMQAVMALIQ-SGAHAIKLEGS-S
PANB_FRAT1       QAV----ANGAT-----DKFIVADLPFMSYRQSLETTMQAVMALIQ-SGAHAIKLEGS-S
PANB_FRATH       QAV----ANGAT-----DKFIVADLPFMSYRQSLETTMQAVMALIQ-SGAHAIKLEGS-S
PANB_FRATO       QAV----ANGAT-----DKFIVADLPFMSYRQSLETTMQAVMALIQ-SGAHAIKLEGS-S
PANB_FRATW       QAV----ANGAT-----DKFIVADLPFMSYRQSLETTMQAVMALIQ-SGAHAIKLEGS-S
PANB_FRATN       QAV----ANGAT-----DKFIVADLPFMSYRQSLEITMQAVTTLIQ-SGAHAIKLEGS-S
PANB_LEGPH       QAV----ARGLG-----KQFLITDLPFLGHKSSQGHTVENVKRLLQ-AGAQAVKIEGADK
PANB_LEGPA       QAV----ARGLG-----KQFLITDLPFLGHKSSQGHTVENVKRLLQ-AGAQAVKIEGADK
PANB_LEGPL       QAV----ARGLG-----KQFLITDLPFLGHKSSQGHTVENVKRLLQ-AGAQAVKIEGADK
PANB_LEPIC       KAV----RRGAP-----DKFLIADLPFLSYQTSIEEGIRSAGKIMKESDCDAVKIEGGSE
PANB_LEPIN       KAV----RRGAP-----DKFLIADLPFLSYQTSIEEGIRSAGKIMKESDCDAVKIEGGSE
PANB_LEPBJ       KVV----RRGAP-----DKFIIADLPFLSYQTSIEEGIRSAGRMMKETDCDAVKIEGGSD
PANB_LEPBL       KVV----RRGAP-----DKFIIADLPFLSYQTSIEEGIRSAGRMMKETDCDAVKIEGGSD
PANB_HYPBU       AAV----ARAQP-----RALIVADMPFMSYEASTRDAVLNAGRLIA-AGADAVKIEGG-A
PANB_STAMF       SSV----ARAKP-----RALIVGDMPFLSYEVSIEEAVRNAGLMLK-SGAEAVKIEGG-S
PANB_AERPE       AAV----ARAAK-----RPLIVADMPFGSYEPSSSAAVESAVALAR-VGAEAVKLEGG-S
PANB_SULAC       DSV----VRAKP-----RQLVVADMPFLSYEVSANTAVKNAGLFVR-HGADSVKLEGG-E
PANB_SULTO       DAV----VKAKP-----PQLIVADMPFLSYETSIKDAVKNAGLLAR-HGADAVKLEGG-E
PANB_SACS2       RAV----ARANP-----PQLIVSDMPFLSYEIDVKSAVKNAGLLVK-AGSDAVKLEGG-E
PANB_PYRFU       RAV----AKAVK-----RALVLADMPFGSYEVSVEEGVKNAIKLIQ-AGADAVKIEGG-Y
PANB_PYRHO       RAV----AKAVK-----RALVLADMPFGSYEVSVEEGIKNAIKLVQ-AGADAVKIEGG-Y
PANB_PYRAB       RAV----ARAVK-----RALVLADMPFGSYEVSVEEGIKNAIKLIQ-AGADAVKIEGG-Y
PANB_THEKO       RAV----AKAVK-----RALVLADMPFGSYEVSVEEGVKNAMRLIR-AGADAVKIEGG-Y
PANB_PYRAE       QAV----ARARP-----RALVVADMPFMSYETGPRDALRNASKLIK-AGADAVKLEGG-A
PANB_PYRAR       QAV----ARAAP-----KALVVADMPFMTYETGPRDALRNAARLIR-AGAEAVKLEGG-S
PANB_PYRIL       EAV----ARAKP-----RALVVADMPFMSYETGPEDALKNAARLIR-AGADAVKLEGG-A
PANB_PYRCJ       AAV----ARARP-----RALVVADMPFMTYETGPRDALRAAAKLVR-AGAEAVKPEGG-V
PANB_THEMA       AAV----KRGAP-----DAFIVADMPFLSYQTSVEKAVENAGKFLK-VGANAVKIEGG-E
PANB_DEIRA       KAV----RRGAP-----NTFLVVDLPFGTYHAGVTDAMRHAVRVIQETGADAVKMEGSTP
PANB_DEIGD       RAV----RRGAP-----NTFLVVDLPFGTYHTGVTDAMRNAVRVIQQTGADAVKLEGATP
PANB_THET2       KAA----RRGAP-----ETFLVADLPYLAYAT-LDRALLAAERLLKEGGADAVKLEGGE-
PANB_THET8       KAA----RRGAP-----ETFLVADLPYLAYAT-LDRALLAAERLLKEGGADAVKLEGGE-
PANB1_METPP      QAV----RRGAP-----RTFTLGCMPYQSYNT-VDRALLNATRFMQDGGCDAVKPQGGR-
PANB_ENTFA       RAV----TRGAK-----NTLVVADMPFMSYQTSVYDSVVNAGRLIKEGRAQVVKLEGG-I
PANB_CLONN       RAV----SRGVK-----NTLVVGDMPFMSYQSSVYDAVVNAGRLIKEGGATAVKLEGG-A
PANB_CLOAB       KAV----VRGAK-----STLIVADLPFMSYQTSVYDAVFNAGRLVKEAGATAIKLEGG-A
PANB_CLOD6       KAV----KNGVK-----NALIVSDMPFLSYHVSIEDAVKNAGRLIKEGGAHAVKLEGG-S
PANB_HUNT2       KAV----VRGVK-----RAMVVADMPFLSYHTGKNDSVRNAGRLVSEGGCKAVKLEGG-E
PANB_DEHM1       KAV----VRGSQ-----KAMVIADMPFMTYHLSPEQALLNAGRFMQEGGAQAVKLEGG-V
PANB_DEHMC       KAV----VRGSQ-----KALIIADMPFMTYHLSPEQALLNAGRFIQEGGAQAVKLEGG-V
PANB_CARHZ       KAV----VRGSK-----RSMVVADMPFMSYQASYTDALYNAGRFLKEGGAQAVKLEGG-G
PANB_SYNWW       KTV----VRASK-----NAMVVGDMPFLSYHISKKEAVRNAGRFIQEAGCSAVKLEGG-S
PANB_SYNAS       RAV----SRGAN-----NAMVVADLPFMSYQCSVEEAVRNAGRFLQEAGAHAVKLEGG-R
PANB_DESPS       AAV----RRGAP-----DAFVVGDMPFGSYQTGARDAVLNAMRLLKEGGCDVVKLEGG-E
PANB_MOOTA       KAV----VRANP-----AALVVADLPFLSYQTSVPDAVYNAGRLIKEGGADAVKLEGG-Q
PANB_DESVH       RAV----VRGTR-----HAMVVADMPFMTYETGVRDALLNGARLFRESGVRAVKLEGA-G
PANB_DESVV       RAV----VRGTR-----HAMVVADMPFMTYETGVRDALLNGARLFRESGVRAVKLEGA-G
PANB_DESAG       RAV----TRGAS-----RALVVGDLPFMTYEQGPDQAMHSAARLFREGGVRAVKLEGG-K
PANB_SYNFM       SAV----ARGAK-----RALVIGDMPFMSYQVSVEEALYNAGLFLKEAKAQAVKLEGG-R
PANB_CENSY       GAV----SRGRK-----DSMVVGDLPFMSYQACTADAIRNSGRLVR-AGADAVKLEGG-A
PANB_MYCTU       RGV----VRGAP-----HALVVADLPFGSYEAGPTAALAAATRFLKDGGAHAVKLEGG-E
PANB_MYCBO       RGV----VRGAP-----HALVVADLPFGSYEAGPTAALAAATRFLKDGGAHAVKLEGG-E
PANB_MYCBP       RGV----VRGAP-----HALVVADLPFGSYEAGPTAALAAATRFLKDGGAHAVKLEGG-E
PANB_MYCUA       RGV----VRGAP-----HALVVADLPFGSYESGPSAALAAATRFMKEAGAHAVKLEGG-E
PANB_MYCPA       RGV----VRGAP-----HALVVADLPFGSYEAGPAAALAAATRFMKEGGAHAVKLEGG-E
PANB_MYCA1       RGV----VRGAP-----HALVVADLPFGSYEAGPAAALAAATRFMKEGGAHAVKLEGG-E
PANB_MYCLE       RGV----VRGAG-----HALVVADLPFGSYEPGPTAALAVATRFMKEGGAHAVKLEGG-Q
PANB_MYCSJ       RGV----VRGAP-----HALVVADLPFGSYEEGPRQALATATRFLKETGAHAVKLEGG-E
PANB_MYCSK       RGV----VRGAP-----HALVVADLPFGSYEEGPRQALATATRFLKETGAHAVKLEGG-E
PANB_MYCSS       RGV----VRGAP-----HALVVADLPFGSYEEGPRQALATATRFLKETGAHAVKLEGG-E
PANB_MYCVP       RGV----VRGAP-----HALVVADLPFGSYEAGPQQALATATRMLKETGAHAVKLEGG-E
PANB_NOCFA       RGV----VRGAP-----HALVVADLPFGTYEGSAQQALAAATRFMKEGGAHAVKLEGG-E
PANB_RHOJR       RGV----VRGAP-----HALVVADLPFGSYESSPEQALASATRFMKEGLAHAVKLEGG-E
PANB_LEIXX       RAV----ARAAK-----RAFVVADLPFGSYETGPQEALRTAVRFMKETGAHAVKLEGG-E
PANB_SACEN       RAV----TRGAR-----SALVVADLPFGSYEASPEQALATAVRFMKEGGAHAVKLEGG-R
PANB_PAEAT       RAV----SRSAK-----RALIVADLPFGSYEVSPGQAVATGVRFLKEGLAHAVKIEGT-A
PANB_ARTS2       RAV----ARSAK-----RALVVADLPFGSYEVSAEQAVATGVRFLKEGLAHAVKIEGG-K
PANB_NOCSJ       RAV----SRSVR-----RALVVADLPFGSYQASPEQAYLTAVRFMKEANAHAVKLEGG-I
PANB_FRAAA       RAV----VRGAP-----HAMVVADLPFGSYQAGPEQALATATRFLKEGGAQAVKLEGG-A
PANB_FRACC       RAV----VRGAP-----HAMVVADLPFGSYQGGPAEALASATRFLKEGGAHAVKLEGG-S
PANB_ACIC1       RAV----ARAAQ-----RALVVADLPFGSYQISPRQALQTAIRFVKRAGVQAVKFEGG-R
PANB_STRAW       AAV----VRGTS-----RALIVGDLPFGSYQEGPVQALRSATRLVKEAGVGAVKLEGG-E
PANB_STRCO       AAV----VRGTS-----RALIVGDLPFGSYQEGPVQALRSATRLVKEAGVGAVKLEGG-E
PANB_THEFY       AAV----SRATK-----RALVVADLPFGSYQAGPEQALESAARLMKEGGAQAVKLEGG-H
PANB_CORGL       KAV----TIATK-----RALVVVDLPFGTYEVSPNQAVESAIRVMRETGAAAVKIEGG-V
PANB_CORGB       KAV----TIATK-----RALVVVDLPFGTYEVSPNQAVESAIRIMRETGAAAVKIEGG-V
PANB_COREF       KAV----TIAAK-----RALVIVDLPFGTYEVSEQQAVESAVRVMRETGAAAVKIEGG-V
PANB_CORDI       AAV----VRGAG-----PAMVVADLPFGTYEASDEQAVRSATEMVRRTGAHVVKLEGG-V
PANB_CORJK       AAV----VRGAG-----NAAVVADLPFGTYEASDEQAVKAASEMLHRTGAHAVKIEGG-V
PANB_TROW8       AGV----VRGAP-----NSFIIVDLPFGTYEKSDELAVETAIEVIKRTGASAVKLEGG-A
PANB_TROWT       AGV----VRGAP-----NSFIIVDLPFGTYEKSDELAVETAIEVIKRTGASAVKLEGG-A
PANB_BACFR       KSV----VRGVK-----RAMVVVDMPFGSYQGNEMEGLASAIRIMKESHADALKLEGG-E
PANB_BACFN       KSV----VRGVK-----RAMVVVDMPFGSYQGNEMEGLASAIRIMKESHADALKLEGG-E
PANB_BACTN       KSV----VRGVK-----RAMVVVDMPFGSYQGNEMEGLASAIRIMKESHADALKLEGG-E
PANB_PORGI       KSV----VKAVK-----RALVVVDLPFGSYQGNSKEALCSAIRVMKETHADCIKLEGG-E
PANB_CYTH3       SSV----IRAIN-----RALVVVDLPFGSYQGNSSEALRSAIRIMKESGAHAVKMEGG-I
PANB_GRAFK       TSV----VRAIT-----RSLVVVDLPFGSYQSDPKEALRSAIRIMKESGGHAVKLEGG-K
PANB_SALRD       QCV----VRGID-----RSLVVVDLPFGAYQGDPTEALDSAIRVMKEAGAHAVKLEGG-A
PANB_CHLCH       KAV----VRGVHDETG-RAMVVIDMPFMSYQLSSEEALRNAGKIMKEHECDAVKMEGG-H
PANB_CHLPD       KAV----VRGVHDESG-RAMVVVDMPFMSYQISGDEALRNAGKIMKEHGCDALKLEGG-K
PANB_PELLD       KGV----VRGVQAETS-RAMVVVDMPFMSYQLSPEDALRNAGKIMKEHECDAVKMEGG-R
PANB_CHLTE       KAV----VRGVQAETR-RAMVIVDMPFMSYQLSPEDAVRNAGKIMKEHECDAVKMEGG-K
PANB_RHOBA       EMV----GRAAD-----HAMVVVDLPFPDGQLDLLHSVRCGARVLKETQCHAVKLEGG-A
PANB_GEOSL       RAV----TRARP-----KALVVTDMPFLSYQTDLRDARINAGRLVKEGGAEAVKLEGG-A
PANB_GEOMG       RAV----VRARP-----KALVVADMPFLSYQTDLRDARLNAGRLVKDGGAEAVKLEGG-S
PANB_PELCD       RAV----ARGLG-----QAFLVADMPFLSYQVDLREARLNAGRLVKEGCAQAVKLEGG-E
PANB_PELPD       RAV----ARAKP-----QAVLVTDMPFMSYQVSVEEACRNCGRMIQEGGAQAVKIEGG-M
PANB_KORVE       RAV----RRAVR-----HAFLIADMPYASYHVGGRESVRNAARFIKEGGAEAVKIEGG-E
PANB2_BRADU      EAV----ARTRPH-----ALLVADMPFLSFHVGSEDTIRNAGGFLQRG-ADAVKLEGG-A
PANB1_BRADU      EAA----VRSKPR-----ALLVADMSFLSFHVSVEETIRNAGGFLQRG-AAAARLEGG-G
PANB_NOSS1       KAV----CRGVQ-----RALVVVDLPFLTYQESIPQAINSAGRILKETGAQAVKLEGGYP
PANB_TRIV2       KAV----CRGVQ-----RALVVVDLPFLTYQESIPQAINSAGRILKETGAQAVKLEGGYP
PANB_SYNP6       QAV----QRGCR-----NALIVSDLPFLSYQTSPEDAILAAGQLLKVTEAQAVKLEGGYP
PANB_SYNE7       QAV----QRGCR-----NALIVSDLPFLSYQTSPEDAILAAGQLLKVTEAQAVKLEGGYP
PANB_SYNY3       AAV----KRGVQ-----RALVVCDLPFLTYQESPAQAMGSAGRVLQETGAQAVKLEGGHP
PANB_TRIEI       KAV----RRAVK-----QALMVVDLPFLTYQESPQQAIHSAGRILKETGAQAVKLESGNE
PANB_THEEB       QAV----RRGVS-----HSFLVCDLPFLSYQESPEQALRSAGRLIKEAEVQAVKMEGASP
PANB_SYNJA       QAV----RRGVE-----RAFLVADLPFLSYQVCKEQALLSAGRLMKEAGVNGVKLEGGYP
PANB_SYNJB       QAV----RRGVE-----RAFLVADLPFLTYQVHKEQALLSAGRLMKEAGVNGVKLEGGYP
PANB_GLOVI       RAV----RRGVE-----RALLVADLPFGSYEQSPQQAFSTATRFLKEAGVQAVKLEGGYP
PANB_PROM0       NAV----SRGFKKKIEEQPLVVSDMPFMTYQCGEDKAVEYAGKIIQSTYAKAVKVEGAEP
PANB_PROMS       NAV----SRGFKKKIEEQPLVVSDMPFLTYQCGEDKAVEYAGKIIQSTYAKAVKVEGAEP
PANB_PROM9       NAV----SRGFKKKIEEQPLLVTDMPFLTYQCGEDKAVEYAGKIIQSTYAKAVKVEGAEP
PANB_PROM5       NAV----SRGFSREIEEHSLLVCDMPFLTYQCGEDKAVEYAGKIIKNTYAKAVKIEGAEP
PANB_PROMP       NAV----SRGFSKEIEEQSLLVCDMPFLTYQCGENKAVEYAGKIIKNTYAKAVKVEGADP
PANB_PROM1       KAV----CRGFCRPLSKQPLVVCDLPFLSYQCGEDKAVEAAGTLLKNSTASAVKLEGAEP
PANB_PROMT       KAV----CRGFCKPLSKQPLVVCDLPFLSYQCGEDKAVEAAGTLLKNSTASAVKLEGAEP
PANB_PROM3       QAV----GRGFTRPLPQQPLVVCDLPFLSYQCGEDKAVAAAGSLLKHSCAAAVKLEGAEP
PANB_PROMM       KAV----GRGFTRPLPQQPLVVCDLPFLSYQCGEDKAVAAAGSLLKHSCAAAVKLEGAEP
PANB_PROMA       QAV----GRGFLSPKNKQPLVVCDLPFLSYQCGEDKAVAAAGTLLKNSCAAAVKIEGAEP
PANB_SYNPX       LAV----SRGFAAAPSKQPLLICDLPFLSYQCGADLAVQAAGTLLKETPAAAVKLEGAEA
PANB_SYNS9       LAV----ARGFTASHDQQPLLVCDLPFLSYQCGPDLAVAAAGKLLKESSAAAVKLEGADP
PANB_SYNSC       QAV----ARGLTTMPADQPLLVCDLPFLSYQCGEDRAVAAAGRLLKESSAAAVKLEGAEP
PANB_SYNS3       QAV----CRGMSKPLAQQPLVVCDLPFLSYQCGLDRAVAAAGTILKESDAAAIKLEGGEP
PANB_HALSA       GAV----ARATA-----DAVVVADMPFLSFGADETESVRNAGRMLKEEDADAVKLESG-P
PANB_HALMA       GAV----ARGAD-----DALVVADMPFLSFGAHESESIQNCGRMLKEEGANAIKLESG-P
PANB_NATPD       AAV----ARATD-----DALVVADMPFLSFGADEADAVDNCGRMLKEADADAVKLECG-P
                                         :.                           : :    

PANB_ECOK1       WLVETVQMLTERAVPVCGHLGLTPQSVNIFGGYKVQGRGDEAGDRLLSDALALEAAGAQL
PANB_ECOUT       WLVETVQMLTERAVPVCGHLGLTPQSVNIFGGYKVQGRGDEAGDRLLSDALALEAAGAQL
PANB_ECOL6       WLVETVQMLTERAVPVCGHLGLTPQSVNIFGGYKVQGRGDEAGDRLLSDALALEAAGAQL
PANB_ECOL5       WLVETVQMLTERAVPVCGHLGLTPQSVNIFGGYKVQGRGDEAGDRLLSDALALEAAGAQL
PANB_SHIBS       WLVETVKMLTERAVPVCGHLGLTPQSVNIFGGYKVQGRGDEAGDQLLSDALALEAAGAQL
PANB_SHISS       WLVETVKMLTERAVPVCGHLGLTPQSVNIFGGYKVQGRGDEAGDQLLSDALALEAAGAQL
PANB_SHIFL       WLVETVKMLTERAVPVCGHLGLTPQSVNIFGGYKVQGRGNEASDRLLSDALALEAAGAQL
PANB_SHIF8       WLVETVKMLTERAVPVCGHLGLTPQSVNIFGGYKVQGRGNEASDRLLSDALALEAAGAQL
PANB_ECOLI       WLVETVQMLTERAVPVCGHLGLTPQSVNIFGGYKVQGRGDEAGDQLLSDALALEAAGAQL
PANB_ECO57       WLVETVKMLTERAVPVCGHLGLTPQSVNIFGGYKVQGRGDEASDRLLSDALALEAAGAQL
PANB_SHIDS       WLVETVKMLTERAVPVCGHLGLTPQSVNIFGGYKVQGRGDEASDRLLSDALALEAAGAQL
PANB_SALTY       WLVDTVKMLTERAVPVCGHLGLTPQSVNIFGGYKIQGRGD-AGQVLLDDALALEAAGAQL
PANB_SALPA       WLVDTVKMLTERAVPVCGHLGLTPQSVNIFGGYKIQGRGD-AGQVLLDDALALEAAGAQL
PANB_SALCH       WLVDTVKMLTERAVPVCGHLGLTPQSVNIFGGYKIQGRGD-AGQVLLDDALALEAAGAQL
PANB_SALTI       WLVDTVKMLTERAVPVCGHLGLTPQSVNIFGGYKIQGRGD-AGQILLDDALALEAAGAQL
PANB_YERPA       WLCDTIRMLAERAVPVCGHLGLTPQSVNIFGGYKVQGREEVAANQLLQDAIALEQAGAQL
PANB_YERPN       WLCDTIRMLAERAVPVCGHLGLTPQSVNIFGGYKVQGREEVAANQLLQDAIALEQAGAQL
PANB_YERPP       WLCDTIRMLAERAVPVCGHLGLTPQSVNIFGGYKVQGREEVAANQLLQDAIALEQAGAQL
PANB_YERPE       WLCDTIRMLAERAVPVCGHLGLTPQSVNIFGGYKVQGREEVAANQLLQDAIALEQAGAQL
PANB_YERPS       WLCDTIRMLAERAVPVCGHLGLTPQSVNIFGGYKVQGREEVAANQLLQDAIALEQAGAQL
PANB_YERE8       WLCDTVRMLAERAVPVCGHLGLTPQSVNIFGGYKVQGREEVAANQLLKDAQALENAGAQL
PANB_PECAS       WLAPTVKMLTERAVPVCGHLGLTPQSVNIFGGYKIQGRSESDANQLLADALALEEAGAQL
PANB_SODGM       WLADTVNGLTARAVPVCGHLGLTPQSVNIFGGYKIQGRDAVGADQLLADARTLEQAGAQL
PANB_BAUCH       WVTKIVRCLTDRAVPVCCHLGLTPQSVNILGGYKIQGRDKDSADRILSESIALELAGAQM
PANB_PHOLL       WLYDTINMLTERSVPVCAHLGLTPQSVHILGGYKVQGRDEVSANQLIKDAITLEKAGIQL
PANB_PHOPR       WLAETITKLTERAVPVCAHLGLTPQSVNIFGGYKVQGRDSDHAAQMVKDAILLKNAGAQI
PANB1_ALIF1      WIAETVRVLAERAVPVCAHLGLTPQSVNIFGGFRIQGRDEAKAEQMVKDALTLEAAGAQI
PANB_VIBVU       WLVDTVKMLTERAVPVCAHLGLTPQSVNIFGGYKVQGRDQEKADRMVKDALALQAAGAQI
PANB_VIBVY       WLVDTVKMLTERAVPVCAHLGLTPQSVNIFGGYKVQGRDQEKADRMVKDALALQAAGAQI
PANB_VIBPA       WLVDTVKMLTERAVPVCAHLGLTPQSVNIFGGYKIQGRDQEKADRMVKDALALQEAGAQI
PANB_VIBCH       WLVDTVKMLTERAVPVCAHLGLTPQSVNIFGGYKVQGREQDKADRMVRDALALQEAGAQI
PANB2_ALIF1      WLINTVKMLTERAVPVCAHLGLMPQAVNIYGGYKLQGKTEEQATKMLENAKELQRAGAQA
PANB_SHEON       WLLETVTKLTERGIPVCAHLGLTPQSVNVFGGFKVQGRDAENAQRIIDEAKALEAAGAQL
PANB_SHESA       WLLETVTKLTERGIPVCAHLGLTPQSVHVFGGFKVQGRDAENAQRILDEAKALEAAGAQL
PANB_SHESM       WLLETVTKLTERGIPVCAHLGLTPQSVHVFGGFKVQGRDAENAQRILDEAKALEAAGAQL
PANB_SHESR       WLLETVTKLTERGIPVCAHLGLTPQSVHVFGGFKVQGRDAENAQRILDEAKALEAAGAQL
PANB_SHESW       WLLETVTKLTERGIPVCAHLGLTPQSVHVFGGFKVQGRDAENAQRILDEAKALEAAGAQL
PANB_SHELP       WLLETVTKLTERGIPVCAHLGLTPQSVHVFGGFKVQGRDADNAQRIIDEAKAIEAAGAQL
PANB_SHEAM       WLLESVKKLTERGVPVCAHIGLTPQSVHVFGGFKVQGRDADNAQRILNEAKALEAAGAQL
PANB_SHEFN       WLLESVKMLTERGIPVCAHLGLTPQSVNVFGGFKVQGRDADNAQRILDEAKALQAAGAQL
PANB_SHEDO       WLLETVTMLTQRGIPVCGHLGLTPQSVHVFGGFKMQGKDEKNAQRILDEALALQDAGAQL
PANB_COLP3       WLNGTISALVERGVPVCAHLGLTPQSVNIFGGFKVQGRDDDKAQQMIADAKALEAAGAQL
PANB_AERHH       WLCDSIRHLTRNGVPVCGHLGLTPQSVHVFGGFKVQGRDEFQAQEIYRQALELQAAGIQL
PANB_AERS4       WLCDSIRHLTRNGVPVCGHLGLTPQSVHVFGGFKVQGRDEYQAQEIYRQALCLQEAGIQL
PANB_PSEA6       WLLESIQGLNERGVPVCGHLGLTPQSVHVFGGFKVQGRDDLQAEQMLEQAKEMAAAGIQL
PANB_PSYIN       WLTDSVKGLVERGIPVCGHLGLTPQSVNIFGGYKVQGREEEQADELLNDALLLQEAGIQL
PANB_PSET1       WLFESIEALTQQGIPVCGHLGLTPQSVHVFGGFKVQGRAEEQALKIIADAKALEAAGAQL
PANB_IDILO       WLVETIEGLKTRGIPVCAHLGLLPQSVNVLGGYKVQGKEQQQADDTLNQALALEQAGAQL
PANB_BUCAI       WLIEIIRELSNRLILICGHIGLIPQSFHYLGGYKVQGRKENDANKLIDEALLLEESGINM
PANB_BUCAP       WLVETVKELSKRSILVCGHIGLTPQSINFLSGYKIQGKEKNDAQRIIDEAFILEEAGIKM
PANB_WIGBR       WVSDIIHELNTRSIPVCGHIGLTPQSINMQGSYKIQGRNNNDAIRLMEEAISIEESGAKL
PANB2_PSEAE      WLAEPIARLAQMGVPVCAHLGLTPQAVNLFGGFKVQGRQETQARQLRADAIALEQAGAAM
PANB2_PSEAB      WLAEPIARLAQMGVPVCAHLGLTPQAVNLFGGFKVQGRQETQARQLRADAIALEQAGAAM
PANB_PSEPK       WLAETIRLLAERGVPVCAHMGLTPQTVNVLGGYKVQGRQEAQARQMRADAIALEQAGAAM
PANB2_PSEE4      WLAETIRLLAERGVPVCAHMGLTPQTVNVLGGYKVQGRQEAQARQMRADAIALEQAGAAM
PANB_PSE14       WLGESIRLLAERGIPVCAHMGLTPQAVNVLGGYKVQGRLEAQARQMRADAIALEQAGAAM
PANB_PSEU2       WLAESIRLLAERGIPVCAHMGLTPQAVNVLGGYKVQGRLETQARQMRADAIALEQAGAAM
PANB_PSESM       WLGESIRLLAERGIPVCAHMGLTPQSVNVLGGYKVQGRLEAQARQMRADAIALEQAGAAM
PANB2_PSEF5      WLAEPVRLLNERGVPVCVHMGLTPQTVNVLGGYKVQGRNESQARQMRADAIALEQAGAAM
PANB_PSEPF       WLADSIRLLAERGVPVCAHMGLTPQAVNILGGYKVQGRNENQARQMRADAISLEQAGAAM
PANB_PSEU5       WLAESIRLLADRGIPVCAHMGLTPQAVNLFGGYKVQGREEAQAQQMLEDAKSLEAAGAAM
PANB_MARHV       WMKDTIEALSERGVPVCAHLGLTPQFVNKFGGYKVQGRDEKAAEAMIEHACELEAAGADL
PANB2_HAHCH      WLCDAIAHLSRQGVPICAHLGLTPQSVNKFGGYKVQGKEASQAQLMLDDAKALEQAGADI
PANB_ALCBS       WLAEAIEVLNRNGVPVCAHMGLTPQAVNSLGGYRVQGKDDDGAAELLNAAKILDQAGTAL
PANB_PSYA2       ELCELVTMLAQAGTPTCVHLGLTPQSVNVFGGYKVQGRGDEAGQKLLDDAKAVVNAGAAL
PANB_PSYCK       ELCELITTLAQAGTPTCVHLGLTPQSVNVFGGYKVQGRGNEAGQKLLDDAKAVVDAGAAL
PANB_ACIAD       WLSESIRVLTQNGIPVCVHLGLTPQSVHVFGGYKLQAKTREAADQLIADCQAVVDAGAAI
PANB_CHRSD       WMHEGVRELTRRGVPVCAHLGLTPQSVHQFGGYKVQGREQDDAQRIIDDARLLVEAGASV
PANB_SACD2       WLVDSVRMLSERGIPVCAHLGLTPQSVNKFGGFRVQGRSEEQGEQIIADALALEEAGADL
PANB_NEIMB       WMAETTEFLQMRGIPVCAHIGLTPQSVFAFGGYKVQGRGGK-AQALLNDAKAHDDAGAAV
PANB_NEIMF       WMAETTEFLQMRGIPVCAHIGLTPQSVFAFGGYKVQGRGSK-AQALLNDAKAHDDAGAAV
PANB_NEIMA       WMAETTEFLQMRGIPVCAHIGLTPQSVFAFGGYKVQGRGGK-AQALLNDAKAHDDAGAAV
PANB_NEIG1       WMAETTEFLQMRGIPVCAHIGLTPQSVFAFGGYKVQGRGGK-AQALLNDAKAHDEAGAAV
PANB_CHRVO       YMAETTRFLVERGIPVCSHIGLTPQYVNMFGGYRVQGRGED-AQRILNDAKVLAEAGASL
PANB_BURMA       WLAETVRFLVERAVPVCAHVGLTPQSVHAFGGFKVQGKTEAGAAQLLRDARAVEEAGAQL
PANB_BURPS       WLAETVRFLVERAVPVCAHVGLTPQSVHAFGGFKVQGKTEAGAAQLLRDARAVEEAGAQL
PANB_BURP0       WLAETVRFLVERAVPVCAHVGLTPQSVHAFGGFKVQGKTEAGAAQLLRDARAVEEAGAQL
PANB_BURP1       WLAETVRFLVERAVPVCAHVGLTPQSVHAFGGFKVQGKTEAGAAQLLRDARAVEEAGAQL
PANB_BURTA       WLAETVRFLVERAVPVCAHVGLTPQSVHAFGGFKVQGKTEAGAAQLLRDARAVEEAGAQL
PANB_BURCA       WLADTIRFLVERSVPVCAHLGLTPQSVHAFGGFKVQGKTEAGAAQLLRDARAIEDAGAQL
PANB1_BURCH      WLADTIRFLVERSVPVCAHLGLTPQSVHAFGGFKVQGKTEAGAAQLLRDARAIEDAGAQL
PANB1_BURCM      WLAETIRFLVERAVPVCAHVGLTPQSVHAFGGFKVQGKTEAGAAQLLRDARAVEDAGAQL
PANB2_BURL3      WLAETIRFLVERAVPVCAHVGLTPQSVHAFGGFKVQGKTEAGAAQLLRDARAVEAAGAQV
PANB_PARXL       WLADTVRFLVERSIPVCAHVGLTPQSVHAFGGFKVQGKTEAGATQLLRDSLAVQAAGAQL
PANB_CUPNH       WLAPIVKFLVERSIPVCAHIGLTPQSVHALGGFKVQGKTNAGAAQLKRDALALQAAGAQV
PANB_CUPPJ       WLAPTVKFLVERSIPVCAHIGLTPQSVHAFGGFKVQGKTDEGAAQLRRDAQAMEAAGAQI
PANB_CUPMC       WLAPTVKFLVERSIPVCAHIGLTPQSVHALGGFKVQGKTDESAAQLKRDALALQQAGAQL
PANB_RALSO       WLAPTLRFLVERSIPVCAHIGLTPQSVHAFGGFKVQGRGDEAAAQLKADALAVQDAGAQM
PANB_NITEU       HMAETVEFLSCRGIPVCAHIGLMPQFVHQLGGYRVQGKTPNDARQLREDALLLQEAGAAM
PANB_NITEC       HMAETIEFLTCRGIPVCAHIGLIPQSVHQLGGYKIQGKTPDGARQLLEDALLLQKAGAAM
PANB_NITMU       VMAETVEFLTQRGIPVCAHIGLTPQSVNQLGGYKVQGKTDYEAEQLLEDAVALEQAGAGM
PANB_DECAR       DMAPTVRFMVSRGIPVCGHIGLTPQSVHVLGGYKVQGKGEAAAQRLKDDAMALKAAGATM
PANB_METFK       IMLETVRFLVERGIPVCGHLGLTPQSVHQFGGYRVQARDEAAARQLLDDAKALAAAGAGM
PANB_AZOSB       FMAETVRFLVERGVPVCAHIGLTPQSVHQLGGYRVQGRSEEGAARLKADALALEQAGAAL
PANB_AROAE       FMAETVRFLVERGIPVCAHIGLTPQSVHQLGGYRVQGRSEAAAAQLKGDALALEQAGAAL
PANB_THIDA       VMVDTVAFLAARGIPVCAHLGLLPQSVNQLGGYRVQGREDGDAAQLVADARALEAAGAGL
PANB_ACIAC       WTAPTVRFLVERGVPVCAHLGLTPQTVHALGGYRVQGRSDEAARALRSQANELQDAGAAM
PANB_ACISJ       WTAPTVQFLVERGVPVCAHLGLTPQTVHALGGYRVQGKGDQAAQQLRRQALELQDAGAAM
PANB_VEREI       WTAPTVEFLVQRGVPVCAHLGLTPQSVHALGGYRVQGKTDAGARTLRQQARELQDAGAAL
PANB_POLNA       WTTETVRFLVERGIPVCAHLGLTPQTVHALGGYRVQGKTDESAALLRREASALQDAGASM
PANB_POLSJ       WTADTVRFLVERGIPVCAHLGLTPQTVHALGGYRVQGKTEEAAATLKREAHELQDAGAAM
PANB_RHOFT       WTADTVRFLVERGIPVCAHLGLTPQTVHALGGYRVQGKTQESAALMKRQAHELQDAGAAL
PANB1_ZYMMO      WTVDIVEFLVQRGIPVCAHLRLTPQTVSALGGYRVQGRSEEAAEKLRVDAGALDNAGASM
PANB2_METPP      WTPETVNFLVERGVPVCAHLGLTPQSVHALGGYRIQGKDEAGAATLRRHAKALADAGAAM
PANB_XANAC       HKLEVIRYLVEREIPVCSHLGLTPQSVLRFGGYKVQGRGE-AGEQLRRDAQAVVDAGASL
PANB_XANC5       HKLEVIRYLVEREIPVCSHLGLTPQSVLRFGGYKVQGRGE-AGEQLRRDAQAVVDAGASL
PANB_XANOM       HKLEVIRYLVEREIPVCSHLGLTPQSVLRFGGYKVQGRGE-AGEQLRRDAQAVVDAGASL
PANB_XANOR       HKLEVIRYLVEREIPVCSHLGLTPQSVLRFGGYKVQGRGE-AGEQLRRDAQAVVDAGASL
PANB_XANCP       HKLDVIRYLVEREIPVCSHLGLTPQSVLRFGGYKVQGRGE-AGEQLRRDAQAAVDAGASL
PANB_XANC8       HKLDVIRYLVEREIPVCSHLGLTPQSVLRFGGYKVQGRGE-AGEQLRRDAQAAVDAGASL
PANB_XYLFA       HKLEVISYLVEREIPVCSHLGLTPQSVLRFGGYKVQGRGEEAGGRLRAEARAAVEAGATL
PANB_XYLFT       HKLEVISYLVEREIPVCSHLGLTPQSVLRFGGYKVQGRGEEAGGRLRAEARAAVEAGATL
PANB_RUTMC       EHEASFKIFQNNDIPVCGHLGLQPQSVIEMGGYKTEGRDKQSADKIIKDALALASWGVKV
PANB_VESOH       EHEASFRILQGNDISVCGHLGLQPQSVVEIDGYRVQGRGKQGANKIIKNALALASWGVKV
PANB_ALKEH       EQAELVARLARAGIPVCAHLGLQPQLVHKLGGYRVQGRESAAADAMLADAQALEAAGADL
PANB_HALHL       EQAALVERLAQNGIPVCGHLGLKPQQVHKIGGYRVQGREQADAERMEADALALEAAGADL
PANB_NITOC       LLGEIVEHLTARGIPVCAHLGLLPQSVHRIGGYRVQGREEISARRIQEDAMILQEAGADM
PANB_HYDCU       RVVEMVQALSDLGVPVCGHLGLLPQSVQK-KGYQVAGKEAESAARLLGEAKMLESAGADM
PANB_METCA       ERLDVVRFLTEQNVPVCGHLGLQPQAIHRLGRYALQGRDAESACRMVEDARQLAEAGAML
PANB_ANADE       EFGDVIRRIVRAGVPVMGHIGLTPQSVHKMGGYVVQGKDSEKAQQILRDARALEAAGCYA
PANB_MYXXD       EFADTVRAIVRASIPVMGHLGLTPQSVHKMGGYVVQGRGEDQARQILDDALALEQAGAYA
PANB_MAGMM       AMAATVAYLTERAIPVIGHLGLTPQSVHAFGGFKIQGRDQAAAQRIADDALALQQAGAGA
PANB_CAMJE       EIASKIKLISQSGIPVVAHLGLTPQAVNMLGGYRVQGKDLQSAQKIIDDAKAVQDAGACM
PANB_CAMJJ       EIASKIKLISQSGIPVVAHLGLTPQAVNMLGGYRVQGKDLQSAQKIIDDAKAVQDAGACM
PANB_CAMJR       EIASKIKLISQSGIPVVAHLGLTPQAVNMLGGYRVQGKDLQSAQKIIDDAKAVQDAGACM
PANB_AQUAE       EIAELVYKLTRIGIPVVGHVGFTPQHINVFGKPKVVGKKKEEEEKLRRDFRALEEAGAFM
PANB_BACAN       EVISTIHYLTNAGIPVVAHLGLTPQSVGVLGGYKVQGKDAESAKKLIEDAKKCEEAGAIA
PANB_BACAH       EVISTIHYLTNAGIPVVAHLGLTPQSVGVLGGYKVQGKDAESAKKLIEDAKKCEEAGAIA
PANB_BACCZ       EVISTIHYLTNAGIPVVAHLGLTPQSVGVLGGYKVQGKDAESAKKLIEDAKKCEEAGAIA
PANB_BACHK       EVISTIHYLTNAGIPVVAHLGLTPQSVGVLGGYKVQGKDAESAKKLIEDAKKCEEAGAIA
PANB_BACCR       EVISTIQYLTNAGIPVVAHLGLTPQSVGVLGGYKVQGKDAESAKKLIEDAKKCEEAGAIA
PANB_BACC1       EVISTIHYLTSAGIPVVAHLGLTPQSVGVLGGYKVQGKDAESAKKLIEDAKRCEEAGAIA
PANB_GEOKA       EVVDMIAALTKAGVPVVAHLGLTPQSVGVLGGYKVQGKDAESAKKLLDDAKQCEQAGAIA
PANB_GEOTN       EVVETIAALTKAGVPVVAHLGLTPQSVGVLGGYKVQGKDAESAKKLLNDAKQCEQAGAIA
PANB_BACSU       GVFESIRALTLGGIPVVSHLGLTPQSVGVLGGYKVQGKDEQSAKKLIEDSIKCEEAGAMM
PANB_BACLD       GVFETITALTRGGIPVVSHLGLTPQSVGVLGGYKVQGKDEESAGKLIEDSRRCEEAGAMA
PANB_LISIN       EVVNKIARLTEAGAPVVAHLGLTPQSVGLTGSYKVRAKSVQEAQELIDNALAVEAAGAIA
PANB_LISW6       EVVNKIARLTEAGAPVVAHLGLTPQSVGLTGSYKVRAKSVQEAQELIDNALAVEAAGAIA
PANB_LISMF       EVVNKIARLTEAGAPVVAHLGLTPQSVGLTGSYKVRAKSAQEAQELMDNALAVEAAGAIA
PANB_LISMO       EVVNKIARLTEAGAPVVAHLGLTPQSVGLTGSYKVRAKSAQEAQELMDNALAVEAAGAIA
PANB_DESHY       EMIPHIRALVRAGIPVVSHLGLTPQTAAVLGGFKVRGKDGEAARKMLEDVKECQEAGAFA
PANB_BACHD       DIIDTIERLTLAGVPIVAHLGLTPQNVAVEGGYRVQAKDAKSAKQLLADAKAVEAAGAFA
PANB_BACSK       DIASTVQRLTAAGVPVVGHIGLTPQSVGVLGGYRVQGKAQEEGEQLLADAQALEQAGAFA
PANB_STAA3       HITPFIEKATAIGIPVVAHLGLTPQSVGVMG-YKLQGATKEAAEQLILDAKNVEQAGAVA
PANB_STAA8       HITPFIEKATAIGIPVVAHLGLTPQSVGVMG-YKLQGATKEAAEQLILDAKNVEQAGAVA
PANB_STAAS       HITPFIEKATAIGIPVVAHLGLTPQSVGVMG-YKLQGATKEAAEQLILDAKNVEQAGAVA
PANB_STAAW       HITPFIEKATAIGIPVVAHLGLTPQSVGVMG-YKLQGATKEAAEQLILDAKNVEQAGAVA
PANB_STAAN       HITPFIEKATAIGIPVVAHLGLTPQSVGVMG-YKLQGATKEAAEQLILDAKNVEQAGAVA
PANB_STAAM       HITPFIEKATAIGIPVVAHLGLTPQSVGVMG-YKLQGATKEAAEQLILDAKNVEQAGAVA
PANB_STAAB       HITPFIEKATAIGIPVVAHLGLTPQSVGVMG-YKLQGATKEAAEQLILDAKNVEQAGAVA
PANB_STAAC       HITPFIEKATAIGIPVVAHLGLTPQSVGVMG-YKLQGATKEAAEQLILDAKNVEQAGAVA
PANB_STAAR       HITPFIEKATAIGIPVVAHLGLTPQSVGVMG-YKLQGATKEAAEQLILDAKNVEKAGAVA
PANB_STAES       HLTSFIQKATKMGIPVVSHLGLTPQSVGVMG-YKLQGDTKTAAMQLIKDAKAMETAGAVV
PANB_STAEQ       HLTSFIQKATKMGIPVVSHLGLTPQSVGVMG-YKLQGDTKTAAMQLIKDAKAMETAGAVV
PANB_STAHJ       HLVNFIKKSTQIGIPIVAHLGLMPQSVGVMG-YRLQGSTKDAAEQLIQEAHAVQEAGAVA
PANB_STAS1       HLTQYIKNCSNMGIPVVSHLGLTPQSVGIMG-YKMQAGNKEAARQLIEDAYAVQQAGAVM
PANB_OCEIH       HAAPVIKKCHDIGIPVVAHLGLTPQSYGITG-YQLQATSKEAAKQLIEDAKLVEKSGAIM
PANB_BRUA2       EMAETVAFLVRRGIPVFGHVGLMPQQVNTVGGFRSLGRGDDEAGKIRRDAQAIAQAGAFA
PANB_BRUAB       EMAETVAFLVRRGIPVFGHVGLMPQQVNTVGGFRSLGRGDDEAGKIRRDAQAIAQAGAFA
PANB_BRUME       EMAETVAFLVRRGIPVFGHVGLMPQQVNTVGGFRSLGRGDDEAGKIRRDAQAIAQAGAFA
PANB_BRUSU       EMAETVAFLVRRGIPVFGHVGLMPQQVNTVGGFRSLGRGDDEAGKIRRDAQAIAQAGAFA
PANB_AGRFC       EMAETIAFLVARGIPVFGHVGLMPQLVHTAGGFRSLGHSDAETQKIWRDGIAVDQAGAFA
PANB_RHIEC       EMAETIAFLTKRGIPVMGHIGLMPQQVQTAGGYRSVGHSEHETSKIRRDAHAIGGSGAFA
PANB_RHIL3       EMAETIAFLTKRGIPVMGHIGLMPQQVQTAGGYRSVGHSEHETSKIRRDAHAVGGSGAFA
PANB_RHIME       EMAETVEFLVSRGIPVLGHVGLMPQLVNTTGGYRSVGRNEKEVAKIRRDAKAIDDAGAFA
PANB_BORBR       EMASTVAFLVERGIPVMGHVGLKPQSVHGHGGFRTVGR-GAEAEQVMADAQAIAAAGAFT
PANB_BORPA       EMASTVAFLVERGIPVMGHVGLKPQSVHGHGGFRTVGR-GAEAEQVMADAQAIAAAGAFT
PANB_BORPE       EMASTVAFLVERGIPVMGHVGLKPQSVHGHGGFRTVGR-GAEAEQVMADAQAIAAAGAFT
PANB_MAGSA       ELAETIRFLTDRGIPVMAHIGLKPQAVHAAGGFRAQGRIESEAEAIRADARAITEAGAFS
PANB_RHORT       EMAETVAFLVQRGVPVMGHVGLKPQMVHAMGGFRAQGRDEAEAEAVVAETRAIAEAGAFS
PANB_GRABC       EMAETIAFLTARGIPVCGHVGLMPQDTLMEGGYRATGRTEDSAARVLADAMAVAEAGAFM
PANB1_PSEAE      EMEETVDFLVRRGIPVLAHIGLMPQQVNAMGGFKAQGRDPESAERVRRDGLAMQRGGAFA
PANB1_PSEAB      EMEETVDFLVRRGIPVLAHIGLMPQQVNAMGGFKAQGRDPESAERVRRDGLAMQRGGAFA
PANB2_BURCH      EMTDTIRFLTDRGIPVMAHVGLMPQQANAAGGFRAQGMDPRSAAQVFDAACAAERAGAFS
PANB2_BURCM      EMTDTIRFLTERGIPVMAHVGLMPQQANAAGGFRAQGMDPLSAAQVFDAACAAERAGAFS
PANB1_BURL3      EMADAIRFLTERGIPVMAHVGLMPQQANATGGFRAQGMDPRSAAQVFDAACSAEQAGAFS
PANB1_PSEE4      ALAPTVAFLVERGIPVMAHVGLMPQFVHVMGGYKAQGLTEASAETIVEDARANLAAGAFS
PANB1_PSEF5      ALAPTVEFLVQRGIPVMAHIGLMPQFVNQMGGFKAQGLDSEAARKIEEDARAHLEAGAFS
PANB1_HAHCH      ELLETVDFLVRRGIPVMPHIGLTPQHANVQGGFKAQIRTEEEINAFIKLGRAFEEAGAFA
PANB_BARHE       YIAETIDFLCKRGIPVMSHVGLTPQAVNRFGGFKTQGRNESNWQQIEADAAAIEKAGAFA
PANB_BARQU       YIAETIDFLCKRGIPVMGHIGLTPQAVNRFGGFKTQGRNESNWQQIEADAAAIEEAGAFA
PANB_BARBK       HMAKTIDFLCKRGIPVMSHIGLTPQAVNHFGGFKTQGRDKSDWEKIEADAAAIEDAGAFA
PANB_RHOP2       RMAETIAFLTERGIPVMGHIGLTPQSINTLGSFRAQGREEGSWEPIEADARAVADAGAFS
PANB_RHOPS       RMAETIAFLTERGIPVMGHIGLTPQSINTLGSFRAQGREEGSWEPIEADARAVSDAGAFS
PANB_RHOPA       RMAETIAFLTERGIPVMGHIGLTPQSINTLGSFRAQGREEGSWEPIEADARAVADAGAFS
PANB_NITHX       KMAETIAFLTARGVPVMGHVGLTPQSINTLGSFRAQGREEGTWRPIEDDARAVAEAGAFS
PANB_NITWN       KMAETIAFLSARGIPVMGHVGLTPQSINTLGSFRAQGREEGTWQPIEDDARAVAEAGAFS
PANB_RHOP5       KMAETIRFLTERGVPVMGHIGLTPQSINTLGSFRAQGREESNWGPIEADARAVAEAGAFS
PANB_RHOPB       KMAETIRFLSERGVPVMGHIGLTPQSINTLGSFRAQGREESNWAPIEADARAVAEAGAFS
PANB3_BRADU      RMAETVAFLSERGIPVMGHIGLTPQSINTLGSFRAQGREEANWAPIENDARAIAEAGAFS
PANB_HYPNA       YAAGQIAHLVERGIPVMGHIGLRPQAINVDGGFRAKGRTEDERDRVIAEARAAADAGAFC
PANB_MARMM       YAADTIRFMAARSIPVIGHIGLRPQAALADGGFRAKGRTQAERQRVIDEALATAEAGAFA
PANB_CAUVC       TVPETIAYLTRRGVPVMGHVGLRPQAVLLEGGFKAKGKDDAGRAKVLEEARLTAEAGAFA
PANB2_ZYMMO      HLAPVIAFLTARGVPVMGHIGLTPQYVQTLGGFKIQGHSSEQQDKIKQDALDFEAAGAFS
PANB_ERYLH       AMAETVAFLNQRGIPVMGHVGLTPQAVNVLGGYAARGRNDAEADKIVTDAKALDDAGAFA
PANB_NOVAD       AMAETVAFLTNRGIPVMGHVGLTPQAVNVLGGYNARGRSEAEAAKIVGDARSLADAGAFA
PANB_SPHAL       VLAPTIEFLTQRGIPVMGHVGLTPQAVNILGGYGVRGKSEEEARSIVEDAVAVAQAGAFS
PANB_RHOS1       HMAETIRFLVARGVPVMAHIGLTPQAVNALGGYKVQGRGA-DAERVMEDAIAVAEAGAFS
PANB_RHOS4       HMAETIRFLVARGVPVMAHIGLTPQAVNALGGYKVQGRGA-DAERVMEDAIAVAEAGAFS
PANB_RUEPO       EMAETIRFLVKRGIPVMAHIGLTPQSINTLGGYKVQGRDD-QAQAVLADARAVADAGAFS
PANB_RUEST       EMADTIRFLVKRGIPVMAHIGLTPQSINTLGGYKVQGRDD-AAKPLIADARAVAEAGAFA
PANB_ROSDO       HMAQTIEFLVQRGIPVMAHIGLTPQSINTLGGYKVQGRGP-QAEVLMQDAKAVAAAGAFS
PANB_CHESB       SMAETIRFLTGRGIPVMAHVGLTPQAVNAFGGYQVQGRGE-DGDRVMRDAQAVAKAGAFS
PANB_PARDP       HMAETVAFLVARGIPVMGHVGLTPQSVNTLGGYKVQGRGHHEADRIAADAAALADAGAFA
PANB_RHILO       DMAGQIAAIAAAGIPVMGHIGLLPQSVEKDGGYKIKGRTDETVAALMADARAVEKAGAFS
PANB_ANAMM       CVAEEIAFLVARGIPVMGHVGLMPQHFNQLGGYKCQGKTDSSRQHIKEDAKAVCEAGAFC
PANB_PELUB       KVIQIIKTLIKNKIPVMGHLGVLPQSATN---FKFKGKEIAERKIILRDSKLLEDAGVFS
PANB_HELPY       EKAKLVKTLTNEGVIVVGHIGLMPQFVRLDGGYKIKGKNEEQQKKLLEDALSLEEAGVGL
PANB_HELPH       EKAKLVKTLTNEGVIVVGHIGLMPQFVRLDGGYKIKGKNEEQQKKLLEDALSLEEAGAGL
PANB_HELPJ       EKAKLVKTLTDEGVIVVGHIGLMPQFVRLDGGYKIKGKNEEQQKKLLEDALSLEEAGVGL
PANB_HELAH       EKAKLVKTLTNEGVIVVGHIGLMPQFVRLDGGYKIKGKNEEQQKKLLEDALSLEEAGVGL
PANB_HELHP       DKLPVVKVLCEEGIAVMAHIGLKPQFMRFDGGFKIKGKDEVESQELIEAAVAFQEAGVFG
PANB_CAMFF       EMADTIKLLSQNGIIVMSHIGLKPQMSRFEGGYKIKGKDELSAKSILEDAIVLESAGASL
PANB_WOLSU       QKAETIALLSENGIAVMGHIGLKPQFVRAEGGYKVKGKEEGEAQSLLRDAKALEESGVFA
PANB_SULDN       DKAEIISHLCSNGIAVCGHIGLLPQAFRSEGGYKVKGKTDEERIQLIRDAKAIEKAGAFC
PANB_BDEBA       GNLKLVRHLVDSGVPVMGHLGLTPQSVNQLGGFKVQGRDEKAQKKILEAALQLQDAGAFS
PANB_COXBU       HNLKFIHHVVKSGIPVIGHLGLTPQSIYTLGGFKVQGKEPSAAKKLMADAKALAETGCFA
PANB_FRATT       GNLDIIKHIVDSGVPVMGHIGMTPQFINSFGGFKVQGRTEEAAKHLLEEAKLLEQAGCFG
PANB_FRAT1       GNLDIIKHIVDSGVPVMGHIGMTPQFINSFGGFKVQGRTEEAAKHLLEEAKLLEQAGCFG
PANB_FRATH       GNLDIIKHIVDSGVPIMGHIGMTPQFINSFGGFKVQGRTEEAAKHLLEEAKLLEQAGCFG
PANB_FRATO       GNLDIIKHIVDSGVPIMGHIGMTPQFINSFGGFKVQGRTEEAAKHLLEEAKLLEQAGCFG
PANB_FRATW       GNLDIIKHIVDSGVPVMGHIGMTPQFINSFGGFKVQGRTEEAAKHLLEEAKLLEQAGCFG
PANB_FRATN       GNLDIIKHIVNSGVPVMGHIGMTPQFINSFGGFKVQGRTEEAAKHLLEEAKLLEQAGCFG
PANB_LEGPH       DTCQTISHLVNAGIPVMGHIGLTPQSIHQLGGYKVQGKNSEQAETLLQQAATLEQAGCFA
PANB_LEGPA       DTCQTISHLVNAGIPVMGHIGLTPQSIHQLGGYKVQGKNSEQAETLLQQAATLEQAGCFA
PANB_LEGPL       DTCQTISHLVNAGIPVMGHIGLTPQSIHQLGGYKIQGKNSEQAETLLQQATTLEQAGCFA
PANB_LEPIC       FICELVSILKQIGVPVMGHLGLTPQSVHVFGGHRVQGKGEESSSKLLKESISLFESGVFS
PANB_LEPIN       FICELVSILKQIGVPVMGHLGLTPQSVHVFGGHRVQGKGEESSSKLLKESISLFESGVFS
PANB_LEPBJ       FICELVAILKQIGIPVMGHLGLTPQSVHVFGGHRVQGKGEESSAKLLREAVALSESGAFS
PANB_LEPBL       FICELVAILKQIGIPVMGHLGLTPQSVHVFGGHRVQGKGEESSAKLLREAVALSESGAFS
PANB_HYPBU       SYSDTIRALVRAGIPVVAHVGLTPQRYKLLGGYRLAGKTASEAMEVIREAIGAEEAGAFA
PANB_STAMF       EMVDVIKALVRAGIPVMGHIGLTPQRYLLLGGYRRRGVKEYEAEKIIEDAKELEKAGVFS
PANB_AERPE       EYADRVKAIVDAGIPVMGHLGLTPQRAMRIGGYRPRARGRDEARRLLLDAESLVEAGVFS
PANB_SULAC       EMADVVRKIVRAGIPVMGHIGLTPQRFLRIGGFRVLGKSKHEEEQLLRDAEVLEEAGIFS
PANB_SULTO       EMRDVVRAIVRAGIPVMGHIGLTPQRFLRIGGYRILGKREKEEEQLLKDAKTLEEAGAFS
PANB_SACS2       EIKDIIRAIVKAGIPVMGHIGLTPQRFLRLGGFRTIGKTKQEEEQLIKDSLELEDAGVFS
PANB_PYRFU       DHRKLVKKLVRMGIPVMGHTGLTPQRYLRLGGYRIMGENEEEVEEILRDAKALEKAGAFA
PANB_PYRHO       DHRKLVKKLVRIGIPVMGHTGLTPQRYLRLGGYRIMGGTEEEVEEILRDAKALEKAGAFA
PANB_PYRAB       DHKKLVKRLVRMGIPVMGHTGLTPQRYLRLGGYRIMGSTEEEVEEIIRDAKALEKAGAFA
PANB_THEKO       DHKKLVKKLVRMGIPVMGHTGLTPQRYLRLGGYRLMGETEEEIEEILRDAKALEKAGAFA
PANB_PYRAE       EYARIVEKLVKAGIPVMGHIGLNPQRVLALGGFKMVGRTEEQRRKLLDDAKALRDAGAFS
PANB_PYRAR       EYAHVVEKLVKAGIPVMGHIGLNPQRVLALGGFKMVGKTEEQKKKLVEDAKALRDVGVFA
PANB_PYRIL       EYAHIVERLVKAGIPVMGHIGLTPQRVLTIGGFRMVGKTEEQRRKVLEDAKALRDAGAFS
PANB_PYRCJ       EIVDVVEKLTKTGVPVMGHIGLNPQRVLTLGGFRMVGKDEEARRKVLEDAKALQEAGAFA
PANB_THEMA       EFGELVQKLVESGIPVMGHIGLTPQFVNRFGGYRVQGKTEKNREYLLRSARELEKRGAFA
PANB_DEIRA       EVLDVVRVLSRNGVPVMGHVGLMPQTAAAQGGLRVQGKDDDSARRTLEGAVALQEAGAFA
PANB_DEIGD       EVLDVVGVLARNGIPVMGHVGLMPQTATAQGGLKVQGRDEASARRTLEGALALEAAGAFS
PANB_THET2       EVAEIVRGLVRAGVPVLGHVGLTPQTASQLGGYKLQGRRPEEAERILKGALALEEAGAYG
PANB_THET8       EVAEIVQGLVRAGVPVLGHVGLTPQTASQLGGYKLQGRRPEEAERILKGALALEEAGAYG
PANB1_METPP      SQAHILKALVDSGIPTASHIGLTPHTIAMFGGFKIQGRTAEAAMKILEDAFAIQDAGCFM
PANB_ENTFA       EVCDKIEAIVKASIPVMAHIGLTPQSVNAFGGFKVQGKDKEAAKELIRAAKAVEKAGAFA
PANB_CLONN       TVIEQIKAIVNAQIPVMAHIGLTPQSINVFGGFKVQGKDEEKAQKLIEDAKKIEEAGAFA
PANB_CLOAB       LVCDRIKAIVDAQIPVMGHIGLTPQSVNAFGGFKIQGKNISKAKELIEDAKKIEAAGAFA
PANB_CLOD6       NVIKQIESIVNAQIPVMGHLGLTPQSVNSFGGFKVQGNTSETARQLIEDAKLIEKAGAFS
PANB_HUNT2       DIIENVKAIISAGIPVVGHLGYTPQSINVFGGHKAQGKTIDTAKKIYRDALLLQKAGVFA
PANB_DEHM1       NVADKVKRIVDCGIPVMGHIGLTPQSVNQLSGFKVQGKTLTAALALLEDARALEKAGAFA
PANB_DEHMC       NVADKVKRIVDCGIPVMGHIGLTPQSVNQLSGFKVQGKTLATALSLIEDAKALEKAGAFA
PANB_CARHZ       EIAELVAKLVTAGIPVMGHIGLTPQSVNALGGYKVQGKDLKTAQKLLDDAKALADAGAFA
PANB_SYNWW       ERVDTVKAILDAQIPVMGHIGLTPQSVHQFGGFKVQGKDLETAKKLVEDARALDQAGVYC
PANB_SYNAS       EIAESVKRMTVSGIPVVGHLGLTPQSVQQFGGFKVQGKGDAAAQRIMEDAKIIEEAGAFS
PANB_DESPS       VVCPVVKAIVDAGIPVMGHLGLTPQTAAVLGGYKVQGRDMEAARKLFADAKRLEEAGVCG
PANB_MOOTA       AVVPTVRAIVNAGIPVMGHLGLTPQSAVQLGGFRVQGRSEAEGEKIAADAAALVEAGVFA
PANB_DESVH       PVLPQVRALVDAGIPVMGHLGLTPQRVAEMGGFKVQGRQAEAALRLFDDALALQEAGCFS
PANB_DESVV       PVLPQVRALVDAGIPVMGHLGLTPQRVAEMGGFKVQGRQAEAALRLFDDALALQEAGCFS
PANB_DESAG       EVAPQVEALVKAGIPVMGHIGLTPQRVAALGGFKVQGRSAAAARSLAEDARILEDAGCFA
PANB_SYNFM       RVAPQVKAMVEAGIPVQGHLGLTPQSSAQFGGFKIQGKTAEAAKILIEDAQILAEAGCFS
PANB_CENSY       AVADAVRGVTGAGIPVMGHIGLLPQTAALSGGYRVQGRTRESALRLAEDAKALEEAGAFA
PANB_MYCTU       RVAEQIACLTAAGIPVMAHIGFTPQSVNTLGGFRVQGRGD-AAEQTIADAIAVAEAGAFA
PANB_MYCBO       RVAEQIACLTAAGIPVMAHIGFTPQSVNTLGGFRVQGRGD-AAEQTIADAIAVAEAGAFA
PANB_MYCBP       RVAEQIACLTAAGIPVMAHIGFTPQSVNTLGGFRVQGRGD-AAEQTIADAIAVAEAGAFA
PANB_MYCUA       RVAEQIACLTAAGIPVMAHIGFTPQSVNTLGGFRVQGRGD-AAEQTIADAIAVAEAGAFS
PANB_MYCPA       RVAEQIAHLTAAGIPVMAHIGFTPQSVNSLGGFRVQGRGD-AAEQTIADAIAVAEAGAFS
PANB_MYCA1       RVAEQIAHLTAAGIPVMAHIGFTPQSVNSLGGFRVQGRGD-AAEQTIADAIAVAEAGAFS
PANB_MYCLE       RVAEQIACLTAAGIPVMAHIGFTPQSVNSLGGFRVQGRGG-DAEQTVADAVAVAEAGAFS
PANB_MYCSJ       RVAEQIATLSAAGIPVMAHIGFTPQSVNGLGGFKVQGRGD-AAEQTIHDAIAVQEAGAFS
PANB_MYCSK       RVAEQIATLSAAGIPVMAHIGFTPQSVNGLGGFKVQGRGD-AAEQTIHDAIAVQEAGAFS
PANB_MYCSS       RVAEQIATLSAAGIPVMAHIGFTPQSVNGLGGFKVQGRGD-AAEQTIHDAIAVQEAGAFS
PANB_MYCVP       RVADQIAAVSAAGIPVMAHIGFTPQSVNGLGGFRVQGRGD-AAEQTIHDAIAVQEAGAFA
PANB_NOCFA       RVAEQIALLTAAGIPVMAHIGFTPQSVNTLGGFRVQGRGD-GAEQLIADAIAVQEAGAFS
PANB_RHOJR       RVAPQIAAITAAGIPVMAHVGFTPQSVNSLGGFRVQGRGD-AAEQLVADAIAVQEAGAFS
PANB_LEIXX       RSAEQIRRIVDAGVPVMGHIGFTPQSEHGLGGHLVQGRGQ-GAEQVVDDAHAVEEAGAFA
PANB_SACEN       PFARHVEALVNAGIPVMGHIGFTPQSEHTLGGYRVQGRGE-QAEELAADARALQDAGAFA
PANB_PAEAT       YYADTVRAMVQAGIPVMAHIGFTPQSEHSLGGYRVQGRGD-DAQRLVDDAVALQDAGAFS
PANB_ARTS2       FYADTVRAMVQAGIPVMAHIGFTPQSEHSLGGYRVQGRGD-DAQRLIDDAVALAEAGAFS
PANB_NOCSJ       EMAPQVRKLTEGGIPVMAHIGFTPQSEHNLGGYRVQGRGE-AAARVVAEAVAMEQAGAFA
PANB_FRAAA       RVAPAVAALVGAGIPVIGHLGLTPQSIHALGGYRVQGRDE-AGEVLLADALAIEAAGAFA
PANB_FRACC       RVVRAVDALVGAGIPVIGHLGLTPQSIHTIGGYRVQGRDE-AGEILLADALALEAAGAFA
PANB_ACIC1       RVAEHVRTVVEAGIPVMAHIGFTPQSVHALGGYRVQGRGD-DAAAIRDDALALQEAGAFA
PANB_STRAW       RSHRQIELLVESGIPVMAHIGLTPQSVNAMG-YRVQGRGEEAAQQLLRDAKAVQDAGAFA
PANB_STRCO       RSHRQIELLVESGIPVMAHIGLTPQSVNSMG-YRVQGRGEEAAQQLLRDAKAVQDAGAFA
PANB_THEFY       RVIAQVEALVSAGIPVMGHIGLTPQSVNVLGGYRVQGRSEEAAEALLSDAKELERAGVFS
PANB_CORGL       EIAQTIRRIVDAGIPVVGHIGYTPQSEHSLGGHVVQGRGA-SSGKLIADARALEQAGAFA
PANB_CORGB       EIAQTIRRIVDAGIPVVGHIGYTPQSEHSLGGHVVQGRGA-SSGKLIADARAVEQAGAFA
PANB_COREF       EMASTIRRIVDAGIPVCGHIGFTPQSEHALGGPVVQGRGS-GADKLLADAHAVQAAGAFA
PANB_CORDI       RMASRIRAITDAGVPVCAHLGFTPQSMNQLSGFKVQ---R-GAEKLTADVDAVVEAGAEM
PANB_CORJK       RIADRIRAITDAGISVCAHIGFTPQSVNQLGGFKVQGRGA-GAEQLLADARAVQEAGADM
PANB_TROW8       RMACRISAIVRAGVPVMGHIGFTPQTINALGGYKIQGR-D-NADLIYLDAQAVEQAGAFA
PANB_TROWT       RMACRISAIVRAGVPVMGHIGFTPQTINALGGYKIQGR-D-NADLIYLDAQAVEQAGAFA
PANB_BACFR       EIIDTVKRILSAGIPVMGHLGLMPQSINKYGTYTVRAKDDAEAEKLIRDAHLLEEAGCFG
PANB_BACFN       EIIDTVKRILSAGIPVMGHLGLMPQSINKYGTYTVRAKDDAEAEKLIRDAHLLEEAGCFG
PANB_BACTN       EIIDTVKRIISAGIPVMGHLGLMPQSINKYGTYTVRAKDDSEAEKLIRDAHLLEEAGCFA
PANB_PORGI       EVRESIVRILSAGIPIMGHLGLMPQSINKFGTYNVRAKEEAEAEKLLQDAHLLEELGCFA
PANB_CYTH3       EIKESVLCIISAGIPVMGHLGLMPQSIYKFGTYVVRAREEEEANKLIADAKILEESGCFG
PANB_GRAFK       EVKESIKRIIHAGIPVMGHLGLTPQSIYKFGTYTVRAKEEQEAEKLKSDAKLLEKMGCFA
PANB_SALRD       PVVEAVERMVTAGIPVMGHLGLTPQSIYDYGTYQVRARDEEEADELRADAKRLEEAGCFA
PANB_CHLCH       VIVESVKRITDVGIPVMGHLGLMPQSIYKYGSYRVRAQEEQEAEQLLRDAELLEKAGAFA
PANB_CHLPD       IIADTVKRITDVGIPVMGHLGLMPQSIYKYGSYKVRAQEEQEAEQLLQDARLLEEAGAFA
PANB_PELLD       TIADTVRRITDAGIPVMGHLGLMPQSIYKYGSYKVRAEDPAEAEELLEDAVTLERSGAFA
PANB_CHLTE       VIAEAVKRITDIGIPVMGHLGLMPQSIYKYGSYKVRAMEEEEARQLIEDAKIIEEAGAFA
PANB_RHOBA       EQAERIEAMVGAGIPVMAHIGLRPQNIHVEGGYRLQR----DIERLVADAKAAEAAGAFT
PANB_GEOSL       HVTDTIRAIVDMDIPVMAHIGLTPQSIHRMGGYKVQGKKDEQAQRLLEDALAVQEAGAFA
PANB_GEOMG       HVADTIRAIVDMDIPVMAHIGLTPQSIHRMGGYKVQGKKEEQSQRLLDDAKAIEEAGAFA
PANB_PELCD       PVAEVIRTLVDMDIPVVGHIGLTPQSIHRMGGYKVQGKHDQQARQLMRDARAVQEAGAFA
PANB_PELPD       NMSHVIRAVTSIDIPVMGHIGLTPQSIHRMGGYRVQGRK-EQAERIMEDALAVQAAGAFS
PANB_KORVE       NRAALIDRLLDAEVPVVGHIGLTPQSVHRMGGYKVQGKTIRDIEQLMRDATALDRAGVVA
PANB2_BRADU      KRIEMVRALVDCDIPVMGHLGLTPQSVNVMGGFKVQGRTTDTALRLLDDAHRLQEAGCFA
PANB1_BRADU      KRIEMVRAIVDCEIPVMGHLGLVPQSVNVMGGFKVQGRKVDEALRLLDDAHRLQEASCFA
PANB_NOSS1       AMVDTINRLVQAGIPVMGHVGLTPQSVHQLG-LRQQGKTQETAQRILNEAIALEQAGVFS
PANB_TRIV2       AMVETITRLVQAGIPVMGHVGLTPQSVHQLG-LRQQGKTQETAQRILNEAIALEQAGVFS
PANB_SYNP6       RLLETVQRLVEVGIPVMGHVGLTPQSVRQLG-YRQQGQTPEAQQQILDQALALEAAGAFA
PANB_SYNE7       RLLETVQRLVEVGIPVMGHVGLTPQSVRQLG-YRQQGQTPEAQQQILDQALALEAAGAFA
PANB_SYNY3       RMVETVARLTEVGIPVMGHVGLTPQSVHQLG-YRQQGQDPATAEKILHQAIALAEAGVFA
PANB_TRIEI       AIAQTVKKLTSIGIPVMGHIGLIPQSVHQFGGYPQQGNAPDASARILTEALALAEAGAFA
PANB_THEEB       VVQAATRRLVEAGIPVLGHVGLLPQRVHQLGGWRQQGNTPQDAAAILAGALALAEAGVFA
PANB_SYNJA       DMVETVAFLVQRGIPVLGHIGLTPQAKHQLGGYRQQGKTPSEAERLRQEALSLERAGAFA
PANB_SYNJB       DMVETVAFLVQRGIPVLGHIGLTPQAKHQLGGYRQQGKTTPEAERLRQEALSLEQAGAFA
PANB_GLOVI       RMTETVAFLTESGIPVLGHLGLTPQAVHQLGGYRVQGKTAQAAERLIDQALALEGAGAFA
PANB_PROM0       EIQKVISRLIRMGIPVMGHIGLTPQSYLNIG-LRKQGESLASQEKIKKEASILEELGCFS
PANB_PROMS       EIQKVISRLIRMGIPVMGHIGLTPQSYLNIG-LRKQGESLASQEKIKKEASILEELGCFS
PANB_PROM9       EIQKVISRLIRMGIPVMGHIGLTPQSYLNLG-LKKQGESLESQEKIKKDASILEKLGCFS
PANB_PROM5       EVQTVISRLIRMGIPVMGHLGLTPQSYLNLG-LKKQGLKKESYEKIKRDALSLEKLGCFS
PANB_PROMP       EVQNVISRLIRMGIPVMGHLGLTPQSYLNLG-FKQQGNNSESHEKIKRDALSLEKLGCFS
PANB_PROM1       ETLLVIKRLIRMGIPVMGHLGLTPQSVHQLG-YKSQARDKDSQEKIFKDSKMLQESGCFA
PANB_PROMT       ETLLVIKRLIRMGIPVMGHLGLTPQSVHQLG-YKSQARDKDSQEKIFKDSKMLQESGCFA
PANB_PROM3       EVLAVIERLVRMGIPVMGHLGLTPQAVHRLG-YRRQAEDPRSQAQMLQQAKQLEQAGCFA
PANB_PROMM       EVLAVIERLVRMGIPVMGHLGLTPQAVHQLG-YRRQAEDPRSQAQMLQQAKQLEQAGCFA
PANB_PROMA       EVISVIERLIRMGIPVMGHLGLTPQSVNNLG-YHRQAEDALGQEKLVTQALKIEQVGCFS
PANB_SYNPX       EVLAVIDRLVRMGIPVMGHLGLTPQAVHRLG-YRRQAEDPVSQERLLTQAIALEQAGCFA
PANB_SYNS9       EIVAVVDRLVRMGIPVMGHLGLTPQAVHRLG-YRRQALDPVSQDRLIEQALTLEKTGCFA
PANB_SYNSC       EVVAVIDRLVRMGIPVMGHLGLTPQAVHRLG-YRRQATDAISQERLLEQACTLEQKGCFS
PANB_SYNS3       EIVAVVDRLVRMGIPVMGHLGLTPQAVHRLG-YRRQGIDPRSQDKLHRQAQALQDAGCFS
PANB_HALSA       HTVSLTETLTSLGIPVMAHLGLTPQHVNQLGGYFRQGTDQDSAERMLDLARDHEAAGAFA
PANB_HALMA       HTVELTERLTELGIPTMAHLGLTPQSVNQTG-YTRQATGREEAEEILDLAREHEAAGAFA
PANB_NATPD       HTVSLTKTLSDLGIPVQAHLGLTPQRENETG-LYRQGTDEESANRILELAREHEAAGAFS
                                   *    *:                               .   

PANB_ECOK1       LVLECVPVELAKRITEALA-IPVIGIGAGNVTDGQILVMHDAFGIT----GGHIPKFAKN
PANB_ECOUT       LVLECVPVELAKRITEALA-IPVIGIGAGNVTDGQILVMHDAFGIT----GGHIPKFAKN
PANB_ECOL6       LVLECVPVELAKRITEALA-IPVIGIGAGNVTDGQILVMHDAFGIT----GGHIPKFAKN
PANB_ECOL5       LVLECVPVELAKRITEALA-IPVIGIGAGNVTDGQILVMHDAFGIT----GGHIPKFAKN
PANB_SHIBS       LVLECVPVELAKRITEALA-IPVIGIGAGNVTDGQILVMHDAFGIT----GGHIPKFAKN
PANB_SHISS       LVLECVPIELAKRITEALA-IPVIGIGAGNVTDGQILVMHDAFGIT----GGHIPKFAKN
PANB_SHIFL       LVLECVPVELAKRITEALA-IPVIGIGAGNVTDGQILVMHDAFGIT----GGHIPKFAKN
PANB_SHIF8       LVLECVPVELAKRITEALA-IPVIGIGAGNVTDGQILVMHDAFGIT----GGHIPKFAKN
PANB_ECOLI       LVLECVPVELAKRITEALA-IPVIGIGAGNVTDGQILVMHDAFGIT----GGHIPKFAKN
PANB_ECO57       LVLECVPVELAKRITEALA-IPVIGIGAGNVTDGQILVMHDAFGIT----GGHIPKFAKN
PANB_SHIDS       LVLECVPVELAKRITEALV-IPVIGIGAGNVTDGQILVMHDAFGIT----GGHIPKFAKN
PANB_SALTY       LVLECVPVELAKRVTEALS-IPVIGIGAGNVTDGQILVMHDAFGIT----GGHIPKFAKN
PANB_SALPA       LVLECVPVELAKRVTEALS-IPVIGIGAGNVTDGQILVMHDAFGIT----GGHIPKFAKN
PANB_SALCH       LVLECVPVELAKRVTEALS-IPVIGIGAGNVTDGQILVMHDAFGIT----GGHIPKFAKN
PANB_SALTI       LVLECVPVELAKRVTEALS-IPVIGIGAGNVTDGQILVMHDAFGIT----GGHIPKFAKN
PANB_YERPA       LVLECVPVELAQRVTEELT-IPVIGIGAGNVTDGQILVMHDALGIT----GGHTPKFSKN
PANB_YERPN       LVLECVPVELAQRVTEELT-IPVIGIGAGNVTDGQILVMHDALGIT----GGHTPKFSKN
PANB_YERPP       LVLECVPVELAQRVTEELT-IPVIGIGAGNVTDGQILVMHDALGIT----GGHTPKFSKN
PANB_YERPE       LVLECVPVELAQRVTEELT-IPVIGIGAGNVTDGQILVMHDALGIT----GGHTPKFSKN
PANB_YERPS       LVLECVPVELAQRVTEELT-IPVIGIGAGNVTDGQILVMHDALGIT----GGHTPKFSKN
PANB_YERE8       LVLECVPVELAQRVTEALA-IPVIGIGAGNVTDGQILVMHDALGIT----GGHTPKFSKN
PANB_PECAS       LVLECVPVALAKRVTEALS-IPVIGIGAGNVTDGQILVMHDALGIT----GDSTPKFAKN
PANB_SODGM       LVLECVPVALAERVTHELS-IPVIGIGAGAVTDGQILVMQDALGIT----GDSAPSFAKD
PANB_BAUCH       LVLECVPITLSERIADVLT-IPVIGIGAGPVTDGQILVMQDILGIT----GNRIPSFAKN
PANB_PHOLL       LVLECVPVDLAKRITDELQ-IPVIGIGAGNVTDGQVLVMHDTLGIT----VSP-PKFVKN
PANB_PHOPR       ILLECVPASLAERITKAVE-VPVIGIGAGNVTDGQILVMHDMFGIS----ANYMPRFSKN
PANB1_ALIF1      ILLECVPASLAERITKACT-VPVIGIGAGNVTDGQILVMHDMFGIS----ANYMPKFSKN
PANB_VIBVU       VLLECVPAELAARITQVLD-VPVIGIGAGNVTDGQILVMHDMFGIS----ANYMPKFSKN
PANB_VIBVY       VLLECVPAELAARITQVLD-VPVIGIGAGNVTDGQILVMHDMFGIS----ANYMPKFSKN
PANB_VIBPA       VLLECVPAELAERITKVLD-VPVIGIGAGNVTDGQILVMHDMFGIS----ANYMPKFSKN
PANB_VIBCH       VLLECVPAELANRITQILD-VPVIGIGAGNGTDGQILVMHDMFGIS----ANYMPKFSKN
PANB2_ALIF1      LILECIPAKLARQITLELH-IPVIGIGAGNDTDGQVLVMHDILGIS----ANYIPRFSRN
PANB_SHEON       LVVECIPASLATAITQALT-IPVIGIGAGATTDGQILVMHDVLGIS----SGYIPRFSKN
PANB_SHESA       LVVECIPASLATAITQALT-IPVIGIGAGATTDGQILVMHDVLGIS----SGYIPRFSKN
PANB_SHESM       LVVECIPESLATAITQALT-IPVIGIGAGATTDGQILVMHDVLGIS----SGYIPRFSKN
PANB_SHESR       LVVECIPESLATAITQALT-IPVIGIGAGATTDGQILVMHDVLGIS----SGYIPRFSKN
PANB_SHESW       LVVECIPAPLATAITQALT-IPVIGIGAGASTDGQILVMHDVLGIS----SGYIPRFSKN
PANB_SHELP       LVLECIPAALAKSITEALT-IPVIGIGAGADTDGQILVMHDVLGIS----SGYIPRFSKN
PANB_SHEAM       LVIECIPASLAKAITEALS-IPVIGIGAGKDTDGQILVMHDVLGIS----SGYIPRFSKN
PANB_SHEFN       LVVECIPAPLAKAITEALT-IPVIGIGAGADTDGQILVMHDVLGIS----SGYIPRFSKN
PANB_SHEDO       LVLECIPAALAKTITQAVA-IPVIGIGAGADTDGQILVMHDVLGIT----SGYIPKFSKN
PANB_COLP3       LVLECIPAILGEAITQALT-IPTIGIGAGKDTDGQILVMHDALGIA----CNYMPKFSRN
PANB_AERHH       LVLECVPTSLAERISKALR-IPVIGIGAGPATDGQILVMHDAFGIT----SGYVPKFTKN
PANB_AERS4       LVLECVPVALAERITKALR-IPVIGIGAGPATDGQILVMHDAFGIT----SGYVPKFTKN
PANB_PSEA6       LVLECVPTELAGAISQAVD-IPVIGIGAGPETDGQILVMHDMFGIS----ANYMPKFSKN
PANB_PSYIN       LVLECVPVSLADRITTALK-IPVIGIGAGCETDGQILVMHDAFGVS----AGFCPKFSKN
PANB_PSET1       LVLECIPSALAKRVTDALT-IPTIGIGAGNTTDGQILVMHDLVGIS----AGFIPKFSKN
PANB_IDILO       LVLECVPASLGKRITEQLS-IPTIGIGAGADTDGQILVMHDMLGMN----SDYLPKFAKD
PANB_BUCAI       LILECIPEKLAKKITESLS-IPVIGIGSGKNTDGQILVMHDLLGIT----EGKTPSFTKN
PANB_BUCAP       LVLECIPSLLAKKITENLS-IPVIGIGSGHHTDGQILVMQDLLGIT----DGKKLKFVKN
PANB_WIGBR       LVLECIIQKLSNNITKKLN-IPTIGIGSGKKTDGQILVMQDVLGITI---EGKIPSFSKN
PANB2_PSEAE      LLLECVPSVLAEEITQAVK-IPVIGIGAGAATDGQVLVMHDMLGLSL---TGRSPKFVKD
PANB2_PSEAB      LLLECVPSVLAEEITQAVK-IPVIGIGAGAATDGQVLVMHDMLGLSL---TGRSPKFVKD
PANB_PSEPK       LLLECVPSELAAEITNAVG-IPVIGIGAGSATDGQVLVLHDMLGLSL---SGRVPKFVKN
PANB2_PSEE4      LLLECVPSELAAEITQAVG-IPVIGIGAGSATDGQVLVLHDMLGLSL---SGRVPKFVKN
PANB_PSE14       ILLECVPSELAEEITQAVK-IPVIGIGAGSATDGQVLVLHDMLGLSI---SGRVPKFVKN
PANB_PSEU2       ILLECVPSELAEEITQAVK-VPVIGIGAGSATDGQVLVLHDMLGLSI---TGRVPKFVKN
PANB_PSESM       ILLECVPSELAEEITHAVK-IPVIGIGAGSATDGQVLVLHDMLGLSI---TGRVPKFVKN
PANB2_PSEF5      LLLECVPSELAAEITQAVK-IPVIGIGAGNATDGQVLVLHDMLGLSL---SGRSPKFVKN
PANB_PSEPF       LLLECVPSELAAEITQAVK-IPVIGIGAGSDTDGQVLVLHDMLGLSI---SGRVPKFVKN
PANB_PSEU5       LLLECVPSELAARITRAVQ-IPVIGIGAGSDTDGQVLVLHDMLGLSL---SGRVPKFVKN
PANB_MARHV       ILLECVPAPLAARITQAVK-APVIGIGAGSDTDGQVLVLHDMLGVT----TGRKPRFVKN
PANB2_HAHCH      LLLECVPTKLAKQLTEEAC-APVVGIGAGPYTDGQVLVMHDLLGVG----AGKKPKFVKN
PANB_ALCBS       FVLECVPRALSAEITREVA-APVIGIGAAPECDGQVLVMHDMLGIS----PGKPARFVRN
PANB_PSYA2       LVLECVPAELAKAVTEAVA-VPVIGIGAGADTDGQVLVMHDMLGMA----HGRTPRFVHD
PANB_PSYCK       LVLECVPAELAKAVTEAVA-VPVIGIGAGADTDGQVLVMHDMLGMV----HGRAPRFIHD
PANB_ACIAD       LLLECVPAQLGQEIAELFPQTPVIGIGAGKETDGQVLVAQDMLGLS----FGKVARFVRN
PANB_CHRSD       ILLECVPAALGRAVRDAVD-VPVIGIGAGPEVDGQILVMHDVIGVT----HGRPPRFAKN
PANB_SACD2       LVLECIPAELGARVTQALS-IPTIGIGAGIGTDAQVLVINDILGLT-----EFPPKFSKN
PANB_NEIMB       VLMECVLAELAKKVTETV-SCPTIGIGAGADCDGQVLVMHDMLGIFP---G-KTAKFVKN
PANB_NEIMF       VLMECVPAELAKKVTESV-SCPTIGIGAGADCDGQVLVMHDMLGIFP---G-KTAKFVKN
PANB_NEIMA       VLMECVPAELAKKVTESV-SCPTIGIGAGVDCDGQVLVMHDMLGIFP---G-KTAKFVKN
PANB_NEIG1       VLMECVPAELAKKVTETV-SCPTIGIGAGADCDGQVLVMHDMLGIFP---G-KTAKFVKN
PANB_CHRVO       VLMECVPAPLAKEITETV-KAPTIGIGAGADTSGQVLVLHDMLGVYP---G-KKAKFVKN
PANB_BURMA       IVLEAVPTLVAAEVTREL-SIPTIGIGAGAECSGQVLVLHDMLGVFP---G-KRPRFVKD
PANB_BURPS       IVLEAVPTLVAAEVTREL-SIPTIGIGAGAECSGQVLVLHDMLGVFP---G-KRPRFVKD
PANB_BURP0       IVLEAVPTLVAAEVTREL-SIPTIGIGAGAECSGQVLVLHDMLGVFP---G-KRPRFVKD
PANB_BURP1       IVLEAVPTLVAAEVTREL-SIPTIGIGAGAECSGQVLVLHDMLGVFP---G-KRPRFVKD
PANB_BURTA       IVLEAVPTLVAAEVTREL-SIPTIGIGAGAECSGQVLVLHDMLGVFP---G-KRPRFVKD
PANB_BURCA       VVLEAVPTLVAAEVTHML-KIPTIGIGAGVDCSGQVLVLHDMLGVFP---G-KRPRFVKD
PANB1_BURCH      VVLEAVPTLVAAEVTHML-KIPTIGIGAGVDCSGQVLVLHDMLGVFP---G-KRPRFVKD
PANB1_BURCM      VVLEAVPTLVASEVTHML-KIPTIGIGAGTDCSGQVLVLHDMLGIFP---G-KRPRFVKD
PANB2_BURL3      VLLEAVPTLIGSEVTHML-RVPTIGIGAGADCSGQVLVLHDMLGVFP---G-KRPRFVKD
PANB_PARXL       IVMEAIPTLLASDATKQL-RIPTIGIGAGLDCSGQVLVLHDMLGIFP---G-KRPRFVKD
PANB_CUPNH       VLMEAVPAALAGEITQSL-TVPTIGIGAGADCSGQVLVLQDMLNVYP---G-RKAKFVRN
PANB_CUPPJ       VLMEAVPATLAGEITQML-KVPTIGIGAGADCSGQVLVLQDMINVYP---G-RKAKFVRN
PANB_CUPMC       IVMEAVPAKLAAEVTAQL-SIPTIGIGAGVDCSGQVLVLQDMINIYP---G-RKAKFVRN
PANB_RALSO       VLMEAIPATLAGEVTRLL-AVPTIGIGAGPECSGQVLVMHDMLGVFP---G-HRPKFVRN
PANB_NITEU       LLMELIPAVLGEEITRLL-SIPTIGIGAGAACSGQVLVLHDMLGISS---G-TLPRFVRN
PANB_NITEC       LVMELIPAALGEEITRSL-SIPTIGIGAGAVCSGQVLVLHDMLGISS---G-TLPRFVKN
PANB_NITMU       LLMEVVPAALAAQVTRTL-SIPTIGIGAGKDCSAQVLVLYDMLGIYS---G-KKARFMKN
PANB_DECAR       LLLEAIPATLAAEVTAMT-GVITIGIGAGKDCSGQVMVLHDAFDIPP---G-KKAKFVKN
PANB_METFK       LVLEMVPAALAAAVSQAV-HIPVIGIGAGKYCDGQVLVLQDMLGIYA---G-KSPRFVRN
PANB_AZOSB       VVLEMVPAAVASDITRSLSTMATIGIGAGADCSGQVLVLHDMIGVYP---G-KKARFVKN
PANB_AROAE       MVMEMVPAALAREVTASLASMATIGIGAGPDCDGQVLVLHDMIGVYP---G-KKARFVRN
PANB_THIDA       IVLEMVPAALAKTVTAAL-SMPTIGIGAGADCAGQVLVSYDMLGLYP-----RAPKFSKN
PANB_ACIAC       LVLEMVPATLAREVTDALPRCHTIGIGAGSGTAGQVLVLHDMLGVNL---G-KNPKFAHD
PANB_ACISJ       LVLEMVPTPLARDLTQALPRCHTIGIGAGSGTAGQVLVMHDMLGINL---G-KNPKFVHD
PANB_VEREI       LVLEMVPAALARDITDALPHCHTIGIGAGNGTAGQVLVLHDMLGMNL---G-KMPRFVHN
PANB_POLNA       LVLEMVPAALAAEVTQQLTHCATIGIGAGSGTAGQVLVLHDMLGMNL---G-KMARFVHN
PANB_POLSJ       LVLEMVPAALSAALTQALTHCPTIGIGAGNGTAGQVLVLHDMLGMNL---G-KMPKFVRN
PANB_RHOFT       LVLEMVPAALAAELTRELTHCATIGIGAGKDTAGQVLVLHDMLGINL---G-KMPKFVRN
PANB1_ZYMMO      MVLEMIPTELATSITSEMKSCATIGIGAGSGTAGQVLVMHDMLGINL---G-RMAKFVRN
PANB2_METPP      MVLELMPSRVAREVQADNPGLMTIGIGAGAGTAGQVLVLHDMLGVTR---G-RLPRFVRN
PANB_XANAC       LVLECVPTPIATQISAEL-SVPTIGIGAGPGCDGQVLVMHDMLGLDS---GHRRPKFVKD
PANB_XANC5       LVLECVPTPIATQISADL-SVPTIGIGAGPGCDGQVLVMHDMLGLDS---GHRRPKFVKD
PANB_XANOM       VVLECVPTPIATQISAEL-SVPTIGIGAGPGCDGQVLVMHDMLGLDS---GHRRPKFVKD
PANB_XANOR       VVLECVPTPIATQISAEL-SVPTIGIGAGPGCDGQVLVMHDMLGLDS---GHRRPKFVKD
PANB_XANCP       IVLECVPTPIAAQISAEL-RVPTIGIGAGPGCDGQVLVMHDMLGLDS---GHRRPKFVKD
PANB_XANC8       IVLECVPTPIAAQISAEL-RVPTIGIGAGPGCDGQVLVMHDMLGLDS---GHRRPKFVKD
PANB_XYLFA       LLLECVPSQLAAQITTDV-SVPTIGIGAGAGCDGQVLVLHDLLGLDS---GHPRPKFVKD
PANB_XYLFT       LLLECVPSQLAAQITTDA-SVPTIGIGAGAGCDGQVLVLHDLLGLDS---GHPRPKFVKD
PANB_RUTMC       IVLECIPANLAKQVSQSLS-IPTIGIGAGVNCDGQILVSYDMLGIH----VGYVPKFVKN
PANB_VESOH       IVLECVPAELAKQVSQSVS-IPIIGIGAGLDCDGQVLVSYDMLGVH----VRHVPRFVKN
PANB_ALKEH       LLLECVPAELGRRISQGLE-IPVIGIGAGPDCDGQILVLQDILGVTP---G-RIPRFSKN
PANB_HALHL       LILECVPAVLAQQLSERLT-VPVVGIGAGGGCDGQILVLHDVLGVTE-----QPPRFARA
PANB_NITOC       LILECVPARLGSKITDALK-IPVISCGAGPYCDGQVLVLYDMLGISP---G-KSPSFSRN
PANB_HYDCU       LVLECVPAQLAKQITQNLS-IPVIGIGAGHETDGQVLVLHDVLGLTI---G-KAPKFSKN
PANB_METCA       LVLECIPWELAQEITAAVD-IPTIGIGAGRHCDGQVLVWQDMLGMSA-----RLPRFCKD
PANB_ANADE       LVLECIPSELARIVTSQLR-IPTIGIGAGPHCDGQVLVLNDLLGLD----ASFTPKFVKR
PANB_MYXXD       LVLEGVPMDLARTVTQRLS-IPTIGIGAGVDCDGQVLVCYDLLGMN----PDFKPKFVKR
PANB_MAGMM       IILEGIPAALAQQVSQSLT-IPTIGIGAGVGCDGQVLVIYDMLGLY----GDLAPKFVKR
PANB_CAMJE       LVLECVPVKLAQKISSILE-IPTIGIGSGKYCDGQVLVYHDLLGLNK---D-FKAKFVKH
PANB_CAMJJ       LVVECVPVKLAQKISSILE-IPTIGIGSGKYCDGQVLVYHDLLGLNK---D-FKAKFVKH
PANB_CAMJR       LVLECVPVKLAQKISSILE-IPTIGIGSGKYCDGQVLVYHDLLGLNK---D-FKAKFVKH
PANB_AQUAE       IVLESVPTHLAKELWKGSN-SIVIGIGAGKYVDGQVLVFHDIVGLFE---D-FKPKFVRR
PANB_BACAN       LVLECVPMQLAELISEQLT-IPTIGIGAGQKVDGQVLVYHDLISYGV---N-RVPKFVKQ
PANB_BACAH       LVLECVPMQLAELISEQLT-IPTIGIGAGQKVDGQVLVYHDLISYGV---N-RVPKFVKQ
PANB_BACCZ       LVLECVPMQLAELISEQLT-IPTIGIGAGQKVDGQVLVYHDLISYGV---N-RVPKFVKQ
PANB_BACHK       LVLECVPMQLAELISEQLT-IPTIGIGAGQKVDGQVLVYHDLISYGV---N-RVPKFVKQ
PANB_BACCR       LVLECVPMQLAELISEQLT-IPTIGIGAGQKVDGQVLVYHDLISYGV---N-RVPKFVKQ
PANB_BACC1       LVLECVPMQLAEFISKQLT-IPTIGIGAGQKVDGQVLVYHDLISYGV---N-RVPKFVKQ
PANB_GEOKA       LVLECVPKQLGAAMARELT-IPVIGIGAGAEVDGQVLVYHDLLGYGV---T-RVPKFVKQ
PANB_GEOTN       LVLECVPKQLGAAVARELT-IPVIGIGAGAEVDGQVLVYHDLLGYGV---N-RVPKFVKQ
PANB_BACSU       LVLECVPAELTAKIAETLS-IPVIGIGAGVKADGQVLVYHDIIGHGV---E-RTPKFVKQ
PANB_BACLD       LVLECVPAALAERISKELT-IPVIGIGAGAGTDGQVLVYHDVVGHGV---S-RTPKFVKQ
PANB_LISIN       IVLEAIPRQLAEKVTKALT-IPTIGIGAGLETDGQVLVYHDIIGYGI---N-RRAKFVKA
PANB_LISW6       IVLEAIPRQLAEKVTKALT-IPTIGIGAGVETDGQVLVYHDIIGYGI---S-RRAKFVKA
PANB_LISMF       LVLEAIPRQLAEKVSKALS-IPTIGIGAGVETDGQVLVYHDIIGYGI---S-RRAKFVKA
PANB_LISMO       IVLEAIPRQLAEKVSKALS-IPTIGIGAGLETDGQVLVYHDIIGYGI---S-RRAKFVKA
PANB_DESHY       LVLECIPKQLAQEISTNLT-IPTIGIGAGVHTDGQVLVYHDILTYGV---N-RAPKFVKA
PANB_BACHD       LVLECVPEQVATQISEELT-IPVIGIGAGAGCDGQVLVYHDVIGYGA---G-HVPSFVKQ
PANB_BACSK       IVVECVPKQLGALLAKEIN-VPIIGIGAGAETDGQVLVYHDVIGYES---E-RVAKFVKQ
PANB_STAA3       LVLEAIPNDLAEEISKHLT-IPVIGIGAGKGTDGQVLVYHDMLNYGV---E-HKAKFVKQ
PANB_STAA8       LVLEAIPNDLAEEISKHLT-IPVIGIGAGKGTDGQVLVYHDMLNYGV---E-HKAKFVKQ
PANB_STAAS       LVLEAIPNDLAEEISKHLT-IPVIGIGAGKGTDGQVLVYHDMLNYGV---E-HKAKFVKQ
PANB_STAAW       LVLEAIPNDLAEEISKHLT-IPVIGIGAGKGTDGQVLVYHDMLNYGV---E-HKAKFVKQ
PANB_STAAN       LVLEAIPNDLAEEISKHLT-IPVIGIGAGKGTDGQVLVYHDMLNYGV---E-HKAKFVKQ
PANB_STAAM       LVLEAIPNDLAEEISKHLT-IPVIGIGAGKGTDGQVLVYHDMLNYGV---E-HKAKFVKQ
PANB_STAAB       LVLEAIPNDLAEEISKHLT-IPVIGIGAGKGTDGQVLVYHDMLNYGV---E-HKAKFVKQ
PANB_STAAC       LVLEAIPNDLAEEISKHLT-IPVIGIGAGKGTDGQVLVYHDMLNYGV---E-HKAKFVKQ
PANB_STAAR       LVLEAIPNDLAEEISKHLT-IPVIGIGAGKGTDGQVLVYHDMLNYGI---E-HKAKFVKQ
PANB_STAES       LVLEAIPSDLAREISQQLT-IPVIGIGAGKDTDGQVLVYHDMLNYGV---D-RHAKFVKQ
PANB_STAEQ       LVLEAIPSDLAREISQQLT-IPVIGIGAGKDTDGQVLVYHDMLNYGV---D-RHAKFVKQ
PANB_STAHJ       LVLEAIPSDLAGLISEQLD-IPVIGIGAGKDTDGQVLVYHDMLNYGV---D-RYAKFVKQ
PANB_STAS1       LVLEAVPSDLAAEISDKLD-IPVIGIGAGKETDGQVLVYHDLLNYAV---E-HRAKFVKQ
PANB_OCEIH       LVLEAIPSDLAHVITESLT-IPVIGIGAGVGTNGQVLVYHDVLNYGV---E-HKPKFVKR
PANB_BRUA2       VVIEGTVEPLAREITALID-IPTVGIGASSACDGQVLVSDDMLGLFQ---D-FTPRFVKR
PANB_BRUAB       VVIEGTVEPLAREITALID-IPTVGIGASSACDGQVLVSDDMLGLFQ---D-FTPRFVKR
PANB_BRUME       VVIEGTVEPLAREITALID-IPTVGIGASSACDGQVLVSDDMLGLFQ---D-FTPRFVKR
PANB_BRUSU       VVIEGTVEPLAREITALID-IPTVGIGASSACDGQVLVSDDMLGLFQ---D-FTPRFVKR
PANB_AGRFC       IVVEGTVEPLARELTEKLA-APTVGIGASPACDGQVLVSDDMLGLFS---D-FKPKFVKR
PANB_RHIEC       VVIEGTVEPLAREVTSAMH-IPTIGIGASAACDGQVLVSDDILGLFN---D-FKPRFVKR
PANB_RHIL3       VVIEGTVEPLAREVTSAVH-VPTIGIGASSACDGQVLVSDDILGLFN---D-FTPRFVKR
PANB_RHIME       IVVEGTVEPVAREITATLR-APTIGIGASPACDGQILVSDDMLGLFN---D-FKPRFVKH
PANB_BORBR       VVIEGTLEPVARAITEALP-VPTIGIGASPACGGQILVSDDVLGLFS---D-FTPRFVKR
PANB_BORPA       VVIEGTLEPVARAITEALP-VPTIGIGASPACGGQILVSDDVLGLFS---D-FTPRFVKR
PANB_BORPE       VVIEGTLEPVARAITEALP-VPTIGIGASPACGGQILVSDDVLGLFS---D-FTPRFVKR
PANB_MAGSA       VVVEGTVEPVAQALSAEIA-IPTIGIGASAACDGQVLVIDDLVGLFD---D-FTPKFVKR
PANB_RHORT       IVVEGTFEQVAARATREVS-VPTIGIGASADCDGQVLVIDDALGLFT---D-FTPKFVKR
PANB_GRABC       IVLEGTLEPVAAGMTRSVA-VPIIGIGASPHCDGQVLVTDDMLGLYG---S-FQPRFVKR
PANB1_PSEAE      VVIEGVGEPLARRLSEELA-IPCIGIGASPACDGQVLVSEDLLGLSG---E-QVPRFVER
PANB1_PSEAB      VVIEGVGEPLARRLSEELA-IPCIGIGASPACDGQVLVSEDLLGLSG---E-QVPRFVER
PANB2_BURCH      VVIEGTAEALARHLTETLT-IPTIGIGASPACDGQVLVTEDMIGAFD---A-YTPRFVKR
PANB2_BURCM      VVIEGTAEALARHLTGTLT-IPTIGIGASPACDGQVLVTEDMIGAFD---A-YTPRFVKR
PANB1_BURL3      VVIEGTAEALARHITETLT-IPTIGIGASPACDGQVLVTEDMIGAFD---A-YTPRFVKR
PANB1_PSEE4      LLLEGVAEPLARRISQQSQ-QPCIGIGASPACDGQILVTEDLLGLGG---P-QQPRFVKQ
PANB1_PSEF5      LLLEGVAEPLARRISDFSP-MPTIGIGASPACDGQVLVTEDLLGLGG---P-QVPRFVKQ
PANB1_HAHCH      LLVEGAFEEAARKVTAAVT-IPTVGIGASPECDGQVLVTEDILGLFS---G-YTPKFAKR
PANB_BARHE       VVVEGVVEPLAVKLTQMLS-IPTIGIGASSQCDGQILVMEDMLGYG----T-WVPKFVRR
PANB_BARQU       VVVEGVVEPLAVRLTEMLS-IPTIGIGASSQCDGQILVMEDMLGYG----T-WVPKFVRR
PANB_BARBK       VVVEAVVEPLAVKLTEKLS-IPTIGIGASNQCDGQILVMEDMLGYG----A-WAPKFVRR
PANB_RHOP2       VVVEAVAEPLGRKITETIA-IPTIGIGASAACDGQVLVLEDMLGLS----P-RTPKFVKR
PANB_RHOPS       VVVEAVAEPLGRKITETIA-IPTIGIGASAACDGQVLVLEDMLGLS----P-RAPKFVKR
PANB_RHOPA       VVVEAVAEPLGRKITEMIS-IPTIGIGASAACDGQVLVLEDMLGLS----P-KPPKFVKR
PANB_NITHX       MVIEAVAEPLARKITESVA-IPTIGIGASPACDGQVLVLEDMLGLS----P-RAPKFVRR
PANB_NITWN       MVIEAVAEPLARRITETVA-IPTIGIGASPACDGQVLVLEDMLGLS----P-RAPKFVRR
PANB_RHOP5       VVIEAVAEPLAAKITKDIA-IPTIGIGASPACDGQVLVLEDMLGLS----P-WAPKFVKR
PANB_RHOPB       VVIEAVAEPLARKITADIA-IPTIGIGASAACDGQVLVLEDMLGLS----P-WAPKFVKR
PANB3_BRADU      IVIEAVAEPLARKITQSIA-VPTIGIGASAACDGQILVLEDMLGLS----P-RSPKFVRR
PANB_HYPNA       IVIEGVAEDLAAAITAEVS-CPTIGIGASAACDGQVLVTQDMLGLF----D-WTPKFVRR
PANB_MARMM       IVIEGVAEDLAREITETVD-VPTIGIGASAACDGQILVTQDMLGVF----D-WTPKFVKR
PANB_CAUVC       IVVEGVAESLAREVTESVS-VPTIGIGASAGCDGQVLVVDDMLGLF----D-WTPKFVRR
PANB2_ZYMMO      VVLEGVTEPLAREITDNIA-IPTIGIGASSYCDGQVLVLEDMLGFN----D-KVPRFVKK
PANB_ERYLH       IVIEGVLEPIAVAATEAVR-APTIGIGASAQCDGQVLVTEDMLGMF----E-RVPRFVKK
PANB_NOVAD       IVIEGVVEPIAIAITQAVA-CPTIGIGASAQCDGQVLVTEDMLGMF----E-RVPRFVKI
PANB_SPHAL       IVIEGVLESIAIEITNKVA-CPTIGIGASAQCDGQVLVTDDMLGMF----E-RVPKFVKR
PANB_RHOS1       VVLEKVPDGLSQRITQRIA-IPTIGIGASAHCDGQVLVLDDMLGLFA---D-FRPKFVKR
PANB_RHOS4       VVLEKVPDGLSQRITQRIA-IPTIGIGASAHCDGQVLVLDDMLGLFA---D-FRPKFVKR
PANB_RUEPO       VVLEKVPATLADRITAEVA-IPTIGIGASAGCDGQILVVDDMLGFFT---A-FKPKFVKR
PANB_RUEST       VVLEKVPASLADQVTEIVD-IPTIGIGASAGCDGQVLVVDDMLGFFG---A-FKPKFVKR
PANB_ROSDO       VVLEKTPQGLSDEITASID-IPTIGIGASAGCDGQILVVDDMLGLFT---A-FKAKFVKR
PANB_CHESB       VVLEKVPEPLARRITKEIP-IPTIGIGASPACDGQVLVVDDMLGMFT---D-FRPKFVKR
PANB_PARDP       VVLEKLPEALGRRITQEIA-VPTIGIGAGLDCDGQVLVVDDMLGLFS---D-FRPKFVKR
PANB_RHILO       VVIEGTIEAVAADITRRIA-IPTIGIGASGDCDGQILVIDDMVGLTV---D-RVPKFVKE
PANB_ANAMM       VVLECISPSLAAELTQELP-VPTIGIGASNACDGQILVVDDMLGQS----S-RYPKFVKR
PANB_PELUB       IVLECVESSLAKEITKTVK-VPTIGIGASVHCDGQVLVTDDLIGLN----K-IKARFVKR
PANB_HELPY       LVLEGITTPIAQKITQKIK-IPTIGIGSGKDCDGQILVWSDMLGFFD---S-FKPKFVRE
PANB_HELPH       LVLEGITTPIAQTITQKIK-IPTIGIGSGKDCDGQILVWSDMLGFFD---S-FKPKFVRE
PANB_HELPJ       LVLEGITTPIAQTITQKIK-IPTIGIGSGKDCDGQILVWSDMLGFFD---S-FKPKFVRE
PANB_HELAH       LVLEGITTPIAQVITQKIK-IPTIGIGSGKDCDGQILVWSDMLGFFD---S-FKPKFVRE
PANB_HELHP       ILIEGVKSESGARITQALE-IPTIGIGAGVECDGQILVWSDAFGFFD---E-FKPKFVRR
PANB_CAMFF       FLLEGIVSSVASEISQKLK-VPTIGIGSGASCDGQVLVWSDAFGFFD---E-FKPKFVKR
PANB_WOLSU       LVLEGVKAEVAQEVARSVS-VPVIGIGSGSQVDGQVLVWSDMLGFFE---G-FTPKFVRR
PANB_SULDN       MVIEGVKADVAAQVAASVK-IPVIGIGAGRDVDGQVLVFSDMLGLFE---E-FTPKFVKK
PANB_BDEBA       VVLECVPSKLAKEITAALE-IPTIGIGAGVDCDGQVLVLQDMLGMNQ---G-FKPKFVKT
PANB_COXBU       VVLECVPSELAELITHSIS-IPTIGIGAGPATSGQVLVLQDLLGTNN---Q-FQPKYLKK
PANB_FRATT       IVLECIPANIAKDITQNLD-IPTIGIGAGSNTDGQILVLQDMLGMNT---D-FQPKFVKK
PANB_FRAT1       IVLECIPANIAKDITQNLD-IPTIGIGAGSNTDGQILVLQDMLGMNT---D-FQPKFVKK
PANB_FRATH       IVLECIPANIAKDITQNLD-IPTIGIGAGSNTDGQILVLQDMLGMNT---D-FQPKFVKK
PANB_FRATO       IVLECIPANIAKDITQNLD-IPTIGIGAGSNTDGQILVLQDMLGMNT---D-FQPKFVKK
PANB_FRATW       IVLECIPANIAKDITQNLD-IPTIGIGAGSNTDGQILVLQDMLGMNT---D-FQPKFVKK
PANB_FRATN       IVLECIPANIAKDITQNLD-IPTIGIGAGSNTDGQILVLQDMLGMNT---D-FQPKFVKK
PANB_LEGPH       VVIECVPQELAKTITDSLV-IPTIGIGAGPGTDGQVLVWHDMLGLQT---S-FNPKFVKK
PANB_LEGPA       VVIECVPQDLAKTITDSLV-IPTIGIGAGPGTDGQVLVWHDMLGLQT---S-FNPKFVKK
PANB_LEGPL       VVIECVPQDLAKTITDSLV-IPTIGIGAGPGTDGQVLVWHDMLGLQT---S-FNPKFVKK
PANB_LEPIC       MVLEMIPAELGKKVSQEVG-VPTIGIGAGSDCDGQVLVLNDLLGLDI---N-FQPKFLKK
PANB_LEPIN       MVLEMIPAELGKKVSQEVG-VPTIGIGAGSDCDGQVLVLNDLLGLDI---N-FQPKFLKK
PANB_LEPBJ       IVLEMIPAELGKRVSEEVG-VLTIGIGAGPDCDGQVLVLNDLLGLDA---N-FQPKFLKK
PANB_LEPBL       IVLEMIPAELGKRVSEEVG-VPTIGIGAGPDCDGQVLVLNDLLGLDA---N-FQPKFLKK
PANB_HYPBU       VVIEFTAWEVAREITRKLS-IPTICIGSGPYCDGQVLVIHDLLGLT----P-TPPPFAKK
PANB_STAMF       IVIEFTAADIAEEITKEVS-VPTICIGSGPYCDGQVLVLHDLLGIY----E-EIPPFAKK
PANB_AERPE       IVLEFVSEEAAEMVTRRVP-VPTICIGSGRRCDGQIIVFHDIVGLS----R-HTPPFAKK
PANB_SULAC       LVIENTYADVAKKITEKLK-VPTICIGAGPYCDGQILVIHDVLGLS----E-FTPYFAKA
PANB_SULTO       IVIENTYSDVAKKITESIS-IPTICIGAGPYCDGQILVIHDLLGLS----D-FTPYFAKK
PANB_SACS2       IVIENTYVDIAKRITEKLN-VPTICIGAGPYCDGQVLVIHDLLGLS----E-VTPYFAKS
PANB_PYRFU       VVLEFVLADVAKLVTEEVS-IPTIGIGSGPYVDGQVLVWHDVLGLY----E-SSPPFAKR
PANB_PYRHO       IVLEFVLADVAKLVTEEVS-IPTIGIGSGPYVDGQVLVWHDVLGLY----E-SSPPFAKR
PANB_PYRAB       VVLEFVLADVAKLVTEEVS-IPTIGIGSGPYVDGQVLVWHDVLGLY----E-ESPPFVKR
PANB_THEKO       VVLEFVLADVAKLVTEEVS-IPTIGIGAGPHVDGQVLVWHDLLGIY----E-NVPPFVKK
PANB_PYRAE       LVIEFVPASVAKEITEAVD-IPTICIGAGPHCDGQILVLHDIIGLT----E-RPPSFAKR
PANB_PYRAR       IVVEFVPASVAKEVTQSVD-VPTICIGAGPHCDGQILVLHDVVGLS----E-RTPSFAKR
PANB_PYRIL       IVLEFVPASLAREVTQAVD-IPTICIGSGPHCDGQILVLHDVIGLS----E-RPPSFAKR
PANB_PYRCJ       LVVEFVPASLAKEVTEAVK-IPTICIGAGPHCDGQILVLHDIIGLS----E-KPPSFAKR
PANB_THEMA       IVLELVVEEVAKEITESVS-IPTIGIGSGRFCDGQVLVWHDLLGLNP---D-FAPRFSKK
PANB_DEIRA       VVLEAIPARLARLISERLS-VATIGIGAGVHCDGQVLVYHDLLGLYE---G-EEKKIAKR
PANB_DEIGD       VVLEAIPARLARLITERLH-VPTIGIGAGVHCRGQVLVYHDLLGLYE---G-DEKKLAKR
PANB_THET2       VVLEMVPARLAKEVTERLS-VHTVGIGAGPHTDAQVLVFHDVVGLYG---D-FKPRFVKR
PANB_THET8       VVLEMVPARLAKEVTERLS-VHTVGIGAGPHTDAQVLVFHDVVGLYG---D-FKPRFVKR
PANB1_METPP      LEFEAVPAKIATLISKQLE-IPTIGIGAGAGCDGQILLSYDLLGVFT---D-FKPKFTKR
PANB_ENTFA       VVLECVPTKLAELISKEIS-IPTIGIGAGAGCDGQILVYQDMLGMYS---D-FTPKFVKK
PANB_CLONN       IVLECVPAKLAELITKAVS-IPTIGIGAGAGCDGQILVYQDMLGMFS---D-MSPKFVKK
PANB_CLOAB       ITLEGIPEKLAKIITESIT-IPTIGIGAGKHCDGQILVYQDMLGMFS---D-LAPKFVKR
PANB_CLOD6       IVLEGVPTKIAEMVTNSIS-IPTIGIGAGINCDGQILVYQDMLGMFG---D-FVPKFVKQ
PANB_HUNT2       VVLECVPYKLAAFISKRLD-IPTIGIGSGPDCDGQVLVIHDLTGMFK---D-FTPKHVKK
PANB_DEHM1       IVLETMPAELAAMITAAVS-IPTIGIGAGENCDGQVQVVSDMLGMFT---D-FVPKHTKK
PANB_DEHMC       IVLETMPAELAAIITAGIS-IPTIGIGAGEECDGQVQVISDMLGMFT---D-FVPKHTKR
PANB_CARHZ       IVLECVPAALAAKITESIP-IPTIGIGSGVNCDGQVLVYHDVLGMYP---R-MLPKFVKR
PANB_SYNWW       IVLECVPSELARRVTEEIS-VPTIGIGAGPYCDGQVLVINDMLGMFR---G-FTPKFVRK
PANB_SYNAS       VVLECVPAPLAQRITDDLA-IPTIGIGAGAGCDGQVLVVNDMLGIYE---R-FTPKFVKK
PANB_DESPS       LVLECIPAGLAEVVTASIA-VPTVGIGAGKGCDGQVLVINDMLGLFE---K-FTPKFVKH
PANB_MOOTA       LVLECVPADLARRITAALP-VPTIGIGAGPDCDGQVLVYHDLLGLFD---R-FRPKFVKQ
PANB_DESVH       LVLECVPAPVAEQVTARLH-IPTIGIGAGAGCDGQVLVLHDMLGLYG---E-LSPRFVKR
PANB_DESVV       LVLECVPAPVAEQVTARLH-IPTIGIGAGAGCDGQVLVLHDMLGLYG---E-LSPRFVKR
PANB_DESAG       LVLEAIPAPVAAHITRTSG-IPTIGIGAGAQCDGQVLVVHDMLGLFD---R-FTPKFVKR
PANB_SYNFM       IVLEGIPSNVAAMVTEAIP-VPTIGIGAGPDCDGQVLVIHDVLGLYD---R-FVPKFVKK
PANB_CENSY       IVLEMVAEEAARMVTKSVG-VPTIGIGSGAGCDGQVLVLHDMLGLYG---R-FRPKFAKV
PANB_MYCTU       VVMEMVPAELATQITGKLT-IPTVGIGAGPNCDGQVLVWQDMAGFSG---A-KTARFVKR
PANB_MYCBO       VVMEMVPAELATQITGKLT-IPTVGIGAGPNCDGQVLVWQDMAGFSG---A-KTARFVKR
PANB_MYCBP       VVMEMVPAELATQITGKLT-IPTVGIGAGPNCDGQVLVWQDMAGFSG---A-KTARFVKR
PANB_MYCUA       VVMEMVPAELATQITGKLT-IPTIGIGAGPSCDGQVLVWQDMAGLSS---G-KAPRFVKR
PANB_MYCPA       VVMEMVPAELATQITGKLT-IPTIGIGAGPNCDGQVLVWQDMAGMSS---G-KSARFVKR
PANB_MYCA1       VVMEMVPAGLATQITGKLT-IPTIGIGAGPNCDGQVLVWQDMAGMSS---G-KSARFVKR
PANB_MYCLE       VVMEMVPTELATQITGKLT-IPTIGIGAGLNCDAQVLVWQDMAGLSS---G-KVARFVKQ
PANB_MYCSJ       VVMEMVPAELATQITGKLT-IPTVGIGAGPNCDAQVLVWQDMAGLTS---G-RTAKFVKR
PANB_MYCSK       VVMEMVPAELATQITGKLT-IPTVGIGAGPNCDAQVLVWQDMAGLTS---G-RTAKFVKR
PANB_MYCSS       VVMEMVPAELATQITGKLT-IPTVGIGAGPNCDAQVLVWQDMAGLTS---G-RTAKFVKR
PANB_MYCVP       VVMEMVPAELATQITGKLT-IPTVGIGAGPSCDAQVLVWQDMAGMTN---G-KTAKFVKR
PANB_NOCFA       VVMEMVPAELAGQVTRKLT-IPTIGIGAGPDCDAQVLVWQDMAGYTS---G-KTAKFVKR
PANB_RHOJR       VVMEMVPAEIAGQVTRKLT-IPTVGIGAGVECDAQVLVWQDMAGYTS---G-KTAKFVKR
PANB_LEIXX       VVLEMVPADVAQRVTQELR-IPTIGVGAGPHVDGQLLVWTDWAGFTT---G-RVPRFAKQ
PANB_SACEN       VVLEMVSSDSAKRVTAELT-IPTVGIGAGPECDAQVLVWTDMAGMNT---G-RTARFVKR
PANB_PAEAT       VLMEMVPAETAAAVDAALR-VPTVGIGAGKTTTGQVLVWQDMAGLRG---G-KMAKFVKQ
PANB_ARTS2       VLMEMVPAATAAAVDAAIA-VPTVGIGAGNTTTGQVLVWQDMAGLRG---G-KMAKFVKQ
PANB_NOCSJ       VVMEMVPGDVAAEVTKSVS-IPTIGIGAGLDCDGQVLVWQDAFGLRT---G-RMPRFVKQ
PANB_FRAAA       VVLEVVPADLAARVTKELH-IATVGIGAGADCDAQVLVWQDMAGLSG---G-HVPRFVKR
PANB_FRACC       VVLEVVPADLATRVTKELR-IATVGIGAGSGCDAQVLVWQDMAGLSG---G-RTPRFVKR
PANB_ACIC1       IVLELVPAGLAAELTAALQ-IPTIGIGAGPDCDAQVLVWTDMAGLTP---Q-PTPKFVKR
PANB_STRAW       VVLELVPAELAAEVTRVLH-IPTVGIGAGPETDAQVLVWTDMLGLTG---G-KVPKFVKK
PANB_STRCO       VVLELVPAELAAEVTRTLH-IPTVGIGAGPDTDAQVLVWTDMLGLTG---G-RMPKFVKQ
PANB_THEFY       VVLECVPARVGAEITRQLT-VPTIGIGAGPDTDAQVLVWQDMAGLSP-----RVAKFVKS
PANB_CORGL       VVLEMVPAEAAREVTEDLS-ITTIGIGAGNGTDGQVLVWQDAFGLNR---G-KKPRFVRE
PANB_CORGB       VVLEMVPAEAAREVTEDLS-ITTIGIGAGNGTDGQVLVWQDAFGLNR---G-KKPRFVRE
PANB_COREF       VVLEMVPAEIATEVTNQLD-IATIGIGAGNGTDGQVLVWQDAFGFNR---G-RKPRFVRE
PANB_CORDI       VVFEMVPADLAAELTARCP-IPVIGIGAGNATDAQVLVWHDIANLPK---GDHRARFVKT
PANB_CORJK       VVLEMVPADVAASVTKELD-IPTIGIGAGPDCDGQVLVWHDMAAFPA---GGHRPRFAKQ
PANB_TROW8       VVMEMVTEDLAKTITSEIK-IATIGVGAGRYTDGQLLVINDLIGLSE---K--KITFAPR
PANB_TROWT       VVMEMVTEDLAKTITSEIK-ITTIGVGAGRYTDGQLLVINDLIGLSE---K--KITFAPR
PANB_BACFR       LVLEKIPAALASRVASELT-IPVIGIGAGGDVDGQVLVIQDMLGMNN---G-FRPRFLRR
PANB_BACFN       LVLEKIPAALASRVASELT-IPVIGIGAGGDVDGQVLVIQDMLGMNN---G-FRPRFLRR
PANB_BACTN       IVLEKIPATLAERVASELT-IPIIGIGAGGHVDGQVLVIQDMLGMNN---G-FRPRFLRR
PANB_PORGI       LVLEKIPAELATRVASELS-IPVIGIGAGGGVDGQVLVMHDMLGITE---G-FSPRFLRR
PANB_CYTH3       LVLEKIPASLSKTVTHQLQ-IPTIGIGAGPDVDGQVLVTHDLLGINN---E-FHPRFLRT
PANB_GRAFK       IVLEKVPAELAKEVAESIT-IPVIGIGAGNGVDGQVLVVHDMLGMTH---E-FNPRFLRR
PANB_SALRD       VVLEKIPAELAAEVTASLS-IPTIGIGAGDQTDGQVLVSHDALGLST---D-FEPRFVRR
PANB_CHLCH       IVLEKIPSALAAQVTASLT-IPTIGIGAGVACDGQVLVINDILGLNR---E-FHPRFVRQ
PANB_CHLPD       VVLEKIPSALAAEVTLMLT-IPTIGIGAGSHCDGQVLVVNDILGLNR---E-FHPRFVRQ
PANB_PELLD       VVLEKIPAGLAAEISRLLS-IPTIGIGAGAECDGQVLVVNDILGLNR---E-FHPRFVRQ
PANB_CHLTE       IVLEKIPSKLAGEVSRLLT-IPTIGIGAGPECDGQVLVINDMLGLST---D-FRPRFVRR
PANB_RHOBA       VLIECVPSEAAAAITDAVK-VPTIGIGAGRDVSGQVLVTHDILGLTS---G-YTPKFTRL
PANB_GEOSL       VVLEGIPLKLAGRITAELS-IPTIGIGAGPHCDGQVLVIHDILGLCE---K-YSPKFVKR
PANB_GEOMG       VVLEGIPLKLAEKITEELS-IPTIGIGAGPHCDGQVLVIHDILGLCE---K-YSPKFVKR
PANB_PELCD       VVLEGIPAGLAGQITEALD-IPTIGIGAGVDCDGQVLVIHDILGLCE---K-YSPRFVKR
PANB_PELPD       IVLEGIPSSLAASITAELS-IPTIGIGAGPDCDGQVLVIHDILGLCE---K-YSPKFVKR
PANB_KORVE       LVLEGIPREVAAMITAEVE-TPTIGIGAGPDCDGQVLVFHDILNLTF---A-PPAKFVRR
PANB2_BRADU      LVLEGIPAELAARATESLT-IPTIGIGAGADCSGQVLVFHDVLG----LTEGHRPKFVRA
PANB1_BRADU      LVLEGTPAELTARVSDSLT-IPTIGIGSGPDCSEQVLCFMTCWAKPKVIAPNSFPPIRKA
PANB_NOSS1       IVLEHIPADLAMQITQKVN-IPTIGIGAGSHCDGQVLVTSDVLGLSE-----RQPPFAKV
PANB_TRIV2       IVLEHIPADLAMQITQKLS-IPTIGIGAGSHCDGQVLVTSDVLGLSE-----RQPPFAKV
PANB_SYNP6       IVLEHIPDRLAAMITAKLS-IPTIGIGAGPNCDGQILVTADLLGLTP-----SQPPFAPA
PANB_SYNE7       IVLEHIPDRLAAMITAKLS-IPTIGIGAGPNCDGQILVTADLLGLTP-----SQPPFAPA
PANB_SYNY3       IVLEHIPSELAASITEQLP-IPTIGIGAGPQCDGQVLVTADLLGLTV-----KQPPFAPA
PANB_TRIEI       LVLEHIKADLAKEITEKVS-IPTIGIGAGAYCDGQILVINDVLGLSH-----WQPPFAKP
PANB_THEEB       VILEHIPAALAQQITAQLK-IPTIGIGAGPHCDGQVLVTADVLGLSP-----QVPPFAKV
PANB_SYNJA       LVLEHMPAELAAQITQQVG-IPTLGIGAGPACDGQILVTHDLLGLSE-----RIPPFAKA
PANB_SYNJB       LVLEHMPAELAAQISAQVG-IPTLGIGAGPACDGQILVTHDLLGLSE-----RLPPFAKA
PANB_GLOVI       LVLEHIPYDLAGEISGKLV-IPTVGIGAGPHCNGQILVTHDLLGLTE-----NPPPFVNP
PANB_PROM0       IVLEHIPDLLAKEIQNSLT-IPTIGIGAGNYCDGQVRVTADLLGLND-----DQPPFCQP
PANB_PROMS       IVLEHIPDLLAKEIKNSLT-IPIIGIGAGNYCDGQVRVTADLLGLND-----DQPPFCQP
PANB_PROM9       IVLEHMPELLAKEIQNNLT-IPTIGIGAGNFCDGQVRVTADLLGLND-----DQPPFCQP
PANB_PROM5       IVLEHIPELLAKEIQTDLE-IPTIGIGAGVFCDGQVRVTADLLGLSD-----KQPPFCKP
PANB_PROMP       IVLEHIPELLAKEIQTELE-IPTIGIGAGKFCDGQVRVTADLLGLND-----KQPPFCRP
PANB_PROM1       IVLEHIPAEIASRLKKHID-IPVIGIGAGSDCDGQVRVTADILGLSI-----AQPPFAKP
PANB_PROMT       IVLEHIPGEIASRLKKHID-IPVIGIGAGNDCDGQVRVTADILGLSI-----AQPPFAKP
PANB_PROM3       LVVEHVPSSIARCLSQQLT-IPVIGIGAGEDCDGQVRVTADLLGLTP-----SQPPFSPP
PANB_PROMM       LVVEHVPSSIARCLSQQLT-IPVIGIGAGEDCDGQVRVTADLLGLTP-----SQPPFSQP
PANB_PROMA       VVLEHVPSKVASKVTQMLK-IPVIGIGAGEECDGQVRVTADLLGLTD-----KQPPFAKP
PANB_SYNPX       LVLEHVPSALAREVRRRLL-IPVIGIGAGDDCDGQIRVTADLLGLTE-----QQPPFSPA
PANB_SYNS9       LVLEHVPSELAARARHELG-IPVIGIGAGDDCDGQVRVTADLLGLTP-----HQPPFSPP
PANB_SYNSC       LVLEHVPAELACRVQQALT-IPVIGIGAGDDCDGQVRVTADLLGLTA-----KQPPFSPA
PANB_SYNS3       LVVEHVPSELAGRLRRTLS-IPVIGIGAGPDCDGQVSVTADLLGLTP-----SQPPFTPA
PANB_HALSA       LVLEHVPANVAADITDAID-IPTIGIGAGPDTDGQVLVISDVIGMSE-----RSPPFSKQ
PANB_HALMA       LVLEHIPANLAAKVTEAVD-IPTIGIGAGGDCDGQVLVFTDVVGLSE-----SSPPFAEQ
PANB_NATPD       LVLEHVPANLAASVTDALS-IPTIGIGAGPDCDGQVLVVDEVVGLAE-----GTAPFSKR
                 . .*                   :  *:.     *:                        

PANB_ECOK1       FLAET-----GDIRAAVRQYMAEVESGVYPG-EEHSFH----------------------
PANB_ECOUT       FLAET-----GDIRAAVRQYMAEVESGVYPG-EEHSFH----------------------
PANB_ECOL6       FLAET-----GDIRAAVRQYMAEVESGVYPG-EEHSFH----------------------
PANB_ECOL5       FLAET-----GDIRAAVRQYMAEVESGVYPG-EEHSFH----------------------
PANB_SHIBS       FLAET-----GDIRAAVRQYMAEVESGVYPG-EEHSFH----------------------
PANB_SHISS       FLAET-----GDIRAAVRQYMAEVESGVYPG-EEHSFH----------------------
PANB_SHIFL       FLAET-----GDIRAAVRQYMAEVESGVYPG-EEHSFH----------------------
PANB_SHIF8       FLAET-----GDIRAAVRQYMAEVESGVYPG-EEHSFH----------------------
PANB_ECOLI       FLAET-----GDIRAAVRQYMAEVESGVYPG-EEHSFH----------------------
PANB_ECO57       FLAET-----GDIRAAVRQYMAEVESGVYPG-EEHSFH----------------------
PANB_SHIDS       FLAET-----GDIRAAVRQYKAEVESGVYPG-EEHSFH----------------------
PANB_SALTY       FLAEA-----GDMRAAVQQYMAEVESGVYPG-EEHSFH----------------------
PANB_SALPA       FLAEA-----GDMRAAVQQYMAEVESGVYPG-EEHSFH----------------------
PANB_SALCH       FLAEA-----GDMRAAVRQYMAEVESGVYPG-EEHSFH----------------------
PANB_SALTI       FLAEA-----GDMRAAVRQYMAEVESGVYPG-EEHSFH----------------------
PANB_YERPA       FLAHSA----GDIRAAIKLYIEEVEGGIYPA-EEHTFQ----------------------
PANB_YERPN       FLAHSA----GDIRAAIKLYIEEVEGGIYPA-EEHTFQ----------------------
PANB_YERPP       FLAHSA----GDIRAAIKLYIEEVEGGIYPA-EEHTFQ----------------------
PANB_YERPE       FLAHSA----GDIRAAIKLYIEEVEGGIYPA-EEHTFQ----------------------
PANB_YERPS       FLAHSA----GDIRAAIKLYIEEVEGGIYPA-EEHTFQ----------------------
PANB_YERE8       FLAQSA----GDIRAAIKLYIQEVESGAYPA-EEHTFQ----------------------
PANB_PECAS       FLAQS-----GDIRTAVRLYSQEVEQGIYPA-EEHSFH----------------------
PANB_SODGM       FLAAG-----GDIAAAVRRYVQEVETGQFPA-AEHSFQ----------------------
PANB_BAUCH       FLTDS-----RDIPTAIQLYVQEVETGKFPA-VQHYFS----------------------
PANB_PHOLL       FLEEA-----GNIRDAIRLYKEQVESGIYPG-KEHSFY----------------------
PANB_PHOPR       YLAET-----GDMRTAVSKYLEEVEAGTFPG-PQHTFE----------------------
PANB1_ALIF1      FLAET-----GDMRKAVTKYIQDVEQGVFPV-AEHTFN----------------------
PANB_VIBVU       FLAET-----GDMRKAVALYMEQVQAGTFPD-EAHTIA----------------------
PANB_VIBVY       FLAET-----GDMRKAVALYMEQVQAGTFPD-EAHTIA----------------------
PANB_VIBPA       FLAET-----GDMRKAVAKYIEDVANGVFPD-DAHTIA----------------------
PANB_VIBCH       FLAET-----GDIRQAVAKYIEDVASGAFPD-LAHTIA----------------------
PANB2_ALIF1      FLAET-----GSIEAAVKKYIDEVKQQTFPG-EKHCF-----------------------
PANB_SHEON       YLKQT-----GEIRSAVRAYIEEVANGSFPS-AEHTFN----------------------
PANB_SHESA       YLKQT-----GEIRSAVRAYIEEVANGSFPS-ADHTFN----------------------
PANB_SHESM       YLKQT-----GEIRSAVRAYIEEVANGTFPS-SEHTFS----------------------
PANB_SHESR       YLKQT-----GEIRSAVRAYIEEVANGTFPS-SEHTFS----------------------
PANB_SHESW       YLKQT-----GEIRSAVRAYIEEVAAGTFPS-AEHTFS----------------------
PANB_SHELP       YLAQT-----GEIRSAIRAYIEEVDTGVFPA-AEHTFS----------------------
PANB_SHEAM       YLKQT-----GEIRAAVRAFIDEVADGSFPG-PEHTFN----------------------
PANB_SHEFN       YLKQT-----GEIRSAIRAYIDEVANGTFPA-EEHTFN----------------------
PANB_SHEDO       YLKQT-----GEIRSAIKAYIDEVAAGDFPS-EEHTLV----------------------
PANB_COLP3       FLKDT-----GDIKKAVELYISEVSEGNFPG-DEHIFK----------------------
PANB_AERHH       FLAET-----GDMRAAIRLYVKQVSEGTFPG-PEHCFN----------------------
PANB_AERS4       FLAET-----GDMHAAIRLYVQQVSEGTFPG-PEHSFN----------------------
PANB_PSEA6       YLQET-----GDMRTAVSQYIEEVKDGSFPS-EAHSFSK---------------------
PANB_PSYIN       FLLET-----GDIRQAVTLYIDQVESRQFPS-AEHSFY----------------------
PANB_PSET1       FLLET-----GNMPEAVKKYCTDVKSGAFPS-AEHEFK----------------------
PANB_IDILO       FLAQG-----GSLADAFRLYSEQVRSGEFPT-AEHSYK----------------------
PANB_BUCAI       FLSES-----DSIQKAIQKYIYEVEHSIYPS-KKHSF-----------------------
PANB_BUCAP       FLCHN-----GSIQNAIKQYINEVKNGNFPS-EKYSF-----------------------
PANB_WIGBR       FTKNK-----FGIEKAIELYIEEVENELFPS-ENHSFN----------------------
PANB2_PSEAE      FMQ-----GQESIPAAIAAYVRAVKDVSFPA-AEHGFNA---------------------
PANB2_PSEAB      FMQ-----GQESIPAAIAAYVRAVKDVSFPA-AEHGFNA---------------------
PANB_PSEPK       FMQ-----GQPDIHSALVAYVEAVKQVSFPG-SEHGFSA---------------------
PANB2_PSEE4      FMA-----GQPDIQSALAAYVEAVKTVSFPA-SEHGFSA---------------------
PANB_PSE14       FMT-----GQPDIQSAIRAYVAAVKDVSFPA-TEHGFSA---------------------
PANB_PSEU2       FMT-----GQPDIQSAIRAYVTAVKDLSFPA-TEHGFSA---------------------
PANB_PSESM       FMI-----GQPDIQSAIQAYVSAVKDVSFPA-IEHGFSA---------------------
PANB2_PSEF5      FMA-----GKDSIQAALSAYVEEVKAVTFPG-AEHGFSA---------------------
PANB_PSEPF       FMQ-----GQDSIQSALKAYVSEVKATTFPG-IEHGFSA---------------------
PANB_PSEU5       FMR-----EHGDIPAAIAGYVKAVKAVEFPA-AEHGFSA---------------------
PANB_MARHV       FLA-----ETDSIPEAIAAYAQAVKARTFPA-EEHTFKA---------------------
PANB2_HAHCH      FLA-----GSDSIQAAFKGYVEAVKSGAFPA-EEHSFNI---------------------
PANB_ALCBS       FMA-----ETGDMRAAFKAYDDAVKDGSFPA-DEHCF-----------------------
PANB_PSYA2       FLTDER-NTEHSIEGAFALYQQSVKEGSFPK-EQHQFS----------------------
PANB_PSYCK       FLTDER-NTEHSIEGAFALYQQSVKEGSFPT-EQHQFS----------------------
PANB_ACIAD       FMK-EQ-AGETAIVDAFKAYHAAVQDQSFPA-REHTFQVEL-------------------
PANB_CHRSD       FLA-----GRDSIQAAFEAYRDAVKTRQFPA-EEHCF-----------------------
PANB_SACD2       FLLEA-----KDIPGALQKYAADVKSGVFPG-PEQQF-----------------------
PANB_NEIMB       FMQGH-----DSVQAAVRAYVAEVKAKTFPA-AEHIFAD---------------------
PANB_NEIMF       FMHGQ-----SSIQAAVRAYVAEVKAKTFPA-AEHIFAD---------------------
PANB_NEIMA       FMQGQ-----SSIQAAVRAYVAEVKAKTFPA-AEHIFAD---------------------
PANB_NEIG1       FMRGQ-----SSIQAAVRAYVAEVKAKTFPA-AEHIFAD---------------------
PANB_CHRVO       FMEEA-----GSIQGAVQAYIKAVKDKTFPA-EEHTY-----------------------
PANB_BURMA       FMQGQ-----PSIFAAVEAYVRAVKDGSFPG-PEHSF-----------------------
PANB_BURPS       FMQGQ-----PSIFAAVEAYVRAVKDGSFPG-PEHSF-----------------------
PANB_BURP0       FMQGQ-----PSIFAAVEAYVRAVKDGSFPG-PEHSF-----------------------
PANB_BURP1       FMQGQ-----PSIFAAVEAYVRAVKDGSFPG-PEHSF-----------------------
PANB_BURTA       FMQGQ-----PSIFAAVEAYVRAVKDGSFPG-PEHSF-----------------------
PANB_BURCA       FMQGQ-----PNIQAAVEAYVSAVKDRSFPG-PEHSF-----------------------
PANB1_BURCH      FMQGQ-----PNIQAAVEAYVSAVKDRSFPG-PEHSF-----------------------
PANB1_BURCM      FMQGQ-----PTIQAAVEAYVRAVKDSSFPG-PEHSF-----------------------
PANB2_BURL3      FMQGE-----PNIQAAVEAYVRAVKDGSFPG-PEHSF-----------------------
PANB_PARXL       FMQGQ-----PSILAAVEAYVAAVKDGSFPG-PEHTF-----------------------
PANB_CUPNH       FMDGQ-----TSIEAAVRAYVAAVKDGSFPA-AEHTFSA---------------------
PANB_CUPPJ       FMDGQ-----TTIEGAIRAYVAAVKDGSFPA-AEHTFSA---------------------
PANB_CUPMC       FMEGQ-----PSIEAAIRAYVAAVKDGSFPA-VEHTFSA---------------------
PANB_RALSO       FMDGL-----TTIDAAVTAYVTAVKDGTFPG-PEHSFTA---------------------
PANB_NITEU       FMMDA-----DSIQTAVSNYVEAVKLGAFPA-YEHTF-----------------------
PANB_NITEC       FMAGA-----DSIQVAVRNYVKAVKTGEFPA-HEHMF-----------------------
PANB_NITMU       FLTGA-----GSIEEAVQNYTRAVKTGEFPG-PEHTF-----------------------
PANB_DECAR       FMEGA-----SSIHDAACRAIAAVKDGSYPG-PEHTYSA---------------------
PANB_METFK       FMQGA-----GSIEQAICDYVAAVKAQTFPG-IEHTFE----------------------
PANB_AZOSB       FMEGA-----ASIDAAVAAYVAAVKDGSFPA-AEHCY-----------------------
PANB_AROAE       FMTGK-----TDIDEAVASYVQAVRDGSFPA-AEHCY-----------------------
PANB_THIDA       FLAGA-----GSVDAAVRAYVAAVKDGSFPA-AEHAF-----------------------
PANB_ACIAC       FMAQA-----GSVRGAIEAYVQAVKAGRFPDDALHAW-----------------------
PANB_ACISJ       FMRDA-----GSVRGAIEAYVQAVKQGRFPDDALHAWN----------------------
PANB_VEREI       FMQDA-----GSVHGAIAAYVQAVKQGRFPDDALHAW-----------------------
PANB_POLNA       FMDGA-----PSVRGAMEAYVRAVKNVSFPDNSVHAW-----------------------
PANB_POLSJ       FMDGA-----PSVRGAMEAYVRAVKDGSFPVNATHAW-----------------------
PANB_RHOFT       FMTGA-----PGVKEAMQAYVAAVKNGSFPDNTQHAW-----------------------
PANB1_ZYMMO      FMRDA-----EDVPTAFAAYVAAVKDGSFPDDKLHGFL----------------------
PANB2_METPP      FMDSA-----TSIEDAVRRYVAAVKDGSFPDETLHAY-----------------------
PANB_XANAC       FLAEG-----GSVAGAVRAYAQAVRDGSFPD-AEHAYAA---------------------
PANB_XANC5       FLAEG-----GSVAGAVRAYAQAVRDGSFPD-AEHAYAA---------------------
PANB_XANOM       FLAEG-----GSVAGAVRAYAQAVRDGSFPD-AEHAYAA---------------------
PANB_XANOR       FLAEG-----GSVAGAVRAYAQAVRDGSFPD-AEHAYAA---------------------
PANB_XANCP       FLAEG-----GSVAGAVQAYAQAVRDGSFPD-AEHAYAA---------------------
PANB_XANC8       FLAEG-----GSVAGAVQAYAQAVRDGSFPD-AEHAYAA---------------------
PANB_XYLFA       FLAHG-----GSVAGAVRAYANAVRDGSFPD-VEHTYTS---------------------
PANB_XYLFT       FLAHG-----GSVAGAVRAYANAVRDGSFPD-VEHTYTS---------------------
PANB_RUTMC       FLIDS-----GDIKSAVNAFIEAVKDKSFPG-EQHSY-----------------------
PANB_VESOH       FLTDN-----GDVKSAVNAFIKAVKDKSFPS-KKYSY-----------------------
PANB_ALKEH       FMNGA-----GSIQCALQAYVQAVRSGAFPD-AAHSFGGQG-------------------
PANB_HALHL       FGAEG-----GGVHAALEAYVAAVRAGTFPG-PEHGFEA---------------------
PANB_NITOC       FLEGT-----SNIPNAIQAYVSAVKKNEFPL-LELSY-----------------------
PANB_HYDCU       FLSEA-----DSIQTALYQYVSDVKSGRFPA-SEHCVG----------------------
PANB_METCA       FLAGN-----AGVREAVSAYVREVKAGIFPG-DRHSFGRDGP------------------
PANB_ANADE       FGELG-----AAVEGAVGAYVGEVKARAFPD-DAHSFHSA-SVRLVP-VERHAEEAEEEP
PANB_MYXXD       YANLH-----GSITEAAGAYFAEVRKGAFPD-EEHSFKATKNIRLAPGAPAPAARVEPSA
PANB_MAGMM       YLDGV-----PVIGGAIGAYVQEVRNRQFPT-PDHSFEK---------------------
PANB_CAMJE       FDKID-----PQV--GVEKYRDEVKSGIFPSQEHSFDYLDDE---------LLDKLY---
PANB_CAMJJ       FDKID-----PQV--GVEKYRDEVKSGIFPSQEHSFDYLDDE---------LLDKLY---
PANB_CAMJR       FDKID-----PQV--GVEKYRDEVKSGIFPSEEHSFDYLDDE---------LLDKLY---
PANB_AQUAE       YLEGA-----KLVKEALKNFKIDVEGGNFPSEEESYG-----------------------
PANB_BACAN       YTSVQ-----EEIVRGISQYVAEVKTRQFPEEKHSFTMKEEE---------CLALYGGKQ
PANB_BACAH       YTSVQ-----EEIVRGISQYVAEVKTRQFPEEKHSFTMKEEE---------CLALYGGKQ
PANB_BACCZ       YTSVQ-----EEIVRGISQYVAEVKTRQFPEEKHSFTMKEEE---------CLALYGGKQ
PANB_BACHK       YTSVQ-----EEIVRGISQYVAEVKTRQFPEEKHSFTMKEEE---------CLALYGGKQ
PANB_BACCR       YTSVQ-----EEIVRGISQYVTEVKTRQFPEEKHSFTMKEEE---------CLSLYGGKQ
PANB_BACC1       YTFVQ-----EEIVRGISQYVTEVKTGQFPEEKHSFTMKEEE---------CLALYGGKQ
PANB_GEOKA       YASIQ-----ETIVEALANYVADVKLRQFPEPAHTFTMKEEE---------WVALYGGKQ
PANB_GEOTN       YAAIQ-----ETIVEALANYIADVKLRQFPEPAHTFTMKEEE---------WVALYGGKQ
PANB_BACSU       YTRID-----ETIETAISGYVQDVRHRAFPEQKHSFQMNQTV---------LDGLYGGK-
PANB_BACLD       YAQID-----QPLEQALRGYVEDVRSRVFPEDAHSFRIDQQV---------LEGLYGGK-
PANB_LISIN       YADID-----ETIEPALKNYVNDVKELAFPEVKHSFTMAEED---------LKGLYGRE-
PANB_LISW6       YADID-----ETIEPALTSYVKEVKEQTFPEVKHSFTMAEED---------LKGLYGRE-
PANB_LISMF       YADID-----ERIEPALASYVKEVKAATFPEVKHSFTMAEED---------LKGLYGRE-
PANB_LISMO       YADID-----ETIEPALASYVKEVKAETFPEVKHSFTMAEED---------LKGLYGRE-
PANB_DESHY       YANAD-----QLMLKGLQDYADEVRSMNFPDDEHSFTMKEEE---------LKTLYGGRG
PANB_BACHD       YVNIT-----KPIEEAMKQYVQEVKAGTFPDKDHAFSLKENV---------IQELYGGAL
PANB_BACSK       YTAVS-----PIIEEGLASYVTDVKQRAFPEEAHTYTTNDTG---------WLAVYGGDK
PANB_STAA3       FADFS-----VGV-DGLKQYDQEVKSGAFPSE--EYTYKKKI---------MNEVNNND-
PANB_STAA8       FADFS-----VGV-DGLKQYDQEVKSGAFPSE--EYTYKKKI---------MNEVNNND-
PANB_STAAS       FADFS-----VGV-DGLKQYDQEVKSGAFPSE--EYTYKKKI---------MNEVNNND-
PANB_STAAW       FADFS-----VGV-DGLKQYDQEVKSGAFPSE--EYTYKKKI---------MNEVNNND-
PANB_STAAN       FADFS-----VGV-DGLKQYDQEVKSGAFPSE--EYTYKKKI---------MNEVNNND-
PANB_STAAM       FADFS-----VGV-DGLKQYDQEVKSGAFPSE--EYTYKKKI---------MNEVNNND-
PANB_STAAB       FADFS-----VGV-DGLKQYDQEVKSGAFPSE--EYTYKKKI---------MNEVNNND-
PANB_STAAC       FADFS-----VGV-DGLKQYDQEVKSGAFPSE--EYTYKKKI---------MNEVNNND-
PANB_STAAR       FADFS-----VGV-DGLKQYDQEVKSGAFPSE--EYTYKKKI---------MNEVNNND-
PANB_STAES       FADFS-----SGI-DGLRQYNEEVKAGTFPSE--NHTYKKRI---------MDEVEQHD-
PANB_STAEQ       FADFS-----SGI-DGLRQYNEEVKAGTFPSE--NHTYKKRI---------MDEVEQHD-
PANB_STAHJ       FGDFS-----VGI-DAIKHYDEEVKAGTFPAE--AHTYKKKI---------LNEVNSND-
PANB_STAS1       FGDFS-----VGI-DALKQYNNEVKAEQFPGE--AHTYKKQI---------MNEVTE---
PANB_OCEIH       YGDFS-----IGV-ESIKNFHDEVKRQAFPTE--EYTYKKQI---------MNEVDE---
PANB_BRUA2       FAHLA-----PQVSQAAEAYAEEVRARRFPG-PEHVFGAKPG---------A--------
PANB_BRUAB       FAHLA-----PQVSQAAEAYAEEVRARRFPG-PEHVFGAKPG---------A--------
PANB_BRUME       FAHLA-----PQVSQAAEAYAEEVRARRFPG-PEHVFGAKPG---------A--------
PANB_BRUSU       FAHLA-----PQVSQAAEAYAEEVRARRFPG-PEHVFGAKPG---------A--------
PANB_AGRFC       YADLG-----TAATQAAAAYADEVRSGAFPG-PEHTFQVRKP---------SPSGK----
PANB_RHIEC       YDELG-----KRVADAVAAYAEDVRSRKFPA-ADHTFKRRP-------------------
PANB_RHIL3       YDELG-----KRISAAAAAYADEVRSRQFPA-AEHTFKRRS-------------------
PANB_RHIME       FAELA-----PTISKAAEAYANEVKARSFPG-IEHTFQVKR-------------------
PANB_BORBR       YAQLG-----PIIEQAAAAYASEVRARTFPA-PEHCTGMPAP---------DGRPA----
PANB_BORPA       YAQLG-----PIIEQAAAAYASEVRARTFPA-PEHCTGMPAP---------DGRPA----
PANB_BORPE       YAQLG-----PIIEQAAAAYASEVRARTFPA-PEHCTGMPAP---------DGRPA----
PANB_MAGSA       YADLR-----PIITKAAEDYAAEVKARTFPG-PEHCFGVAKK------------------
PANB_RHORT       YADLA-----STVSAAAEAYAADVRARRFPA-PEHCFGIRKV---------G--------
PANB_GRABC       YAELA-----LTVAEAAACYAEDVRTRRFPA-MEHCYTLSR-------------------
PANB1_PSEAE      YARLD-----REIDEAARRFAEDVRERRFPE-ARHCFAMRE-------------------
PANB1_PSEAB      YARLD-----REIDEAARRFAEDVRERRFPE-ARHCFAMRE-------------------
PANB2_BURCH      YADAN-----AVMRDAIRQYAHDVRQRVFPE-PAHCFGYGKP---------LQLADAATA
PANB2_BURCM      YADAN-----AVMRDAIRQYAHDVRHRVFPE-PAHCFGYGKP---------LQLADAGAT
PANB1_BURL3      YADAN-----AVMRDAIRQYAHDVRQGVFPE-PAHCFGYGKP---------LQLVGAADA
PANB1_PSEE4      YADLT-----AVIGEACARYASEVRQGEFPE-LAHCYGS---------------------
PANB1_PSEF5      YADAG-----ALISQACERFAAEVREQAFPQ-LQHCYGVVQE---------A--------
PANB1_HAHCH      YVDLS-----QPIKEAFSRYAHEVRSGEFPA-MEHCFGVRKN---------SDGG-----
PANB_BARHE       YGVLE-----QEMEKAIKSYADDVKSRTFPS-DEEIYKLKQK---------SG-------
PANB_BARQU       YGALE-----QEMEKAIKSYADDVKSRAFPS-EAEIYKLKQK---------SG-------
PANB_BARBK       YGTLE-----QAMDTAIRNYAEDVKSRAFPS-DSEIYKLK--------------------
PANB_RHOP2       YGELG-----PGIEAAIKGYAEEVRSRAFPG-PEHVYGMKAK---------G--------
PANB_RHOPS       YGELG-----PGIEAAIKGFAEEVRSRAFPG-PEHVYGMKTK---------S--------
PANB_RHOPA       YGDLG-----PGIEAAIKGYAEEVRSRAFPG-PEHVYGMKSK---------A--------
PANB_NITHX       YGELG-----PMIEAAIEGYARDVRSRAFPG-PEHVYAMKPK---------AS-------
PANB_NITWN       YGELG-----PMIEAAIEGYARDVRSRAFPG-PEHVYAMKPK---------S--------
PANB_RHOP5       FGDLG-----PGIEAAIKDYASEVRSRAFPG-PEHVYGMKKR------------------
PANB_RHOPB       FGDLG-----PGIEAAIKDYADEVRSRAFPG-PEHVYGMKAK---------S--------
PANB3_BRADU      YGNLG-----PAIEEAIAGYARDVKSRAFPG-PEHVYDMKKS------------------
PANB_HYPNA       YADLR-----EVVDKAAAEYAADVRARRFPG-TAETYSLRKQ---------GS-------
PANB_MARMM       YDNMA-----ERTDAAVAQFASDVRDRSFPS-QREVYTMKRS---------DG-------
PANB_CAUVC       YADLK-----GEIERAAAQYASDVRDRSFPG-PAETYYAKKP------------------
PANB2_ZYMMO      FAHLG-----DDIKKAVSDYATAVSNRSFPA-EDNIYRPKS-------------------
PANB_ERYLH       YGDIA-----ETIEATAKTYAEEVRARSFPG-PEQLYQPK--------------------
PANB_NOVAD       YEDLA-----GTISGAAARYADEVRARTFPG-IEQTYQPK--------------------
PANB_SPHAL       YRDMA-----GVVSGAVQDYADEVRSRSFPT-EDQIYAG---------------------
PANB_RHOS1       YGELG-----ASADEAIATYAAEVRARRFPA-PEHVFADELK---------GKAQ-----
PANB_RHOS4       YGELG-----ASADEAIATYAAEVRARRFPA-PEHVFADELK---------GKAQ-----
PANB_RUEPO       YADLG-----PLAEAAIAEYAAEVRARSFPA-AEHVFGDQAP---------AKGAKA---
PANB_RUEST       YAELG-----PAAEEAIADYASEVRARRFPS-AEHTFADHAP---------QKAPQQD--
PANB_ROSDO       YAELG-----DLGAAAIAAYAADVRARRFPA-PEHVFADAEP---------KANTKR---
PANB_CHESB       YAELA-----EAAEAGIAAYAKDVRQRRFPA-PEHVFSDMPK---------PVKGGEAA-
PANB_PARDP       YAELG-----QDADAAIAAYAAEVRARRFPG-PEHVFGEGKP---------A--------
PANB_RHILO       YADLR-----SVIANAAERYAAEVRDRTFPG-PSHVFSGSKA---------SSDLNGGDE
PANB_ANAMM       FADLE-----HTIKDAVVGYVRAVKCSEFPG-DEHCYSDGPH---------LRVFRAHPH
PANB_PELUB       YSNIE-----KQINDAALKFKKDVIRSKFPT-KKHSY-----------------------
PANB_HELPY       YLKGK-----ELIQNAIKQYADDVKKGNFPN-ELESYH----------------------
PANB_HELPH       YLKGK-----ELVQNAIKQYADDVKKGNFPN-ELESYH----------------------
PANB_HELPJ       YLKGK-----ELIQNAIQQYADDVKKGNFPN-ELESYH----------------------
PANB_HELAH       YLKGK-----ELVQKAIEQYADDVKKGFFPN-ELESYH----------------------
PANB_HELHP       YCDGK-----AILKDAIRAYAKDVKSQAFPQ-AQESY-----------------------
PANB_CAMFF       YLEGA-----TLIKNSLKEYADEVKNSKFPS-SQYEYTK---------------------
PANB_WOLSU       YLEGA-----SLIRQGVREYAKDVREGRFPS-EAESY-----------------------
PANB_SULDN       YLDGA-----SLVKEALKSYADEVKTRAFPQ-DIHTY-----------------------
PANB_BDEBA       YLDGF-----NTIKGALNQYHQEVSTEIFPS-EKESYS----------------------
PANB_COXBU       FLNGF-----ELIKKALDDFDQEVKTSTYPHLETHCY-----------------------
PANB_FRATT       YIDGS-----KLFSDAINTYVKETKANTFPT-KEHCYDYC--------------------
PANB_FRAT1       YIDGS-----KLFSDAINTYVKETKANTFPT-KEHCYDYC--------------------
PANB_FRATH       YIDGS-----KLFSDAINTYVKETKANTFPT-KEHCYDYC--------------------
PANB_FRATO       YIDGS-----KLFSDAINTYVKETKANTFPT-KEHCYDYC--------------------
PANB_FRATW       YIDGS-----KLFSDAINTYVKETKANTFPT-KEHCYDYC--------------------
PANB_FRATN       YIDGS-----KLFSDAINTYVKETKANTFPT-KEHCYDYC--------------------
PANB_LEGPH       YFRAK-----DHFIEALNSYVQQVQQMHFPA-NEHSF-----------------------
PANB_LEGPA       YFRAK-----DHFIEALNSYVQQVQQMHFPA-NEHSF-----------------------
PANB_LEGPL       YFRAK-----DHFIEALNSYVQQVQQMHFPA-NEHSF-----------------------
PANB_LEPIC       FSNLH-----SIVKEAIADYDKEVKSGEFPG-KDHSF-----------------------
PANB_LEPIN       FSNLH-----SIVKEAIADYDKEVKSGEFPG-KDHSF-----------------------
PANB_LEPBJ       FSNLH-----SIVKDAIESYHEEVRSGEFPG-KDHSF-----------------------
PANB_LEPBL       FSNLH-----SIVKDAIESYHEEVRSGEFPG-KDHSF-----------------------
PANB_HYPBU       YVDLA-----AIIRRAVSEYASDVRNGRFPG-EGMYWGMKRG---------EYEKLQRLI
PANB_STAMF       YADLR-----RIVIDSVKKYAEEVRNGVFPE-RKHYFFSKRR---------EAEK-----
PANB_AERPE       YVDAR-----RIMVEAVTRYAEDVRNGRFPG-EEHVVHAKEP---------LEDIS----
PANB_SULAC       YVNLK-----EEIQKAVNKYVEEVRESKFPQ-GENYKERES-------------------
PANB_SULTO       YIDLR-----GLIRRAIEDYISEVKEGKFPG-KEHYKSRDS-------------------
PANB_SACS2       YVNLK-----EIISSAINQYIIDVKTNKFPE-KQHYKERES-------------------
PANB_PYRFU       YANLR-----EEILRAISEFRKEVKEGKFPG-KEHYWEYQDK---------ETFNRIKEN
PANB_PYRHO       YANLK-----EEILRAISTFREEVKEGKFPG-REHYWEFQDK---------EEFKRIKDN
PANB_PYRAB       YANLR-----DEILGAISEFKKDVKEGKFPG-REHYWEFQDK---------EEFKRIKES
PANB_THEKO       YADLA-----SIIQLALENYRGEVKEGRFPA-KEHYWEFLDK---------DDFERKKMK
PANB_PYRAE       YANVA-----DVIRSAVKQYVNEVKTGQFPS-KEHFKE----------------------
PANB_PYRAR       YANVA-----EQILSAVRQYVQEVRTKAFPA-KEHYRDV---------------------
PANB_PYRIL       YADVA-----AAIREAVSKYAEEVRKGLFPA-REHYRE----------------------
PANB_PYRCJ       YADVA-----SIIREAVAKYVAEVREGKFPT-PEHYRP----------------------
PANB_THEMA       YANLY-----EVILKALQEFRREVKKGLFPT-EEHSFTDKSK---------GGVSS----
PANB_DEIRA       YADLG-----REAREAIAHYAAEVRAREFPS-KDNSFVMKDE---------VLDKLY---
PANB_DEIGD       YAELG-----KEAREAIAAYAREVRAREFPT-KDQSFVMKDD---------VLGKLY---
PANB_THET2       YLEAG-----RLIQEALSRYAQEVREGVFPG-EEHSF-----------------------
PANB_THET8       YLEAG-----RLIQEALSRYAQEVREGVFPG-EEHSF-----------------------
PANB1_METPP      YANLT-----EVAVQGLKAYVDEVKTGRFPD-DDHSYGVDDR---------EYEQFMNLV
PANB_ENTFA       YANLS-----EEMNKAFTKYIEEVKDGVFPG-PEHGFKISDD---------VLEKLY---
PANB_CLONN       FADVG-----ELMKDGFKAYIKEVQEGTFPS-KEHCFKIDES---------VLDKLY---
PANB_CLOAB       YGNIG-----DDMKEAFNSYAKEVREGTFPD-EAHSFKIDQS---------IIDEITK--
PANB_CLOD6       YANIG-----DIMKDSIKNYILEVNTGAFPQ-EKHSFSINES---------ELEKLY---
PANB_HUNT2       YAEIG-----ETVSTAVKSYIDEVKNGVFPT-EKNSFKVDDW---------IIDELDKVR
PANB_DEHM1       YADLN-----GIISKAVSGYVTEVAKGEFPT-LKESFTLDKK---------VLEELKKCV
PANB_DEHMC       YADLN-----GSITKAVSEYAAEVTKGAFPT-LKESFTLDKK---------VLEELKKCV
PANB_CARHZ       YADLS-----SLIKEAIRQYVQEVKEQQFPE-EKHSFTMAPE---------ILERIY---
PANB_SYNWW       FANLE-----PLIMEALKNYKAEVEAGTFPA-EEHCFTIKEE---------VLDRLY---
PANB_SYNAS       YANLS-----DNIRGAVKQYIEEVKNGTFPD-QDHSFL----------------------
PANB_DESPS       YAQLA-----PLVRQGVENYIGEVRAGAFPE-AEHTFTSSCD---------YKVLLSGDD
PANB_MOOTA       YANLA-----EATVAALEKYRDEVRQGKFPD-QEHSFK----------------------
PANB_DESVH       YADLA-----GMAGEAVARYAHEVREGSFPA-AEHTFGIDDGQFEAFMAALDKRGCRQTP
PANB_DESVV       YADLA-----GMAGEAVARYAHEVREGSFPA-AEHTFGIDDGQFEAFMAALDKRGCRQTP
PANB_DESAG       YAELR-----GHAVKAVQQYGDEVRQGEFPA-AQHSFGMPED---------EQRRWEENV
PANB_SYNFM       YAQLG-----LTIKEALTKYREEVENGTFPG-PEHEFGMAEL---------EAKKLSGLE
PANB_CENSY       YADLS-----GEVAGAVAGFKAEVESSQFPR-PENSFYMDAG---------EADGLDR--
PANB_MYCTU       YADVG-----GELRRAAMQYAQEVAGGVFPA-DEHSF-----------------------
PANB_MYCBO       YADVG-----GELRRAAMQYAQEVAGGVFPA-DEHSF-----------------------
PANB_MYCBP       YADVG-----GELRRAAMQYAQEVAGGVFPA-DEHSF-----------------------
PANB_MYCUA       YADVG-----GELRRAAVQYAQDVAGGVFPA-EEHCF-----------------------
PANB_MYCPA       FADIG-----GELRRAATQYAHEVAAGVFPA-DEHCF-----------------------
PANB_MYCA1       FADIG-----GELRRAATQYAHEVAAGVFPA-DEHCF-----------------------
PANB_MYCLE       YADIA-----GELRRAAMQYAEEVASAVFPA-EEHCF-----------------------
PANB_MYCSJ       FGDVG-----AELRRAASQYADEVAAGVFPA-EEHSF-----------------------
PANB_MYCSK       FGDVG-----AELRRAASQYADEVAAGVFPA-EEHSF-----------------------
PANB_MYCSS       FGDVG-----AELRRAASQYADEVAAGVFPA-EEHSF-----------------------
PANB_MYCVP       FGAVG-----DELRRAASDYAREVATGAFPA-DEHSY-----------------------
PANB_NOCFA       FGDIG-----DQLRAAAAAYAAEVREGTFPG-PEHSF-----------------------
PANB_RHOJR       FGNVG-----DELRSAAAAYATEVRAGTFPA-EEHSF-----------------------
PANB_LEIXX       YADLK-----DVLTEAARMYRDEVGSGVFPG-PEHSF-----------------------
PANB_SACEN       YADLG-----GTLARAAQEFADEVRGGAFPA-PEHSFE----------------------
PANB_PAEAT       YADLR-----TTLSDAAAAYGEDVRSGQFPG-PEHSF-----------------------
PANB_ARTS2       YADLR-----TSLSNAAKAYGDDVRTGQFPG-PEHSF-----------------------
PANB_NOCSJ       YADLH-----GVLLQAARDYAADVKAGTFPG-PEHTF-----------------------
PANB_FRAAA       YADLR-----TVLGDAVRTYRDEVRGGQYPT-VEHSY-----------------------
PANB_FRACC       YADLR-----TILADAARAYRADVRDGRYPT-IEHSY-----------------------
PANB_ACIC1       YADLR-----TVLHDAARAFAADVADGRYPD-AAHSY-----------------------
PANB_STRAW       YADLR-----EVMGNAAKAFAEDVVGGTFPL-EEHSVH----------------------
PANB_STRCO       YADLR-----KVMGDAAKAYAEDVVGGTFPA-DEHSVH----------------------
PANB_THEFY       YANLA-----EQLRDAATSFAEEVVAGTFPD-EQHSYA----------------------
PANB_CORGL       YATLG-----DSLHDAAQAYIADIHAGTFPG-EAESF-----------------------
PANB_CORGB       YATLG-----DSLHDAAQAYIADIHAGTFPG-EAESF-----------------------
PANB_COREF       YATLG-----DQLLEAARAYADEVGSGAFPG-EVESY-----------------------
PANB_CORDI       YAEVG-----SQLTCAARFYRKDVEARRFPA-EEHTF-----------------------
PANB_CORJK       WASVG-----SDLTAAAAAYKREVAEGGFPT-QEHCF-----------------------
PANB_TROW8       YASID-----NTVASCVKLWRKDVLEGNFPQ-KDHIPA----------------------
PANB_TROWT       YASID-----NTVASCVKLWRKDVLEGNFPQ-KDHIPA----------------------
PANB_BACFR       YADLY-----TVMTDAISHYVSDVKNCDFPN-EKEQY-----------------------
PANB_BACFN       YADLY-----TVMTDAISHYVSDVKNCDFPN-EKEQY-----------------------
PANB_BACTN       YADLY-----TVMTDAISRYVSDVKNCDFPN-EKEQY-----------------------
PANB_PORGI       YANLA-----NEIDRALKHYIADVKSMDFPN-KDEQY-----------------------
PANB_CYTH3       YANLQ-----ATISTAVTSYIDDVKSKNFPN-ENECY-----------------------
PANB_GRAFK       YADLH-----GEMTKAFQNYRDDVKSRKFPS-DDEQY-----------------------
PANB_SALRD       YARLD-----ETIIDAIGAYVSDVRDRSFPD-EDESY-----------------------
PANB_CHLCH       YVDLN-----SMIEQVARQYVTDVRGCDFPS-SNESY-----------------------
PANB_CHLPD       YANLN-----NVIDRAVQQYVDDVKQGGFPA-DDESY-----------------------
PANB_PELLD       YADLN-----TVIEQAVRQYVEDVRSGGFPS-VDESY-----------------------
PANB_CHLTE       YADLS-----SVIEQAVKSYVEDVRSNSFPS-EDESY-----------------------
PANB_RHOBA       FADVG-----NTIREAAKSYCDEVKAASFPS-DAESFE----------------------
PANB_GEOSL       YGDAR-----TLISDAVASYISEVKKGEFPT-EGHSFS----------------------
PANB_GEOMG       YGDAN-----ALITSAVSSYIAEVKKGEFPD-EGHSFS----------------------
PANB_PELCD       YADVA-----SIIRQGVKEYIGDVKQGVFPG-PEHSFS----------------------
PANB_PELPD       YAELA-----PVITDAVNRYVEEVRSGAFPT-EEHSFN----------------------
PANB_KORVE       YADAA-----ELITGAVKAFRDDVKTGSYPS-DDESYHLPKEAQATLEMVQNRKHAMRK-
PANB2_BRADU      YTNGFQLFQE-----ALSRWAADIRKGAFPGSE----ECYRLPDQLRHAVANWVPSSSTS
PANB1_BRADU      FSSSMMRFRAGQRMSAVARSPARKSPIGFPKALGRQLPTGRHPPQIITSVAELRRTLAKS
PANB_NOSS1       YTNLR-----ETITKAVQDYAAEVRDRQFPE-----------------------------
PANB_TRIV2       YTNLR-----ATITKAVQDYAAEVRDRQFPE-----------------------------
PANB_SYNP6       YLNLR-----QAIGSAVQRYAREVRDRQFLQSQPAEQEPLS-------------------
PANB_SYNE7       YLNLR-----QAIGSAVQRYAREVRDRQFLQSQPAEQEPLS-------------------
PANB_SYNY3       YLNLR-----HTITETVHKFSGEVRQRQFPRRG---------------------------
PANB_TRIEI       YVNLR-----ETITQAVKEYSLEVKKRKFPQPPSP-------------------------
PANB_THEEB       YADLG-----TQAIAAIENYCQAVKSRQFP------------------------------
PANB_SYNJA       YANLR-----EVIREAVEAFVGDVHQRLFPPT----------------------------
PANB_SYNJB       YTNLR-----QAIREAVEAFADDVRQKVFPPR----------------------------
PANB_GLOVI       YADLR-----ALISKAVGRYSADVRAHGSREE----------------------------
PANB_PROM0       IIQGK-----KLFKDKLKEWVDSERLS---------------------------------
PANB_PROMS       IIQGK-----KLFKDKLKEWVDSERLN---------------------------------
PANB_PROM9       IIQGK-----HLFKDKLKEWVDSERLN---------------------------------
PANB_PROM5       IVDGK-----KYFGEKLKEWVTSERLS---------------------------------
PANB_PROMP       IIDGK-----KIFGEKLKEWVAAEKLN---------------------------------
PANB_PROM1       LLAGR-----ELCINALKEWINSTDLDQVNPTTKTSESKSDC------------------
PANB_PROMT       LLAGR-----ELCINALKEWINSTDLDQVNPTTKTSESKSDC------------------
PANB_PROM3       LIQGR-----QLCVEALQGWVKQLHQQAETATTTTSQPEPDC------------------
PANB_PROMM       LIQGR-----QLCVEALQGWVKQLHQQAKTATTTTSPPEPDC------------------
PANB_PROMA       LIDGR-----SLFIESLTSWVDQLRN----------------------------------
PANB_SYNPX       LIPGQ-----QLFVEALRTWIAAQ---TPTTTPPPATPDY--------------------
PANB_SYNS9       QLNGR-----QLCIEALRGWIQEHQSSSPTTAPPQAEPDC--------------------
PANB_SYNSC       LVDGR-----RLFIDALKGWVNQTRNHTPPTNGRITQADRT-------------------
PANB_SYNS3       RMQGR-----ELSINALKSWLKEQRDQRATPTTPPPPPAPDC------------------
PANB_HALSA       FGDVN-----REMAAAVDDYVDAVESGSFPAAEHSHVADDVDDVY---------------
PANB_HALMA       FGDVR-----GEVADAVDEYIDAVESGEFPRESHSHTEDELDDLY---------------
PANB_NATPD       FGDVR-----GEMREAIEAYTDAVDSGSFPGDEHSHYEDDIEDIY---------------
                                                                             

PANB_ECOK1       ----------------------
PANB_ECOUT       ----------------------
PANB_ECOL6       ----------------------
PANB_ECOL5       ----------------------
PANB_SHIBS       ----------------------
PANB_SHISS       ----------------------
PANB_SHIFL       ----------------------
PANB_SHIF8       ----------------------
PANB_ECOLI       ----------------------
PANB_ECO57       ----------------------
PANB_SHIDS       ----------------------
PANB_SALTY       ----------------------
PANB_SALPA       ----------------------
PANB_SALCH       ----------------------
PANB_SALTI       ----------------------
PANB_YERPA       ----------------------
PANB_YERPN       ----------------------
PANB_YERPP       ----------------------
PANB_YERPE       ----------------------
PANB_YERPS       ----------------------
PANB_YERE8       ----------------------
PANB_PECAS       ----------------------
PANB_SODGM       ----------------------
PANB_BAUCH       ----------------------
PANB_PHOLL       ----------------------
PANB_PHOPR       ----------------------
PANB1_ALIF1      ----------------------
PANB_VIBVU       ----------------------
PANB_VIBVY       ----------------------
PANB_VIBPA       ----------------------
PANB_VIBCH       ----------------------
PANB2_ALIF1      ----------------------
PANB_SHEON       ----------------------
PANB_SHESA       ----------------------
PANB_SHESM       ----------------------
PANB_SHESR       ----------------------
PANB_SHESW       ----------------------
PANB_SHELP       ----------------------
PANB_SHEAM       ----------------------
PANB_SHEFN       ----------------------
PANB_SHEDO       ----------------------
PANB_COLP3       ----------------------
PANB_AERHH       ----------------------
PANB_AERS4       ----------------------
PANB_PSEA6       ----------------------
PANB_PSYIN       ----------------------
PANB_PSET1       ----------------------
PANB_IDILO       ----------------------
PANB_BUCAI       ----------------------
PANB_BUCAP       ----------------------
PANB_WIGBR       ----------------------
PANB2_PSEAE      ----------------------
PANB2_PSEAB      ----------------------
PANB_PSEPK       ----------------------
PANB2_PSEE4      ----------------------
PANB_PSE14       ----------------------
PANB_PSEU2       ----------------------
PANB_PSESM       ----------------------
PANB2_PSEF5      ----------------------
PANB_PSEPF       ----------------------
PANB_PSEU5       ----------------------
PANB_MARHV       ----------------------
PANB2_HAHCH      ----------------------
PANB_ALCBS       ----------------------
PANB_PSYA2       ----------------------
PANB_PSYCK       ----------------------
PANB_ACIAD       ----------------------
PANB_CHRSD       ----------------------
PANB_SACD2       ----------------------
PANB_NEIMB       ----------------------
PANB_NEIMF       ----------------------
PANB_NEIMA       ----------------------
PANB_NEIG1       ----------------------
PANB_CHRVO       ----------------------
PANB_BURMA       ----------------------
PANB_BURPS       ----------------------
PANB_BURP0       ----------------------
PANB_BURP1       ----------------------
PANB_BURTA       ----------------------
PANB_BURCA       ----------------------
PANB1_BURCH      ----------------------
PANB1_BURCM      ----------------------
PANB2_BURL3      ----------------------
PANB_PARXL       ----------------------
PANB_CUPNH       ----------------------
PANB_CUPPJ       ----------------------
PANB_CUPMC       ----------------------
PANB_RALSO       ----------------------
PANB_NITEU       ----------------------
PANB_NITEC       ----------------------
PANB_NITMU       ----------------------
PANB_DECAR       ----------------------
PANB_METFK       ----------------------
PANB_AZOSB       ----------------------
PANB_AROAE       ----------------------
PANB_THIDA       ----------------------
PANB_ACIAC       ----------------------
PANB_ACISJ       ----------------------
PANB_VEREI       ----------------------
PANB_POLNA       ----------------------
PANB_POLSJ       ----------------------
PANB_RHOFT       ----------------------
PANB1_ZYMMO      ----------------------
PANB2_METPP      ----------------------
PANB_XANAC       ----------------------
PANB_XANC5       ----------------------
PANB_XANOM       ----------------------
PANB_XANOR       ----------------------
PANB_XANCP       ----------------------
PANB_XANC8       ----------------------
PANB_XYLFA       ----------------------
PANB_XYLFT       ----------------------
PANB_RUTMC       ----------------------
PANB_VESOH       ----------------------
PANB_ALKEH       ----------------------
PANB_HALHL       ----------------------
PANB_NITOC       ----------------------
PANB_HYDCU       ----------------------
PANB_METCA       ----------------------
PANB_ANADE       PDAIGAPI--------------
PANB_MYXXD       PAEAGEKLGPVYGRPA------
PANB_MAGMM       ----------------------
PANB_CAMJE       ----------------------
PANB_CAMJJ       ----------------------
PANB_CAMJR       ----------------------
PANB_AQUAE       ----------------------
PANB_BACAN       S---------------------
PANB_BACAH       S---------------------
PANB_BACCZ       S---------------------
PANB_BACHK       S---------------------
PANB_BACCR       ----------------------
PANB_BACC1       ----------------------
PANB_GEOKA       G---------------------
PANB_GEOTN       S---------------------
PANB_BACSU       ----------------------
PANB_BACLD       ----------------------
PANB_LISIN       ----------------------
PANB_LISW6       ----------------------
PANB_LISMF       ----------------------
PANB_LISMO       ----------------------
PANB_DESHY       ----------------------
PANB_BACHD       T---------------------
PANB_BACSK       K---------------------
PANB_STAA3       ----------------------
PANB_STAA8       ----------------------
PANB_STAAS       ----------------------
PANB_STAAW       ----------------------
PANB_STAAN       ----------------------
PANB_STAAM       ----------------------
PANB_STAAB       ----------------------
PANB_STAAC       ----------------------
PANB_STAAR       ----------------------
PANB_STAES       ----------------------
PANB_STAEQ       ----------------------
PANB_STAHJ       ----------------------
PANB_STAS1       ----------------------
PANB_OCEIH       ----------------------
PANB_BRUA2       ----------------------
PANB_BRUAB       ----------------------
PANB_BRUME       ----------------------
PANB_BRUSU       ----------------------
PANB_AGRFC       ----------------------
PANB_RHIEC       ----------------------
PANB_RHIL3       ----------------------
PANB_RHIME       ----------------------
PANB_BORBR       ----------------------
PANB_BORPA       ----------------------
PANB_BORPE       ----------------------
PANB_MAGSA       ----------------------
PANB_RHORT       ----------------------
PANB_GRABC       ----------------------
PANB1_PSEAE      ----------------------
PANB1_PSEAB      ----------------------
PANB2_BURCH      A---------------------
PANB2_BURCM      V---------------------
PANB1_BURL3      AA--------------------
PANB1_PSEE4      ----------------------
PANB1_PSEF5      ----------------------
PANB1_HAHCH      ----------------------
PANB_BARHE       ----------------------
PANB_BARQU       ----------------------
PANB_BARBK       ----------------------
PANB_RHOP2       ----------------------
PANB_RHOPS       ----------------------
PANB_RHOPA       ----------------------
PANB_NITHX       ----------------------
PANB_NITWN       ----------------------
PANB_RHOP5       ----------------------
PANB_RHOPB       ----------------------
PANB3_BRADU      ----------------------
PANB_HYPNA       ----------------------
PANB_MARMM       ----------------------
PANB_CAUVC       ----------------------
PANB2_ZYMMO      ----------------------
PANB_ERYLH       ----------------------
PANB_NOVAD       ----------------------
PANB_SPHAL       ----------------------
PANB_RHOS1       ----------------------
PANB_RHOS4       ----------------------
PANB_RUEPO       ----------------------
PANB_RUEST       ----------------------
PANB_ROSDO       ----------------------
PANB_CHESB       ----------------------
PANB_PARDP       ----------------------
PANB_RHILO       S---------------------
PANB_ANAMM       HAQ-------------------
PANB_PELUB       ----------------------
PANB_HELPY       ----------------------
PANB_HELPH       ----------------------
PANB_HELPJ       ----------------------
PANB_HELAH       ----------------------
PANB_HELHP       ----------------------
PANB_CAMFF       ----------------------
PANB_WOLSU       ----------------------
PANB_SULDN       ----------------------
PANB_BDEBA       ----------------------
PANB_COXBU       ----------------------
PANB_FRATT       ----------------------
PANB_FRAT1       ----------------------
PANB_FRATH       ----------------------
PANB_FRATO       ----------------------
PANB_FRATW       ----------------------
PANB_FRATN       ----------------------
PANB_LEGPH       ----------------------
PANB_LEGPA       ----------------------
PANB_LEGPL       ----------------------
PANB_LEPIC       ----------------------
PANB_LEPIN       ----------------------
PANB_LEPBJ       ----------------------
PANB_LEPBL       ----------------------
PANB_HYPBU       NEQAGSGD--------------
PANB_STAMF       ----------------------
PANB_AERPE       ----------------------
PANB_SULAC       ----------------------
PANB_SULTO       ----------------------
PANB_SACS2       ----------------------
PANB_PYRFU       VMRKLRL---------------
PANB_PYRHO       VMKKLNL---------------
PANB_PYRAB       VLRKVD----------------
PANB_THEKO       ALERLEDE--------------
PANB_PYRAE       ----------------------
PANB_PYRAR       ----------------------
PANB_PYRIL       ----------------------
PANB_PYRCJ       ----------------------
PANB_THEMA       ----------------------
PANB_DEIRA       ----------------------
PANB_DEIGD       ----------------------
PANB_THET2       ----------------------
PANB_THET8       ----------------------
PANB1_METPP      EKRRHV----------------
PANB_ENTFA       ----------------------
PANB_CLONN       ----------------------
PANB_CLOAB       ----------------------
PANB_CLOD6       ----------------------
PANB_HUNT2       FDI-------------------
PANB_DEHM1       SSEQ------------------
PANB_DEHMC       L---------------------
PANB_CARHZ       ----------------------
PANB_SYNWW       ----------------------
PANB_SYNAS       ----------------------
PANB_DESPS       Q---------------------
PANB_MOOTA       ----------------------
PANB_DESVH       TGE-------------------
PANB_DESVV       TGE-------------------
PANB_DESAG       SGADD-----------------
PANB_SYNFM       DKK-------------------
PANB_CENSY       ----------------------
PANB_MYCTU       ----------------------
PANB_MYCBO       ----------------------
PANB_MYCBP       ----------------------
PANB_MYCUA       ----------------------
PANB_MYCPA       ----------------------
PANB_MYCA1       ----------------------
PANB_MYCLE       ----------------------
PANB_MYCSJ       ----------------------
PANB_MYCSK       ----------------------
PANB_MYCSS       ----------------------
PANB_MYCVP       ----------------------
PANB_NOCFA       ----------------------
PANB_RHOJR       ----------------------
PANB_LEIXX       ----------------------
PANB_SACEN       ----------------------
PANB_PAEAT       ----------------------
PANB_ARTS2       ----------------------
PANB_NOCSJ       ----------------------
PANB_FRAAA       ----------------------
PANB_FRACC       ----------------------
PANB_ACIC1       ----------------------
PANB_STRAW       ----------------------
PANB_STRCO       ----------------------
PANB_THEFY       ----------------------
PANB_CORGL       ----------------------
PANB_CORGB       ----------------------
PANB_COREF       ----------------------
PANB_CORDI       ----------------------
PANB_CORJK       ----------------------
PANB_TROW8       ----------------------
PANB_TROWT       ----------------------
PANB_BACFR       ----------------------
PANB_BACFN       ----------------------
PANB_BACTN       ----------------------
PANB_PORGI       ----------------------
PANB_CYTH3       ----------------------
PANB_GRAFK       ----------------------
PANB_SALRD       ----------------------
PANB_CHLCH       ----------------------
PANB_CHLPD       ----------------------
PANB_PELLD       ----------------------
PANB_CHLTE       ----------------------
PANB_RHOBA       ----------------------
PANB_GEOSL       ----------------------
PANB_GEOMG       ----------------------
PANB_PELCD       ----------------------
PANB_PELPD       ----------------------
PANB_KORVE       ----------------------
PANB2_BRADU      R---------------------
PANB1_BRADU      RSANQRAGLCRRWAISTMATWR
PANB_NOSS1       ----------------------
PANB_TRIV2       ----------------------
PANB_SYNP6       ----------------------
PANB_SYNE7       ----------------------
PANB_SYNY3       ----------------------
PANB_TRIEI       ----------------------
PANB_THEEB       ----------------------
PANB_SYNJA       ----------------------
PANB_SYNJB       ----------------------
PANB_GLOVI       ----------------------
PANB_PROM0       ----------------------
PANB_PROMS       ----------------------
PANB_PROM9       ----------------------
PANB_PROM5       ----------------------
PANB_PROMP       ----------------------
PANB_PROM1       ----------------------
PANB_PROMT       ----------------------
PANB_PROM3       ----------------------
PANB_PROMM       ----------------------
PANB_PROMA       ----------------------
PANB_SYNPX       ----------------------
PANB_SYNS9       ----------------------
PANB_SYNSC       ----------------------
PANB_SYNS3       ----------------------
PANB_HALSA       ----------------------
PANB_HALMA       ----------------------
PANB_NATPD       ----------------------