CLUSTAL format seed alignment for MF_00159

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

ISPG_CHLCV       -------------------------MVISPSKKQAARRHTHSVKIGNLYVGSEHSIKMQS
ISPG_CHLPN       -------------------------MTLITPAINSSRRKTHTVRIGNLYIGSDHSIKTQS
ISPG_CHLMU       --------------------------MAESYLQNGFRRKTLSVKVGNLFVGSEHSIKIQS
ISPG_CHLTR       --------------------------MATPCIQNAFRRKTLPVRIGDLFVGSEHSIKIQS
ISPG_THEVB       ------------------MQTLPSPVQATPTETAIVRRKTRPVPIGSVVIGGGHPVAVQS
ISPG_SYNY3       ----------------MVTASLPTPVQPE-FDTTIHRRKTRPVPVGAVTVGGGHPVVVQS
ISPG_GLOVI       ----------------------MQTLDPVTPALLPLRRVTRPVQVGALTIGGNAPVVVQS
ISPG_PROMM       ---------------MSATMAEYQSSTSRRYDTQIHRRVTRTVNVGGVLIGSDHPVRVQS
ISPG_PARMW       -----------------------MTALDRRYDTQIHRRITRTVMVGDVAIGSDHPVVVQS
ISPG_PROMA       -------------MTIENTQNINIDTLSRRYSTQIQRRKTRSVMVGNIGIGSDYPVAVQS
ISPG_PROMP       ---------------MSLTQSKEVNSLSRRYSTYIERRITRTVMVGDIAIGSDYPVRVQS
ISPG_LEPIN       -----------------------MNFRYNQTPFGYQRRKTREVKVGDVKVGGNNPIVIQS
ISPG_BACTN       -----------------------------MDLFNYFRRETSEVNIGAVPLGGPNPIRIQS
ISPG_PORGI       ----------------------------MLDLFGYKRRKTSVAQIGDTPLGGDFPIRIQS
ISPG_RHOBA       ----------------------------MLSFMKIRRNPTRPVTIGSITIGDGHPIAVQS
ISPG_HELHP       ----------------------------------MQRVKTKQIFVGNVAVGGDAPISVQS
ISPG_HELPJ       --------------------------------MLENRVKTKQIFIGGVAIGGDAPISTQS
ISPG_WOLSU       ---------------------------------MQERVKTKKIFVGDVAIGGDAPISVQS
ISPG_CAMJE       --------------------------------MEYKRFKTRQIKVGNVLIGGDAPISVQS
ISPG_CORDI       -------------MSTPTGQPIGLGLPDAPLPVLAPRRKTRQLMVGNVGVGSDYPVSVQS
ISPG_MYCPA       -------------------MTTGLGMPQTPAPTLAPRRRTRQLMVRDVGVGSDYPISVQS
ISPG1_STRAW      ------------------MTAISLGMPSVPTKLAE-RRKSRQIQVGTVAVGGDAPVSVQS
ISPG_TROWT       -------------------MSIDLGLPKVREVLSP-RRKTRRIKLGKVFVGGDSPILVQS
ISPG_BIFLO       --------MNTENPIEKPFRKTGDPVDLTSESPLHPRRKSRRIMVGPVPVGGGAPISVQS
ISPG_AQUAE       ---------------------------------MIQKRKTRQIRVGNVKIGGDAPIVVQS
ISPG_BUCAI       ---------------------------MNNKCKIINRRKSDRIYVGKVAIGNNAPISVQS
ISPG_BUCAP       ----------------------------MNKYKNIKRRKSNRIYVGNVPIGDGAPISVQS
ISPG_ECOLI       ----------------------------MHNQAPIQRRKSTRIYVGNVPIGDGAPIAVQS
ISPG_VIBVY       ----------------------------MHNESPIIRRKSTRIYVGDVPIGDGAPIAVQS
ISPG_HAEDU       ----------------------------MLKEVPIKRRQSTKIYVGNVPVGGDAPIAVQS
ISPG_WIGBR       ----------------------------MKINNYIIRRKSKKIYIKNVPIGGDSPISVQS
ISPG_PSESM       ----------------------------MHGESPIKRRESRKIWVGSVPVGGDAPIAVQS
ISPG_CAUVC       ---------------------MAADHTHVRPWRMITRRQSRKIRVGSVEVGGDAPISVQS
ISPG_CLOAB       ----------------------------------MQRIETRKVKVGSVYVGGDSRVTVQS
ISPG_CLOTE       ----------------------------------MDRKETIKIKVGDKFIGGDSPITVQS
ISPG_CLOPE       ----------------------------------MNRKETRKVKVGNIYVGGDFRVSIQS
ISPG_CALS4       --------------------------------MIKMRKLTREIKIGNKKIGGNNPILVQS
ISPG_LISMO       ------------------------------MNERIFRENTRPVQVGNLTIGGSEELTIQS
ISPG_BACCR       ------------------------------MNEMTHRTKTRPVKVGNLTIGGNNELIIQS
ISPG_FUSNN       -----------------------------------MERNTRVVKVANLKIGGNNPIIIQS
ISPG_DESVH       ---------MLGLPGEMQYVPGIHSPNEGPRPMTIQRKQTREVRIGKVRIGGANPVVVQS
ISPG_GEOSL       -----------------------------------MKAKTRQIRVGNVPVGGDAPCSVQS
ISPG_MYCPE       -------------------------------MYKTIREKTKAVYVGNVQIGGNNKVVIQS
ISPG_MYCGA       ---------------------------------MYTRTKTKKVFVGDVQIGGQNKIVLQS
ISPG_TREPA       MDSSAGVSPCNSPYGSGLLDVPLKLRPRASHYRARSLVIGGKEHVRALPLGGDAPIPIQT
ISPG_TREDE       ---------------------------MNSIKLPRTIHIGGKGQVKKLTLGGTSPILLQT
ISPG_THEMA       --------------------------------------MRKSVKVGKVVIGGEAPVSVQS
ISPG_DEIRA       ------------MSFDSLPALPLDPLPDAALPTAPRRRQTVSVNVGGVMVGSAHPIVVQS
ISPG_THETH       --------------------------------MEGMRRPTPTVYVGRVPIGGAHPIAVQS
ISPG_NEIMB       -------------------------------MNTLQRRKTHQVRIDHITVGSEAPVVIQS
ISPG_CHRVO       -----------------------------MDSVNIARRPTRLVRVGHVLVGSDAPVMVQS
ISPG_RALSO       --------------MQMTTPVDCAPALPGPLPRRHSRAAEIRWGERLVRVGGDAPVCVQS
ISPG_BORPE       ---------MRYMQDSSMPCQDASPPDVGAAPRRATRAVRVQWGGRTVTVGGNASVVVQS
ISPG_NITEU       ---------------------------MSSNNVPASRRKCVGVKVGSVMIGGGAPIVVQS
ISPG_RHILO       -------------------------MTGYFSF-PFPRRTSVGVDVGGVAVGGGAPVVVQS
ISPG_RHIME       -------------------------MSSAFDFEPQPRRASVAVDVGGVIVGGGAPVVVQS
ISPG_RHOPA       ---------MSPKPDIRTAMNKLENPLRDDVAGPAPRHQTTQVMVGDVAVGGGAPIVVQS
ISPG_XANCP       ------------------MYDAVTRPSPPADASAWPRRITQAVKVGNVIVGGGHPVVVQS
ISPG_XYLFT       ----------------------MTPQVASDSAVPWPRRLTQAVNIGHLTVGGGHPVVVQS
ISPG_EHRRG       --------------MQCDFVDRILNEYDLLNAIVYRSKFTHEVKVGDVIIGGNNPIVVQS
ISPG_EHRRW       --------------MQCDFVDRILNEYDLLNAIVYRSKFTHEVKVGDVIIGGNNPIVVQS
ISPG_ANAMM       --------------MVGCRAASDAAEFESVVGSSRVARVSCAVRVGRVIIGGGSPVVVQS
ISPG_WOLTR       --------------MLNKDLVDHDLSDEVCELLPASRHKTYVVKVGQVKIGGNNPIVVQS
ISPG_WOLPM       --------------MLDKDLI---LNDNTCELSQISRHKTHVVEVGKVKIGGNNPVVVQS
                                                                  :*.      *:

ISPG_CHLCV       M--TTTPTAD-----VEATVTQICALVEAKCEIARVTVQGIKEAQACEHIKERL----LS
ISPG_CHLPN       M--TTTLTTD-----IDSTVEQIYALAEHNCDIVRVTVQGIKEAQACEKIKERL----IA
ISPG_CHLMU       M--TTTATTD-----VEGTVRQIYALQECGCEIVRVTVQGLKEVGACEQIKDRL----VQ
ISPG_CHLTR       M--TTTATTD-----VDGTVRQICALQEWGCDIVRVTVQGLREVHACEHIKDRL----IQ
ISPG_THEVB       M--INEDTLD-----IEGSVAAIRRLHEIGCEIVRVTVPSLAHAKAMEEIRDRL----YK
ISPG_SYNY3       M--INEDTLD-----VDGSVAGIRRLHEIGCEIVRVTVPSMAHAKALADIKQKL----QA
ISPG_GLOVI       M--INEDTLD-----TPGAVAAIRALHKAGCELVRVTVPSLAHARALERIRKTL----ED
ISPG_PROMM       M--INEDTLD-----VEGATAGIRRLHEAGCEIVRLTVPSLGHAKAVGEICQRL----RE
ISPG_PARMW       M--INEDTLD-----IDAAVAGIVRLAEAGSEIVRVTTPSMAHARAMGEIRAAV----RA
ISPG_PROMA       M--INEDTLD-----IEASTSAIRRLHEIGCEIVRLTVPSLSHAKAVGEIKRRL----EQ
ISPG_PROMP       M--INEDTMD-----VDNSYLAIKRLHEVGCEIVRLTVPSLAHAKAVGDIKEKL----IK
ISPG_LEPIN       M--INSDTTD-----TQGSVKQILELERAGCEIVRLTVPSQADADNLPSIRQEL----KK
ISPG_BACTN       M--TNTSTMD-----TEACVEQAKRIVDAGGEYVRLTTQGVKEAENLMNINIGL----RS
ISPG_PORGI       M--ANVSTMD-----TQASVDQAARIIDAGADYVRFTAQGVREAVNLQHIHAGL----CR
ISPG_RHOBA       M--TATKTQN-----IDATVEQAEALHARGAGVVRIAVDSDKDAEALAEIRKQT----QA
ISPG_HELHP       M--TFSKTCD-----IEATKAQLDRLYFAGADMVRVAVSDPKDADALKDLKKV-------
ISPG_HELPJ       M--TFSKTAD-----IESTKNQIDRFKLAGADLVRVAVSNEKDALALKELKKV-------
ISPG_WOLSU       M--TFSKTAD-----IGATKAQIDRLALAGCDIVRVAVSDHEDANALKELKRL-------
ISPG_CAMJE       M--LFTKTRD-----IEGSLEQINRLYFAGANIVRLACLDMADARALKEIKAK-------
ISPG_CORDI       M--TTTKTHD-----VNATLQQIAQLTASGCDIVRVACPKTVDAEALPAIAKK-------
ISPG_MYCPA       M--CTTKTHD-----VNSTLQQIAELTAAGCDIVRVACPRQEDADALAEIARH-------
ISPG1_STRAW      M--TTTRTSD-----IGATLQQIAELTASGCQIVRVACPTQDDADALAVIARK-------
ISPG_TROWT       M--TTTQTTN-----IDATLQQIAELTAAGCDIVRVAVPSRDDAQVLHIIAKK-------
ISPG_BIFLO       M--TNTLTAN-----VPATLQQIAELTAAGCDIVRVAVPSQDDADALPEICRK-------
ISPG_AQUAE       M--TSTKTHD-----VEATLNQIKRLYEAGCEIVRVAVPHKEDVEALEEIVKK-------
ISPG_BUCAI       M--TNTRTTN-----ISETINQILELQKVGVDIVRISIPNLKAAESFKEIKKQ-------
ISPG_BUCAP       M--TNTQTTN-----IEETIKQIIKLKKVGVDIVRISVPTLEAAESFKIIKLN-------
ISPG_ECOLI       M--TNTRTTD-----VEATVNQIKALERVGADIVRVSVPTMDAAEAFKLIKQQ-------
ISPG_VIBVY       M--TNTRTTD-----VAATVAQIKALENVGADIVRVSVPTMDAAEAFKLIKQQ-------
ISPG_HAEDU       M--TNTRTTD-----IEATIAQIKALERVGADIVRVSVPTMDAAEAFKVIKQQ-------
ISPG_WIGBR       M--TNTCTTD-----INSTISQINKLQKAGADIVRVSIPTLEAAESFKIIKRN-------
ISPG_PSESM       M--TNSDTND-----VAATVAQINRLEAAGVDIVRISVPDMDAAEAFGRIKQL-------
ISPG_CAUVC       M--TNTLTSD-----AAATLEQIRQLEEAGADIVRVSCPDVESTAAFKTIARE-------
ISPG_CLOAB       M--TNTDTRD-----SKKTIEQIKKLEIAGCDIVRCAVPDFDAASSLSEITKN-------
ISPG_CLOTE       M--TNTDTRD-----VEKTVEQIKKLEEVDCDIIRCAVPDDEACQALGKITKK-------
ISPG_CLOPE       M--TNTDTKD-----VESTVKQIKELQEAGCDIVRCAVLDMDAACAIKDIVAK-------
ISPG_CALS4       M--TNTDTHD-----VEKTVEQIKRLEEEGCDIIRVAVPDEKAAYSIKEIKKH-------
ISPG_LISMO       M--TTTKTHD-----VEATVAEIHRLEEAGCQIVRVACPDERAANALSAIKKK-------
ISPG_BACCR       M--TTTKTHD-----VEATVAEIKRLEEAGCQVVRVAVPDERAADAIADIKKQ-------
ISPG_FUSNN       M--TNTNSAD-----VEATVKQINNLEKVGCQLVRMTINNIKAAEAIKEIKKK-------
ISPG_DESVH       M--TNTDTRD-----VEQTVEQIRQLQEAGCEIVRLAVLNEDAAWAIKPIRSQ-------
ISPG_GEOSL       M--CNTDTRD-----AGATLDQINALAAAGCEIVRCAVPDMAAAEALGAIKRQ-------
ISPG_MYCPE       M--TTTKTHD-----VEKTVAQVKELVREGCELVRIAVLDDEDAAAFGEVVKN-------
ISPG_MYCGA       M--TIAKTKH-----VKKSLKEINDLVKEGADLVRIAVFDDADKRAIRKVVDQ-------
ISPG_TREPA       MWKEPLIGAD-----LQSIVDRLLELEQLGCDVVRFAVPDRESAELFVALCAR-------
ISPG_TREDE       MWKESLLGAD-----LLSIVKSLNELEQLGCDIVRFAVPDMDSAEQFVKLTRL-------
ISPG_THEMA       M--TTTKTAD-----VEKTVSQIKSLERAGCEIVRVAVQDEEDAKAIRRIKEQ-------
ISPG_DEIRA       MTNTDTAN-------AEATAIQVAQLARAGSEIVRVTVNTREAAAAVPELVQRLADIGVH
ISPG_THETH       MTNTPTRD-------VEATTAQVLELHRAGSEIVRLTVNDEEAAKAVPEIKRRLLAEGVE
ISPG_NEIMB       MTNTDTAD-------AKATALQIKELSDAGSEMVRITVNSPEAASKVAEIRRRLDDMGYA
ISPG_CHRVO       MTNTDTAD-------AAGTAEQVYQLAQAGSEVVRITVNSPEAAARVAEIRQRLDDLGCD
ISPG_RALSO       MTNTDTAD-------AIGTAIQVKELARTGSELVRITVNTPEAAAAVPAIREQLDRMGID
ISPG_BORPE       MTNTDTAD-------AVATAIQVKELAQAGSEIVRITVNTPEAAREVATIREQLDRMGVE
ISPG_NITEU       MTNTDTAD-------EVSTTQQVAQLALAGSELVRITVNSMEAARAVAGIRARLDDMGCH
ISPG_RHILO       MTNTDTAD-------IDQTVAQVAALHRAGSEIVRITVDRDESAAAVPRIHERLQRLGIN
ISPG_RHIME       MTNTDTAD-------IDATVAQVAALHKAGSELVRITVDRDESAAAVPKIRERLLRLGID
ISPG_RHOPA       MTNTDTAD-------VEGTIKQIAALARAGSEMVRITVDREEAAAAVPHIRDGIRKLGLT
ISPG_XANCP       MTNTDTAD-------IAGSVKQVAELWRAGSEMVRLTVNNAESAAAIPRIVEKLRMMGIE
ISPG_XYLFT       MTNTDTAD-------VVASTKQVAELWRAGSEMVRLTVNNAQSAAAIPRIAERLAMMGIE
ISPG_EHRRG       MALGGSGD-------VYQDAREVLELAQAGSELVRIAINSDKAIKSVPYIRDVLINHGFN
ISPG_EHRRW       MALGGSGD-------VYQDAREVLELAQAGSELVRIAINSDKAIKSVPYIRDVLINHGFN
ISPG_ANAMM       MALGGSGS-------LSSDLEEILCLAKEGSELIRVAINSEESIKSIPRIVEHLVSHGFD
ISPG_WOLTR       MALGVHIDSDNVKSSAKRYAKEIIELAHAGSELVRIALNSEEVARAVPYIVEEINKEGFD
ISPG_WOLPM       MALGVHIDADNIKSSAKHYAKEITELARTGSELVRIALNSEEVARAIPYIVEEINKEGFD
                 *                        :        * :            :          

ISPG_CHLCV       MGIAIPLVADIHFFP-QAAMHVADFVDKVRINPGNFVDKRNMFTG-KTYTDKNYADSLLR
ISPG_CHLPN       LGLNIPLVADIHFFP-QAAMLVADFADKVRINPGNYIDKRNMFKGTKIYTEASYAQSLLR
ISPG_CHLMU       QNVTIPLVADIHFFP-QAAIHVADFVDKVRINPGNYVDKRNMFSG-KIYSDEQYTRSLER
ISPG_CHLTR       QNISIPLVADIHFFP-QAAIHVVDCVDKVRINPGNYVDKRNMFTG-KIYSDEQYAHSLEH
ISPG_THEVB       TYKPVPLVADVHHNGMKIALEVAKYVDNVRINPGLYVFEKPKPNR-TEYTQAEFDEIGAK
ISPG_SYNY3       TYQAVPLVADVHHNGMKIALEVAKHVDKVRINPGLYVFEKPDAQR-EGYSDQEFAEIGEK
ISPG_GLOVI       TYRPVPLVADVHHDGGPIALEVARHVDKVRINPGLFVFRR--ARL-GDYTAEDVERARAQ
ISPG_PROMM       TYQPVPLVADVHHNGMKIALEVANHVDKVRINPGLFVFDKADPDR-TEFSGEEIASIRER
ISPG_PARMW       RGCTVPLVADVHHNGVKIAMEVAQHVDKVRINPGLFVFDKPDPNR-QEFSDKEFAAIGAR
ISPG_PROMA       NYLPVPLVADVHHNGMKIALEVAKHVDKVRINPGLFVFSNPDPSR-TEFSNSEISAIKEK
ISPG_PROMP       NNIDTPLVADVHHNGMKIAMEVAKHVDKVRINPGLFVFEKSDPTR-TEYTDTEFETIKKT
ISPG_LEPIN       AGSKVPLVADIHFTP-SVAMKAVEYVEKVRINPGNFADKK-KFAV-RDYTDLEYNQELER
ISPG_BACTN       QGYMVPLVADVHFNP-KVADVAAQYAEKVRINPGNYVDAARTFKK-LEYTDEEYAQEIQK
ISPG_PORGI       LGYHIPLVADIHFSP-KAAEEALLHVEKVRINPGNFVEMKSGGN---LTEEEAFDLGHKA
ISPG_RHOBA       N------LAVDLQENFRLAEKVAPHVDKIRYNPGHLYHHARELTW---------------
ISPG_HELHP       --SPLPLIADIHFRYKFALIAAES-VDCIRINPG----------------------NIGS
ISPG_HELPJ       --SPLPLIADIHFHYKFALIAAQS-VDAIRINPG----------------------NIGS
ISPG_WOLSU       --SPLPLVADIHFRYKLALIAAQS-VDCIRINPG----------------------NIGS
ISPG_CAMJE       --SPLPLIVDIHFNHNLAVYCAEF-IDGVRINPG----------------------NIGS
ISPG_CORDI       --SPIPVIADIHFQPKYIFSAIDAGCAAVRVNPG----------------------NIKE
ISPG_MYCPA       --SQIPVIADIHFQPKYIFAAIDAGCAAVRVNPG----------------------NIKE
ISPG1_STRAW      --SQIPVIADIHFQPKYVFAAIEAGCAAVRVNPG----------------------NIKQ
ISPG_TROWT       --SQIPVIADIHFQPNYVYAAIDAGCAAVRVNPG----------------------NIRK
ISPG_BIFLO       --SPIPVIADIHFQSKYVFQAIDAGCAAVRVNPG----------------------NIRK
ISPG_AQUAE       --SPMPVIADIHFAPSYAFLSMEKGVHGIRINPG----------------------NIGK
ISPG_BUCAI       --TNVPLIADIHFDYRLALQAIKYGADCLRINPG----------------------NIGN
ISPG_BUCAP       --VDVPLIADIHFDYRLAIKSIKYGADCLRINPG----------------------NIGN
ISPG_ECOLI       --VNVPLVADIHFDYRIALKVAEYGVDCLRINPG----------------------NIGN
ISPG_VIBVY       --VSIPLVADIHFDYRIALKVAEYGVDCLRINPG----------------------NIGN
ISPG_HAEDU       --VNVPLVADIHFDYRIALKVAEYGVDCLRINPG----------------------NIGN
ISPG_WIGBR       --VSIPIVADIHFDYRIALKAAEYGADCLRINPG----------------------NIGK
ISPG_PSESM       --VKVPLVADIHFDYRIALRVAELGVDCLRINPG----------------------NIGR
ISPG_CAUVC       --AKVPLVADIHFHYKRGIEAAQAGAACLRINPG----------------------NIGS
ISPG_CLOAB       --VKLPVVADIHFDYRLALEAIKNGVSALRINPG----------------------NIGS
ISPG_CLOTE       --IAIPLVADIHFDYRLAIKAIDNGISALRINPG----------------------NIGN
ISPG_CLOPE       --INIPLVADIHFDYRLALKAIENGVSAIRINPG----------------------NIGS
ISPG_CALS4       --INIPLVADIHFDYRLAIKSIENGADKIRINPG----------------------NIGR
ISPG_LISMO       --IHIPLVADIHFDYRLALKAIDAGVDKIRINPG----------------------NIGR
ISPG_BACCR       --INIPLVADIHFDYRLALKAIEGGIDKVRINPG----------------------NIGR
ISPG_FUSNN       --VSLPLVADIHFDYRLALLAIKNGIDKLRINPG----------------------NIGS
ISPG_DESVH       --VSVPLVADIHFDHRLAVSALEAGVDALRINPG----------------------NIGT
ISPG_GEOSL       --SPIPVIADIHFDYKLALKVLEGGIDGLRLNPG----------------------NIGE
ISPG_MYCPE       --SPCPIIADIHFNPLYAIKAIESGAAKVRLNPG----------------------NIKD
ISPG_MYCGA       --SPCPIIADIHFNPDYAIAAIKAGCKKIRLNPG----------------------NIKS
ISPG_TREPA       --TRMPLVADIHFDYRLALRCMDGPVAKVRINPG----------------------NIGV
ISPG_TREDE       --TEMPLVADIHFDYKLALRCMDGDTAKIRINPG----------------------NIGS
ISPG_THEMA       --IEIPLVADIQFDYRLAILSIENGADKIRINPG----------------------NMS-
ISPG_DEIRA       VPI-VGDFHYNGHLLLREYPETARLLAKYRINPGN-------------------VGAGQR
ISPG_THETH       VPL-VGDFHFNGHLLLRKYPKMAEALDKFRINPGT-------------------LGRGRH
ISPG_NEIMB       TPL-IGDFHFNGERLLAEFPECGKALSKYRINPGN-------------------VGKGVK
ISPG_CHRVO       VPL-VGDFHFNGDRLLKEFPDCARALAKYRINPGN-------------------VGKGAK
ISPG_RALSO       VPL-VGDFHYNGHKLLQDHPACAEALSKYRINPGN-------------------VGQGAK
ISPG_BORPE       VPL-VGDFHYNGHKLLTQFPECAQALSKYRINPGN-------------------MGGGKQ
ISPG_NITEU       VPL-VGDFHFNGHKLLTAYPECARALAKYRINPGN-------------------VGHGRK
ISPG_RHILO       VPL-VGDFHYIGHKLLADHPACAEALAKYRINPGN-------------------VGFKDK
ISPG_RHIME       VPL-VGDFHYIGHKLLADHPACAEALAKYRINPGN-------------------VGFKDK
ISPG_RHOPA       TPI-IGDFHYIGHKLLAEYPACAEALDKYRINPGN-------------------VGFKNK
ISPG_XANCP       VPL-IGDFHYNGHQLLTAEPACAEALAKYRINPGN-------------------VGFGKK
ISPG_XYLFT       VPL-IGDFHYNGHQLLADEPACAEVLAKYRINPGN-------------------VGFGKK
ISPG_EHRRG       SKMIIGCGQYEIARLVKQYPECALALGKIRINPGN-------------------IGFGDK
ISPG_EHRRW       SKMIIGCGQYEIARLVKQYPECALALGKIRINPGN-------------------IGFGDK
ISPG_ANAMM       EKMVVGCGQYEVADLLNKYPDDAAFLGKIRINPGN-------------------VGFGDK
ISPG_WOLTR       GKILVGCGQYELDKLVRNYPDNIKMLGKIRINPGN-------------------IGFGDK
ISPG_WOLPM       GKILVGCGQYELDKLVQDYPDNIKMLGKIRINPGN-------------------IGFGDK
                                              * ***                          

ISPG_CHLCV       LEEKFTPLVEKCKRLGKAMRIGVNHGSLSERVM--QRYGD-------------------T
ISPG_CHLPN       LEEKFAPLVEKCKRLGKAMRIGVNHGSLSERIM--QKYGD-------------------T
ISPG_CHLMU       LFEKFSPLVAKCKRLGRAMRIGVNHGSLSERIM--QRYGD-------------------T
ISPG_CHLTR       LMNKFSPLVEKCKRLGKAMRIGVNHGSLSERVT--QRYGN-------------------T
ISPG_THEVB       IRETLEPLVISLRDQGKSMRIGVNHGSLAERML--FTYGD-------------------T
ISPG_SYNY3       IRETLEPLVISLRDQGKSMRIGVNHGSLSERML--FTYGD-------------------T
ISPG_GLOVI       IREELKPLVDVLGAQDKAMRIGVNHGSLSERML--YIHGD-------------------T
ISPG_PROMM       IAENFEPLVTRLKQQDKALRIGVNHGSLAERML--FAYGD-------------------T
ISPG_PARMW       IHETFEPLVTLLRDQNKALRIGVNHGSLAERML--FTYGD-------------------T
ISPG_PROMA       IINNFEPIVNTLKAQNKALRIGVNHGSLAERML--FQYGD-------------------T
ISPG_PROMP       ILKRFTPLVEVLKSENKALRIGVNHGSLSERML--FTYGD-------------------T
ISPG_LEPIN       ISEVFSPLVLRCKELGVSMRIGTNHGSLSDRIM--NRYGD-------------------T
ISPG_BACTN       IHDRFVPFLNICKENHTAIRIGVNHGSLSDRIM--SRYGD-------------------T
ISPG_PORGI       VRERFGSFVEDAKRLGRAIRIGVNHGSLSERML--TRYGD-------------------T
ISPG_RHOBA       -QEKVRYLIDTAGSNNCAVRIGVNCGSVDPAKKEKYDHDD-------------------S
ISPG_HELHP       -KDRIKAVADACNARGIPIRIGVNGGSLEKQFEEKYGA---------------------T
ISPG_HELPJ       -KDKIKAVVDACKEKNIPIRIGVNAGSLEKQFDQKYGP---------------------T
ISPG_WOLSU       -KEKIKAVADACAERGIPIRIGVNGGSLEEMFEQKYGA---------------------T
ISPG_CAMJE       -KENIKEVVKACKERGIPIRIGVNHGSIEKQFSDKFGY---------------------G
ISPG_CORDI       FDGRVKEVAKAAGDAGIPIRIGVNAGSLDKRIMEKYGKA--------------------T
ISPG_MYCPA       FDGRVGEVAKAAAAAGIPIRIGVNAGSLDKRFMAKYGKA--------------------T
ISPG1_STRAW      FDDKVKEIAKAAKEHGTPIRIGVNAGSLDRRLLEKYGKA--------------------T
ISPG_TROWT       FDDQIGKIAEKAKAAGVSIRIGVNAGSLDPRLLEKYGRP--------------------T
ISPG_BIFLO       FDEVGPDICKAATDAGISLRIGVNAGSLDKELYAKYGGP--------------------T
ISPG_AQUAE       -EEIVREIVEEAKRRGVAVRIGVNSGSLEKDLLEKYGYP--------------------S
ISPG_BUCAI       -KRRVSEIISYAKDENIPIRIGVNAGSLEKDILKKYKIP--------------------T
ISPG_BUCAP       -KRRILDIVNCAKDKNIPIRIGVNAGSLENDLLKKYKSP--------------------I
ISPG_ECOLI       -EERIRMVVDCARDKNIPIRIGVNAGSLEKDLQEKYGEP--------------------T
ISPG_VIBVY       -EERIRSVVDCARDKNIPIRIGVNGGSLEKDLQMKYGEP--------------------T
ISPG_HAEDU       -EERIRAVVDCAKDKNIPIRIGVNAGSLERDLQEKYGEP--------------------T
ISPG_WIGBR       -LNRIISVVSTAKEKKLPIRIGVNSGSLEKDIENKYGIN--------------------N
ISPG_PSESM       -EDRVRAVVDAARDRGIPIRIGVNAGSLEKDLQKKYGEP--------------------T
ISPG_CAUVC       -PDRVRDVIQAARDHGCSMRIGVNAGSLERELLEKYGEP--------------------C
ISPG_CLOAB       -KERVELVAKSAKEKNIPIRIGVNSGSLEKDILNKYKRV--------------------C
ISPG_CLOTE       -EEKVNLVSKKAKEKGIPIRIGVNSGSLEKDILNKYGGV--------------------C
ISPG_CLOPE       -REKVEAVVKACKEKNIPIRIGVNSGSLSKELLTKYGKP--------------------T
ISPG_CALS4       -EENIKKVVEAAKERGIPIRIGVNAGSLEKEILNKYGGI--------------------T
ISPG_LISMO       -RDRVEKVVNAAKAKNIPIRIGVNAGSLEKKIIQKYGYP--------------------T
ISPG_BACCR       -RHKVEAVVNAAKERGIPIRIGVNAGSLERHILEKYGYP--------------------T
ISPG_FUSNN       -DENVKKVVEAAKEKNIPIRIGVNSGSIEKEILEKYGKP--------------------C
ISPG_DESVH       -RAAVDRVVDAAKAHNAVIRIGVNSGSLETDLIDQYGGP--------------------T
ISPG_GEOSL       -RWKVEEVVAAARERLVPIRIGVNAGSLEKELLQKYGHP--------------------T
ISPG_MYCPE       -EEQLRKIIDLANKKNIPIRVGVNSGSLPMDLMKSHGV---------------------T
ISPG_MYCGA       -KEKLREICLLANQYNIPIRVGVNSGSIPYDLMREYGV---------------------T
ISPG_TREPA       -RERVRAVVEKARATGTALRIGVNTGSLPGVVKRAVAARYADGMQSVNA----------R
ISPG_TREDE       -KEKTEEVIRKAKDTGTAIRIGVNSGSLPSDLKKKIEEANSKRNLSGDKKALDDEISLLR
ISPG_THEMA       -RDRLKDVVAAAKGKGIPIRVGANVGSIKRRTSE-------------------------R
ISPG_DEIRA       HDENFATMIEVAKEFDKPVRIGVNWGSLDQQVLARLMDENAAAGHPKSPTD-------VT
ISPG_THETH       KDEHFAEMIRIAMDLGKPVRIGANWGSLDPALLTELMDRNASRPEPKSAHE-------VV
ISPG_NEIMB       GDEKFAFMIRTAAENDKAVRIGVNWGSLDQSLAKRMMDANLASSAPKPPEE-------VT
ISPG_CHRVO       GDDKFAFMIRTAMEHDKAVRIGVNWGSLDQALLARMMDANNRAANPLPLPK-------LM
ISPG_RALSO       RDTQFAQMIETACRYGKPVRIGVNWGSLDQDLLARIMDENAQRAAPWDARA-------VM
ISPG_BORPE       RDDNFAQMIEVACRHDKPVRIGVNWGSLDHELMARKMDENSRRAQPWEAQA-------VI
ISPG_NITEU       RDEQFSLLIETACKYDKPVRIGVNWGSLDPEMLARIMDENARSPDPLGASQ-------VM
ISPG_RHILO       KDRQFTDIVEMAIKHDKPVRIGVNWGSLDQELLTRLMDDNQDKGFPLTAQE-------VT
ISPG_RHIME       KDKQFAEIIEMAIRYDKPVRIGVNWGSLDQELLTRLMDANQANGSPLTAQQ-------VM
ISPG_RHOPA       RDTQFADIVEIAIKNNKAVRIGANWGSLDQELLTKLMDENAASANPRDVRA-------VT
ISPG_XANCP       KDLQFAQLIEFAIQYDKPVRIGANWGSLDQALAAQLMDENSKRETPWDAGR-------VL
ISPG_XYLFT       RDLQFGQLIECAIRYGKPIRIGANWGSLDQMLAAQLMDENNRRKQPWDAAQ-------VL
ISPG_EHRRG       RDKNFEDIIEFAIKNDIPIRIGVNWGSLDKYLAAKLMHDNSLRGTPDPDYV-------VL
ISPG_EHRRW       RDKNFEDIIEFAIKNDIPIRIGVNWGSLDKYLAAKLMHDNSLRGTPDPDYV-------VL
ISPG_ANAMM       RDRNFESVIEYAIKHDIPVRIGVNWGSLDKALIGKLMDDNASLASPYPDNV-------VM
ISPG_WOLTR       HDEKFERVIEYAITHDIPVRIGVNWGSLDKYLLQKLMDENSLSNNPKSSDV-------IL
ISPG_WOLPM       RDEKFERVIEYAIMHDLPVRIGVNWGSLDKYLLQKLMDENSSLSNSRPSDV-------IL
                        .          :*:*.* **:                                

ISPG_CHLCV       IEGMVVSALEYIEVCEKLGYRDVVFSMKSSNPKVMVAAYRQLAKDLDARGWHYPLHLGVT
ISPG_CHLPN       IEGMVASAIEYIAVCEKLNYRDVVFSMKSSNPKIMVTAYRQLAKDLDARGWLYPLHLGVT
ISPG_CHLMU       IEGMVFSALEYAEVCVNMDYHNIVFSMKSSNPRTMVAAYRALARELDQRKWLYPLHLGVT
ISPG_CHLTR       IEGMVYSALEYAEVCVAMDYHDVIFSMKSSNPKVMVAAYRSLAYELDQREWSYPLHLGVT
ISPG_THEVB       PEGMVESALEFIRICESLNFYNLEISLKASRVPVMIAANRLMVKRMDELGMDYPLHLGVT
ISPG_SYNY3       PEGMVQSALEFIKICESLDFRNLVVSMKASRVPVMLAAYRLMVKRMDELGMDYPLHLGVT
ISPG_GLOVI       PEGMVQSAVEFVEICEQLGYHNLVISLKASRVPVMIAVYRLAAKLLDARGMHYPFHLGVT
ISPG_PROMM       PLGMVESAMEFVRICDSLDFHNIVISMKASRAPVMLAAYRLMADTMDQEGFNYPLHLGVT
ISPG_PARMW       PKGMVESAMEFVRICDELDFHNIVISMKASRAPVMLAAYRLMADTMDKEGFNYPLHLGVT
ISPG_PROMA       PLGMVESAMEFVRICDSLDFHNIVISMKASRPPVMLAAYRLMADAMDKEGFNYPLHLGVT
ISPG_PROMP       PLGMTESAMEFVKICDELDFHNIIISMKASRAPVMLAAYRMIADRLDAEGYNYPLHLGVT
ISPG_LEPIN       PQGMVESALEFIRIAESLGYYDIIVSMKASNPQVMVQAYRMLASRFNELKMDYPLHLGVT
ISPG_BACTN       PEGMVESCMEFLRICVAEHFTDVVISIKASNTVVMVKTVRLLVAVMEQEGMSFPLHLGVT
ISPG_PORGI       AEGMVQSCMEYLDVCHEHEFDDVVISMKASNTLVMTAAVRLLVERMDAADMHYPLHIGVT
ISPG_RHOBA       ITPMLESALEHCELVDSLGFHNFVVSLKDSDPSKVVQVNTLFAEKRP----DVALHLGVT
ISPG_HELHP       PKGMVESALYNIKLLEDFGFSNIKISLKASDVLRTMEAYRMLRPLVD-----YPFHLGVT
ISPG_HELPJ       PKGMVESALYNAKLLEDLDFTDFKISLKASDVVRTIEAYRMLRPLVI-----YPFHLGVT
ISPG_WOLSU       PRGMVESALYNIKLLEDFGFANIKVSLKASDVERTVLAYRELRPLVE-----YPFHLGVT
ISPG_CAMJE       VDAMLESAMYNIKLLEDLDFFDIKISMKTSDAQKTIEAYERLRPLCD-----YPFHLGVT
ISPG_CORDI       PEALVESALWEAGLFEDCGFGDIAISVKHNDPVIMVEAYRQLAAQSD-----YPLHLGVT
ISPG_MYCPA       PEALVESALWEASLFEEHGFSDIKISVKHNDPVVMVAAYEQLAEQCD-----YPLHLGVT
ISPG1_STRAW      PEALVESALWEASLFEEHDFRDIKISVKHNDPVVMVNAYRQLAAQCD-----YPLHLGVT
ISPG_TROWT       AQALVDSAVWEAGLFEEYDFHDFKISVKHHDPVTMVKAYRLLAERGD-----WPLHLGVT
ISPG_BIFLO       PEALVASALKEAHMFEDVGFHDFKISVKHHDVITMVETYRLLASKGD-----WPLHLGVT
ISPG_AQUAE       AEALAESALRWSEKFEKWGFTNYKVSIKGSDVLQNVRANLIFAERTD-----VPLHIGIT
ISPG_BUCAI       PDALVESAMRHIEYFDALNFNQFKVSVKASDVFLAIESYRMLGKKIT-----QPLHIGIT
ISPG_BUCAP       PEALVESAIRHIEYLDSLNFNQFKVSVKTSDVFSAIEANEILAKKTV-----QPIHIGIT
ISPG_ECOLI       PQALLESAMRHVDHLDRLNFDQFKVSVKASDVFLAVESYRLLAKQID-----QPLHLGIT
ISPG_VIBVY       PEALVESAMRHVDILDRLNFDQFKVSVKASDVFLAVDSYRLLAKKID-----QPLHLGIT
ISPG_HAEDU       PQALLESALRHVEILDRFNFDQFKVSVKASDVFLAVESYRLLAKAIK-----QPIHLGIT
ISPG_WIGBR       PKSLFESAMRHVNILEKLNFDMFKVSVKSSDVLTCVQSYKLLASKID-----QPLHLGIT
ISPG_PSESM       PEALVESALRHVEHLERLNFKDFKVSVKASDVFMAVAAYRLLAKQIV-----QPLHLGIT
ISPG_CAUVC       PDAMVESALNHARILQDHDFHEFKISVKASDPFMTVAAYYQLAEAID-----CPLHLGVT
ISPG_CLOAB       SEALVESALNHVKILEDVNFNDIVISIKSSNVQMMIDSYRLISKEVN-----YPLHLGVT
ISPG_CLOTE       SDALVESALRHVEILNKVDFHDIVISIKSSNVNQMIESYKKISSKVN-----YPLHLGVT
ISPG_CLOPE       PDALVESALEHVKILEELDFHDIVISMKSSNVETMIESYRIASQKTN-----YPLHLGVT
ISPG_CALS4       PEAVVESALKSVRLLEKLGFYDIVISLKTSNVPLTIEAYKLASSKVD-----YPLHLGIT
ISPG_LISMO       ADGMVESALAHIKILEDLDFYDIIVSLKASDVNLAIEAYDKASRAFN-----YPLHLGIT
ISPG_BACCR       ADGMVESALHHIKILEDLDFHDIIVSMKASDVNLAIEAYEKAARAFD-----YPLHLGIT
ISPG_FUSNN       VDALVESAMYHIRLLEKFDFFDIIVSLKSSNVKMMVEAYRKISSLVD-----YPLHLGVT
ISPG_DESVH       PEAMVESAFRHIRMLEDRNFGDIKVSLKSSSVSRCIEAYTLLSAKCD-----YPLHIGVT
ISPG_GEOSL       AEAMVESALGHVRILEELGYDQIKISLKASDVPKTVAAYRLLAQRID-----YPLHIGIT
ISPG_MYCPE       ADAMMIAVKRYINLFESNGFNNIVVSLKATNVLLAIEAYKKAAMEFN-----YPLHIGIT
ISPG_MYCGA       STAMIIAAQRYVRMLKRFGFDNIVISLKTSSALLSMQAYELGAKKFS-----YPLHLGIT
ISPG_TREPA       AEALVQTAFAEAAYLDQLHFDRVVLSLKASTVAETVRANELFAQQSD-----IPLHLGVT
ISPG_TREDE       ADTLTEAAARELEIFEKADFKDAVVSMKASNVRETVMANEIFAKKFD-----NPLHLGVT
ISPG_THEMA       WKDLAESALEEVRLLEKEGFYDIIVSVKSSDVLETIKANEYIAEKVE-----YPIHLGVT
ISPG_DEIRA       IDAMIVSALDSARFAEELGLGHDKILISVKVSSAP---ELWQVYRQLAPLCDYPLHLGLT
ISPG_THETH       LEALVESAVRAYEAALEMGLGEDKLVLSAKVSKAR---DLVWVYRELARRTQAPLHLGLT
ISPG_NEIMB       KEALIVSALESAEKAVLLGLPEDKIILSCKVSAVQ---DLIQVYRELGSRCAYPLHLGLT
ISPG_CHRVO       QEALIVSALESAEKAVEIGLSPDNIILSCKVSNVQ---DLISVYRELGGRCDYPLHLGLT
ISPG_RALSO       IEALITSAIESARKAEEIGLPGSQIILSCKVSAVQ---DLIAVYRELARRCDYALHLGLT
ISPG_BORPE       RDALVVSAISNARRAEELGLRSDAIVLSCKVSHVQ---DLIAVYRDLSARCDYPLHLGLT
ISPG_NITEU       HKALITSALESAARAEELGLARDHIVLSCKVSGVARQQDMIAVYGALAEQCDYALHLGLT
ISPG_RHILO       REAIVQSAILSAEMAEEIGLGRDKIILSAKVSGVQ---DLIAVYTELATRSDHALHLGLT
ISPG_RHIME       RETIVQSALLSAELAEELGLPRSRIILSAKVSGVQ---DLIAVYAMLAARSVHALHLGLT
ISPG_RHOPA       REAMVQSALLSAARAEEIGLPKNKMILSAKVSAVQ---DLIAVYQDLASRSDYAIHLGLT
ISPG_XANCP       REALIRSAVDSAERAVELGLPRERIILSAKVSGVQ---ELIAVYRDMAARCDFALHLGLT
ISPG_XYLFT       REVLIFSAVGSAERAVELGLPRDRIVLSAKVSGVQ---ELIAVYRDMAARCDFALHLGLT
ISPG_EHRRG       RKALVISAITSAKHAEKVGLPANKIVISCKVSKVR---DLISVYTMLSKICDYPLHLGLT
ISPG_EHRRW       RKALVISAITSAKHAEKVGLPANKIVISCKVSKVR---DLISVYTMLSKICDYPLHLGLT
ISPG_ANAMM       RKALVTSALQSAELAERIGLPRNKIVLSCKTSKVR---DLVAVYSALSESADYALHLGLT
ISPG_WOLTR       RKALVMSALNSAQKAEEIGLSLDKIVISCKVSRVQ---DLISVYTALAKSSNYALHLGLT
ISPG_WOLPM       RKALVMSALDSAKKAEEIGLNSNKIIISCKVSKVQ---DLILVYMALAKSSNYALHLGLT
                    :  :                 . :.                         .:*:*:*

ISPG_CHLCV       EAGIGLDGIIKSAVGIGTLLTEGLGDTIRCSLTGCPTT------------------EIPV
ISPG_CHLPN       EAGMGVDGIIKSAVGIGTLLAEGLGDTIRCSLTGCPTT------------------EIPV
ISPG_CHLMU       EAGSGMDGMIKSSVGIGTLLSEGLGDTIRCSLTGSPTL------------------EIPV
ISPG_CHLTR       EAGSGTAGIVKSAVGIGTLLSEGLGDTIRCSLTGSPIN------------------EIPI
ISPG_THEVB       EAGDGEYGRIKSTAGIATLLAEGIGDTIRVSLTEAPEK------------------EIPV
ISPG_SYNY3       EAGDGEYGRIKSTAGIATLLADGIGDTIRVSLTEAPEK------------------EIPV
ISPG_GLOVI       EAGDGEYGRIKSTAGIATLLADGIGDTIRVSLTEDPLK------------------EIPV
ISPG_PROMM       EAGDGDYGRIKSTAGIATLLAEGLGDTIRVSLTEAPEK------------------EIPV
ISPG_PARMW       EAGDGDYGRVKSTAGIATLLADGLGDTIRVSLTEAPER------------------EIPV
ISPG_PROMA       EAGDGDYGRIKSTVGIGTLLTEGLGDTIRVSLTEAPEK------------------EIPV
ISPG_PROMP       EAGDGDYGRIKSTAGIGTLLAEGLGDTIRVSLTEAPEK------------------EIPV
ISPG_LEPIN       EAGDGNDGRIKSAIGIGSLLEDGLGDTIRVSLTEDPVL------------------EVPV
ISPG_BACTN       EAGDGEDGRIKSALGIGALLCDGLGDTIRVSLSEAPEA------------------EIPV
ISPG_PORGI       EAGDGEDGRIKSAVGIGSLLADGIGDTIRVSLSEDPEH------------------EIPV
ISPG_RHOBA       EAGMPPDGIIKTRIAFEQLIGKGIGDTVRVSLTLPNPRKPEEIDAGKQIVEDIHAG----
ISPG_HELHP       EAGTLPHSMIKSAMALGGLLMEGIGDTMRISITGELEE----------------------
ISPG_HELPJ       EAGNLFSSSIKSAMALGGLLMEGIGDTMRVSITGELEN----------------------
ISPG_WOLSU       EAGTLFHSMIKSSMALGGLLLEGIGDTMRVSITGELEQ----------------------
ISPG_CAMJE       EAGTKFHSTVKSSIALGNLLLKGIGDTMRVSMTGELEE----------------------
ISPG_CORDI       EAGPAFQGTIKSSVAFGSLLSQGIGDTIRVSLSADPVE----------------------
ISPG_MYCPA       EAGPAFQGTIKSAVAFGALLSRGIGDTIRVSLSAPPVE----------------------
ISPG1_STRAW      EAGPAFQGTIKSAVAFGALLSEGIGDTIRVSLSAPPVE----------------------
ISPG_TROWT       EAGPAFQGTIKSSTAFAVLLAEGIGDTIRVSLSAPPVE----------------------
ISPG_BIFLO       EAGPAWQGTIKSCLAFGALLAEGIGDTIRVSLSAPPAE----------------------
ISPG_AQUAE       EAGMGTKGIIKSSVGIGILLYMGIGDTVRVSLTDDPVV----------------------
ISPG_BUCAI       ESGGLRNGTVKSSIGIALLLLEGIGDTIRVSLAAHPTE----------------------
ISPG_BUCAP       ESGALRNGIVKSSIGITSLLLSGIGDTLRISLAADPVE----------------------
ISPG_ECOLI       EAGGARSGAVKSAIGLGLLLSEGIGDTLRVSLAADPVE----------------------
ISPG_VIBVY       EAGGARAGAVKSAVGLGMLLAEGIGDTLRISLAANPVE----------------------
ISPG_HAEDU       EAGGARAGSVKSAIGLGLLLSEGIGDTLRVSLAADPVD----------------------
ISPG_WIGBR       ESGSMLHGSIKSSIGIGLLLSEGIGDTLRVSLAADPIE----------------------
ISPG_PSESM       EAGGLRSGTVKSAVGLGMLLAEGIGDTIRISLAADPVE----------------------
ISPG_CAUVC       EAGATRTGTVKSAIGIGAMLWAGIGDTIRVSLAADPVE----------------------
ISPG_CLOAB       EAGTIWRGTIKSSIGIGTLLSEGIGDTIRVSLTGDPVE----------------------
ISPG_CLOTE       EAGTPWRGIIKSSVGIGTLLSQGIGDTIRVSLTGDPIE----------------------
ISPG_CLOPE       EAGTPWRGTIKSAIGIGTLLAEGIGDTIRVSLTGDPVE----------------------
ISPG_CALS4       EAGTLESGTIKSAIGIGTLLYMGIGDTIRVSLTGDPVH----------------------
ISPG_LISMO       ESGTQFAGGIKSAAGLGAILSLGIGNTLRVSLSADPVE----------------------
ISPG_BACCR       ESGTLFAGTVKSAAGLGAILNKGIGNTLRISLSADPVE----------------------
ISPG_FUSNN       EAGTKFQGTVKSAIGIGALLVDGIGDTLRVSLTENPVE----------------------
ISPG_DESVH       EAGTVLRGSIKSAVGLGVLLWQGIGDTLRVSLTSDPVA----------------------
ISPG_GEOSL       EAGTMFSGTIKSAVGLGILLADGIGDTLRVSLTGDPVD----------------------
ISPG_MYCPE       EAGSLFNGTIKSAAGLGVLLHEGIGNTIRISLTGDPLS----------------------
ISPG_MYCGA       EAGTLINGTIKSVAGLTPLLLKGIGDTIRISLSTNPVD----------------------
ISPG_TREPA       EAGPLVSGIVKSTLAFSQLLSRNIGATVRVSLSDSMEH----------------------
ISPG_TREDE       EAGPLIQGIVKSTIAFYRLLEQNIGSTIRVSLSDSCEN----------------------
ISPG_THEMA       EAGVSETAIVKSSIAIGHLLLKNIGDTIRVSISGDPVR----------------------
ISPG_DEIRA       EAGMGMKGIVASSVALAPLLTEGIGDTIRVSLTPEPGA----------------------
ISPG_THETH       EAGMGVKGIVASAAALAPLLLEGIGDTIRVSLTPSPKE----------------------
ISPG_NEIMB       EAGMGSKGIVASTAALSVLLQEGIGDTIRISLTPEPGS----------------------
ISPG_CHRVO       EAGMGSKGIVASSAALAVLLQEGIGDTIRISLTPQPGE----------------------
ISPG_RALSO       EAGMGSKGIVASTAALSVLLQEGIGDTIRISLTPEPGA----------------------
ISPG_BORPE       EAGMSSKGIVASTAALAVLLQEGIGDTIRISLTPEPGG----------------------
ISPG_NITEU       EAGMGSKGIVASTAALAVLLFKGIGDTIRVSLTPEPGG----------------------
ISPG_RHILO       EAGMGSKGIVASSAAMGILLQQGIGDTIRISLTPEPNG----------------------
ISPG_RHIME       EAGMGTKGIVASSASLGILMQQGIGDTIRISLTPEPGG----------------------
ISPG_RHOPA       EAGMGSKGIVASSAALGILLQQGIGDTIRISLTPEPGG----------------------
ISPG_XANCP       EAGIGSKGIVASAAALSVLLQEGIGDTIRISLTPEPGQ----------------------
ISPG_XYLFT       EAGIGSKGIVASSAALAVLLQEGIGDTIRISLTPEPGQ----------------------
ISPG_EHRRG       EAGSGVKGIVGSSAGISYLLLHGIGNTIRVSLTQQPGE----------------------
ISPG_EHRRW       EAGSGVKGIVGSSAGISYLLLHGIGNTIRVSLTQQPGE----------------------
ISPG_ANAMM       EAGTGLKGIVSSTAGIAHLLLMGIGDTIRVSLTSTSRE----------------------
ISPG_WOLTR       EAGTGNKGMISTTAGLTYLLQNGIGDTIRASLTQRPGE----------------------
ISPG_WOLPM       EAGMGNKGVVNTAAGLTYLLQNGIGDTIRASLTQRPGE----------------------
                 *:*    . : :  .:  ::  .:* *:* *::                           

ISPG_CHLCV       CESLLKHTTTYLDL----------------------------------------------
ISPG_CHLPN       CDSLLRHTKIYLDL----------------------------------------------
ISPG_CHLMU       CLDLLKETAKYSKS----------------------------------------------
ISPG_CHLTR       CIDLLKQTTELSERW---------------------------------------------
ISPG_THEVB       C-----------------------------------------------------------
ISPG_SYNY3       C-----------------------------------------------------------
ISPG_GLOVI       C-----------------------------------------------------------
ISPG_PROMM       C-----------------------------------------------------------
ISPG_PARMW       C-----------------------------------------------------------
ISPG_PROMA       A-----------------------------------------------------------
ISPG_PROMP       C-----------------------------------------------------------
ISPG_LEPIN       AKLLADKFNKKISNLNSVKGYSEFRNPFSYNRFYSSEIKIVQFEAGENHPVRVETILPFE
ISPG_BACTN       ARKLVDYVLLRQDHPYIPGMEAPEFNYLSPSR----------------------------
ISPG_PORGI       ARKLLAYIEKRNGHPSVAVPQPDRYDRDKLRR----------------------------
ISPG_RHOBA       ------------------------------------------------------------
ISPG_HELHP       ------------------------------------------------------------
ISPG_HELPJ       ------------------------------------------------------------
ISPG_WOLSU       ------------------------------------------------------------
ISPG_CAMJE       ------------------------------------------------------------
ISPG_CORDI       ------------------------------------------------------------
ISPG_MYCPA       ------------------------------------------------------------
ISPG1_STRAW      ------------------------------------------------------------
ISPG_TROWT       ------------------------------------------------------------
ISPG_BIFLO       ------------------------------------------------------------
ISPG_AQUAE       ------------------------------------------------------------
ISPG_BUCAI       ------------------------------------------------------------
ISPG_BUCAP       ------------------------------------------------------------
ISPG_ECOLI       ------------------------------------------------------------
ISPG_VIBVY       ------------------------------------------------------------
ISPG_HAEDU       ------------------------------------------------------------
ISPG_WIGBR       ------------------------------------------------------------
ISPG_PSESM       ------------------------------------------------------------
ISPG_CAUVC       ------------------------------------------------------------
ISPG_CLOAB       ------------------------------------------------------------
ISPG_CLOTE       ------------------------------------------------------------
ISPG_CLOPE       ------------------------------------------------------------
ISPG_CALS4       ------------------------------------------------------------
ISPG_LISMO       ------------------------------------------------------------
ISPG_BACCR       ------------------------------------------------------------
ISPG_FUSNN       ------------------------------------------------------------
ISPG_DESVH       ------------------------------------------------------------
ISPG_GEOSL       ------------------------------------------------------------
ISPG_MYCPE       ------------------------------------------------------------
ISPG_MYCGA       ------------------------------------------------------------
ISPG_TREPA       ------------------------------------------------------------
ISPG_TREDE       ------------------------------------------------------------
ISPG_THEMA       ------------------------------------------------------------
ISPG_DEIRA       ------------------------------------------------------------
ISPG_THETH       ------------------------------------------------------------
ISPG_NEIMB       ------------------------------------------------------------
ISPG_CHRVO       ------------------------------------------------------------
ISPG_RALSO       ------------------------------------------------------------
ISPG_BORPE       ------------------------------------------------------------
ISPG_NITEU       ------------------------------------------------------------
ISPG_RHILO       ------------------------------------------------------------
ISPG_RHIME       ------------------------------------------------------------
ISPG_RHOPA       ------------------------------------------------------------
ISPG_XANCP       ------------------------------------------------------------
ISPG_XYLFT       ------------------------------------------------------------
ISPG_EHRRG       ------------------------------------------------------------
ISPG_EHRRW       ------------------------------------------------------------
ISPG_ANAMM       ------------------------------------------------------------
ISPG_WOLTR       ------------------------------------------------------------
ISPG_WOLPM       ------------------------------------------------------------
                                                                             

ISPG_CHLCV       -------PKKENPFALENSETFVNASKKITKATPWGSVYGVFIKLMKEHLLNNTVEKLLE
ISPG_CHLPN       -------PEKKNPFSLQHSENFVSAAEKPAKTTLWGDVYGVFLKLYPHHLTDFTPEELLE
ISPG_CHLMU       -------TKKYNPFEIYHS--KQLTTQTTPKHFPVENVYGFLVGLTKDHLLTIEPNTLLQ
ISPG_CHLTR       -------GEADNPFAIHSS--KQLGTRNTLNTPPWGNVYGLLINLTDVQLLTAEPIELLQ
ISPG_THEVB       ------------------------------------------------------------
ISPG_SYNY3       ------------------------------------------------------------
ISPG_GLOVI       ------------------------------------------------------------
ISPG_PROMM       ------------------------------------------------------------
ISPG_PARMW       ------------------------------------------------------------
ISPG_PROMA       ------------------------------------------------------------
ISPG_PROMP       ------------------------------------------------------------
ISPG_LEPIN       NSNSFLENVAKLYQYGKSLSIEPESILVDSPLPDQLKEISEAATALSIPVGILLSKNVSL
ISPG_BACTN       -------------RKTRAVRN-IGGEHLPVVIADRMDGKTEVNPQFTPDYIYAGRTLPEQ
ISPG_PORGI       -------------QETYAVGDFIGSKHIPIVISDRRQGDDHFDTELLPDIVLGADGRYYR
ISPG_RHOBA       ------------------------------------------------------------
ISPG_HELHP       ------------------------------------------------------------
ISPG_HELPJ       ------------------------------------------------------------
ISPG_WOLSU       ------------------------------------------------------------
ISPG_CAMJE       ------------------------------------------------------------
ISPG_CORDI       ------------------------------------------------------------
ISPG_MYCPA       ------------------------------------------------------------
ISPG1_STRAW      ------------------------------------------------------------
ISPG_TROWT       ------------------------------------------------------------
ISPG_BIFLO       ------------------------------------------------------------
ISPG_AQUAE       ------------------------------------------------------------
ISPG_BUCAI       ------------------------------------------------------------
ISPG_BUCAP       ------------------------------------------------------------
ISPG_ECOLI       ------------------------------------------------------------
ISPG_VIBVY       ------------------------------------------------------------
ISPG_HAEDU       ------------------------------------------------------------
ISPG_WIGBR       ------------------------------------------------------------
ISPG_PSESM       ------------------------------------------------------------
ISPG_CAUVC       ------------------------------------------------------------
ISPG_CLOAB       ------------------------------------------------------------
ISPG_CLOTE       ------------------------------------------------------------
ISPG_CLOPE       ------------------------------------------------------------
ISPG_CALS4       ------------------------------------------------------------
ISPG_LISMO       ------------------------------------------------------------
ISPG_BACCR       ------------------------------------------------------------
ISPG_FUSNN       ------------------------------------------------------------
ISPG_DESVH       ------------------------------------------------------------
ISPG_GEOSL       ------------------------------------------------------------
ISPG_MYCPE       ------------------------------------------------------------
ISPG_MYCGA       ------------------------------------------------------------
ISPG_TREPA       ------------------------------------------------------------
ISPG_TREDE       ------------------------------------------------------------
ISPG_THEMA       ------------------------------------------------------------
ISPG_DEIRA       ------------------------------------------------------------
ISPG_THETH       ------------------------------------------------------------
ISPG_NEIMB       ------------------------------------------------------------
ISPG_CHRVO       ------------------------------------------------------------
ISPG_RALSO       ------------------------------------------------------------
ISPG_BORPE       ------------------------------------------------------------
ISPG_NITEU       ------------------------------------------------------------
ISPG_RHILO       ------------------------------------------------------------
ISPG_RHIME       ------------------------------------------------------------
ISPG_RHOPA       ------------------------------------------------------------
ISPG_XANCP       ------------------------------------------------------------
ISPG_XYLFT       ------------------------------------------------------------
ISPG_EHRRG       ------------------------------------------------------------
ISPG_EHRRW       ------------------------------------------------------------
ISPG_ANAMM       ------------------------------------------------------------
ISPG_WOLTR       ------------------------------------------------------------
ISPG_WOLPM       ------------------------------------------------------------
                                                                             

ISPG_CHLCV       QLGINPTNGKKDFTAPDGIIVPKSFIGTSVIEKLKEHLLVFHHHEVPCLYNHNEEIWNSE
ISPG_CHLPN       HLGVNPVTKEKAFTTPEGVVVPPELKDAPITDVLREHFLVFHHHQVPCLYEHNEEIWDSP
ISPG_CHLMU       CLGVDITTGKKDLTSPDGVVIPKSMRSSAIVSEIEKHLRIFYKEDAPILNEMNEELWLSD
ISPG_CHLTR       CLGIDTTTGKIDPTTPEGVVVPKAMRSSPIVSEIEKHLLVFNKEDVPILNPMNEEEWLSE
ISPG_THEVB       ------------------------------------------------------------
ISPG_SYNY3       ------------------------------------------------------------
ISPG_GLOVI       ------------------------------------------------------------
ISPG_PROMM       ------------------------------------------------------------
ISPG_PARMW       ------------------------------------------------------------
ISPG_PROMA       ------------------------------------------------------------
ISPG_PROMP       ------------------------------------------------------------
ISPG_LEPIN       NEKLQKELLSFPKIVFDPFLQFQDGEKMLSFLKERQNAGLFSEIHTSGDKLDSLRGLPDT
ISPG_BACTN       REEGVEYILDADVWEGEAGTWPAFNHAQLPLMGECSAELKFLFMPYMAQTDEVIACLKVH
ISPG_PORGI       EDMLLENIVFRSIRQDD-------------------------------LTDDCLQTIEAI
ISPG_RHOBA       ------------------------------------------------------------
ISPG_HELHP       ------------------------------------------------------------
ISPG_HELPJ       ------------------------------------------------------------
ISPG_WOLSU       ------------------------------------------------------------
ISPG_CAMJE       ------------------------------------------------------------
ISPG_CORDI       ------------------------------------------------------------
ISPG_MYCPA       ------------------------------------------------------------
ISPG1_STRAW      ------------------------------------------------------------
ISPG_TROWT       ------------------------------------------------------------
ISPG_BIFLO       ------------------------------------------------------------
ISPG_AQUAE       ------------------------------------------------------------
ISPG_BUCAI       ------------------------------------------------------------
ISPG_BUCAP       ------------------------------------------------------------
ISPG_ECOLI       ------------------------------------------------------------
ISPG_VIBVY       ------------------------------------------------------------
ISPG_HAEDU       ------------------------------------------------------------
ISPG_WIGBR       ------------------------------------------------------------
ISPG_PSESM       ------------------------------------------------------------
ISPG_CAUVC       ------------------------------------------------------------
ISPG_CLOAB       ------------------------------------------------------------
ISPG_CLOTE       ------------------------------------------------------------
ISPG_CLOPE       ------------------------------------------------------------
ISPG_CALS4       ------------------------------------------------------------
ISPG_LISMO       ------------------------------------------------------------
ISPG_BACCR       ------------------------------------------------------------
ISPG_FUSNN       ------------------------------------------------------------
ISPG_DESVH       ------------------------------------------------------------
ISPG_GEOSL       ------------------------------------------------------------
ISPG_MYCPE       ------------------------------------------------------------
ISPG_MYCGA       ------------------------------------------------------------
ISPG_TREPA       ------------------------------------------------------------
ISPG_TREDE       ------------------------------------------------------------
ISPG_THEMA       ------------------------------------------------------------
ISPG_DEIRA       ------------------------------------------------------------
ISPG_THETH       ------------------------------------------------------------
ISPG_NEIMB       ------------------------------------------------------------
ISPG_CHRVO       ------------------------------------------------------------
ISPG_RALSO       ------------------------------------------------------------
ISPG_BORPE       ------------------------------------------------------------
ISPG_NITEU       ------------------------------------------------------------
ISPG_RHILO       ------------------------------------------------------------
ISPG_RHIME       ------------------------------------------------------------
ISPG_RHOPA       ------------------------------------------------------------
ISPG_XANCP       ------------------------------------------------------------
ISPG_XYLFT       ------------------------------------------------------------
ISPG_EHRRG       ------------------------------------------------------------
ISPG_EHRRW       ------------------------------------------------------------
ISPG_ANAMM       ------------------------------------------------------------
ISPG_WOLTR       ------------------------------------------------------------
ISPG_WOLPM       ------------------------------------------------------------
                                                                             

ISPG_CHLCV       QVLSAPFVHCHATPPFIHSTREFFEKKQSNEQPVKLVFSKDLDD-EFEAAVSIATEFGAL
ISPG_CHLPN       AVHQAPFVHFHASDPFIHTSRDFFEKQGHQGKPTKLVFSRDFDN-KEEAAISIATEFGAL
ISPG_CHLMU       KTLATPFVYFEVES--IYQARRFFALRQNYSQPVCLSFSLKANLSKNSAAIDLSIRLGAL
ISPG_CHLTR       ETLSAPFVYFEVTD--IHTARRFFSLRQHSTQPVCLSFSLDPHLSKNEAIIDLSARLGAL
ISPG_THEVB       ------------------------------------------------------------
ISPG_SYNY3       ------------------------------------------------------------
ISPG_GLOVI       ------------------------------------------------------------
ISPG_PROMM       ------------------------------------------------------------
ISPG_PARMW       ------------------------------------------------------------
ISPG_PROMA       ------------------------------------------------------------
ISPG_PROMP       ------------------------------------------------------------
ISPG_LEPIN       LSEIGIKNVLFSLDSKEILYDYRKLGSILSRFEFPILLHGSFSNPEEALYNSAIGIGGLL
ISPG_BACTN       PEVVVISQSNHPNRLGEHRALVHQLMTEGLENPVVFFQHYAEDEAEDLQIKSAVDMGALI
ISPG_PORGI       SDTVIILESVGINPVAEWRAMLHRLELAGCRCPVILHRRYDCTDLEDLQLQASADMGAIL
ISPG_RHOBA       ------------------------------------------------------------
ISPG_HELHP       ------------------------------------------------------------
ISPG_HELPJ       ------------------------------------------------------------
ISPG_WOLSU       ------------------------------------------------------------
ISPG_CAMJE       ------------------------------------------------------------
ISPG_CORDI       ------------------------------------------------------------
ISPG_MYCPA       ------------------------------------------------------------
ISPG1_STRAW      ------------------------------------------------------------
ISPG_TROWT       ------------------------------------------------------------
ISPG_BIFLO       ------------------------------------------------------------
ISPG_AQUAE       ------------------------------------------------------------
ISPG_BUCAI       ------------------------------------------------------------
ISPG_BUCAP       ------------------------------------------------------------
ISPG_ECOLI       ------------------------------------------------------------
ISPG_VIBVY       ------------------------------------------------------------
ISPG_HAEDU       ------------------------------------------------------------
ISPG_WIGBR       ------------------------------------------------------------
ISPG_PSESM       ------------------------------------------------------------
ISPG_CAUVC       ------------------------------------------------------------
ISPG_CLOAB       ------------------------------------------------------------
ISPG_CLOTE       ------------------------------------------------------------
ISPG_CLOPE       ------------------------------------------------------------
ISPG_CALS4       ------------------------------------------------------------
ISPG_LISMO       ------------------------------------------------------------
ISPG_BACCR       ------------------------------------------------------------
ISPG_FUSNN       ------------------------------------------------------------
ISPG_DESVH       ------------------------------------------------------------
ISPG_GEOSL       ------------------------------------------------------------
ISPG_MYCPE       ------------------------------------------------------------
ISPG_MYCGA       ------------------------------------------------------------
ISPG_TREPA       ------------------------------------------------------------
ISPG_TREDE       ------------------------------------------------------------
ISPG_THEMA       ------------------------------------------------------------
ISPG_DEIRA       ------------------------------------------------------------
ISPG_THETH       ------------------------------------------------------------
ISPG_NEIMB       ------------------------------------------------------------
ISPG_CHRVO       ------------------------------------------------------------
ISPG_RALSO       ------------------------------------------------------------
ISPG_BORPE       ------------------------------------------------------------
ISPG_NITEU       ------------------------------------------------------------
ISPG_RHILO       ------------------------------------------------------------
ISPG_RHIME       ------------------------------------------------------------
ISPG_RHOPA       ------------------------------------------------------------
ISPG_XANCP       ------------------------------------------------------------
ISPG_XYLFT       ------------------------------------------------------------
ISPG_EHRRG       ------------------------------------------------------------
ISPG_EHRRW       ------------------------------------------------------------
ISPG_ANAMM       ------------------------------------------------------------
ISPG_WOLTR       ------------------------------------------------------------
ISPG_WOLPM       ------------------------------------------------------------
                                                                             

ISPG_CHLCV       LLDGLGEAVILDLPNVSLPTVREIAFSTLQSAGVRLVKTEYISCPGCGRTLFDLPEVTTR
ISPG_CHLPN       LLDGLGEAVVLDLPNLPLQDVLKIAFGTLQNAGVRLVKTEYISCPMCGRTLFDLEEVTTR
ISPG_CHLMU       LLDGLGSCVLFNFSDLKLA--RTLGFSILQSANIRSTTVEYISCPGCGRTLFDLPEVSQR
ISPG_CHLTR       LLDGLGSCVLLDFVDIKLS--RTLGFLILQSANIRSVTVEYVSCPGCGRTLFDLLAVSQR
ISPG_THEVB       -------------------------YGILQALGLRRTMVEYVACPSCGRTLFNLEEVLHK
ISPG_SYNY3       -------------------------YSILQALGLRKTMVEYVACPSCGRTLFNLEDVLHE
ISPG_GLOVI       -------------------------YGILQALGLRRTMVEYVACPSCGRTLFNLETVLHR
ISPG_PROMM       -------------------------YSILQSIGLRKTMVEYISCPSCGRTLFNLEEVVQK
ISPG_PARMW       -------------------------YSILQSLGLRKTMVEYVACPSCGRTLFNLEEVLHK
ISPG_PROMA       -------------------------YSILQTVGLRKTMVEYISCPSCGRTLFNLEEVVAK
ISPG_PROMP       -------------------------YSILQSLGLRKTMVEYISCPSCGRTLFNLEEVVDK
ISPG_LEPIN       IDGIGDLIRISTSKIKDIEEIFQLSYDLLQGTRLRLTKTEYISCPSCGRTLFDLQETTAR
ISPG_BACTN       FDGLCDGIFLFNQGSLSHAVVDATAFGILQAGRTRTSKTEYISCPGCGRTLYDLEKTIAR
ISPG_PORGI       LEGRGNG-LMITADKLPSVAVNHLAFGILQATRLRMSRTEYISCPSCGRTLYNLQETVAR
ISPG_RHOBA       --------------------------RVRSVVKFDDSKLNIISCPSCSRVENEAFIDLAA
ISPG_HELHP       --------------------EIKVARLILQYSGRQKSGVSIVSCPTCGRIEANLVKMVQE
ISPG_HELPJ       --------------------EIKVARAILRHSGRLKEGINWISCPTCGRIEANLVDMASK
ISPG_WOLSU       --------------------EVEVARAILKYSGRQKEGVYLISCPTCGRIEADLVSAVKR
ISPG_CAMJE       --------------------EIRVARAILQDSGVQKSGVNIISCPTCGRIQSDLLSAIKI
ISPG_CORDI       --------------------EIKVGDQILQSLNLRKRGLEIVSCPSCGRAQVDVYSLAEE
ISPG_MYCPA       --------------------EVKVGIQILESLNLRPRSLEIVSCPSCGRAQVDVYTLANE
ISPG1_STRAW      --------------------EIKVGIQILESLNLRQRGLEIVSCPSCGRAQVDVYKLAEE
ISPG_TROWT       --------------------EVKVGLEILRSLGLRERRLEIVSCPSCGRAQVDVYRLAEE
ISPG_BIFLO       --------------------EVKVGCKLLEYMGLRPRKFDIISCPSCGRAQVDVIQLASA
ISPG_AQUAE       --------------------EVETAYEILKSLGLRRRGVEIVACPTCGRIEVDLPKVVKE
ISPG_BUCAI       --------------------EVKVGYDILKVLSLRARGINFIACPTCSRQEFDVINTVNQ
ISPG_BUCAP       --------------------EVKVGYDILKTLGIRFRGVNFIACPTCSRQEFNVIDVVNQ
ISPG_ECOLI       --------------------EIKVGFDILKSLRIRSRGINFIACPTCSRQEFDVIGTVNA
ISPG_VIBVY       --------------------EIKVGFDILKSLRIRSRGINFIACPSCSRQEFDVISTVNA
ISPG_HAEDU       --------------------EVKVGFDILKSLRIRSRGINFVACPTCSRQEIDVIATVNA
ISPG_WIGBR       --------------------EVKVGFSILRSLNIRKRGINFIACPTCSRQEFDVINVVNV
ISPG_PSESM       --------------------EVKVGYDILKSLRLRSRGINFIACPSCSRQNFDVVKTMNE
ISPG_CAUVC       --------------------EIKVGFDILKSLGLRHRGVNIIACPSCARQGFNVIKTVEA
ISPG_CLOAB       --------------------EVKVGREILKTFGYLKSGVEFISCPTCGRTSIDLIKIANE
ISPG_CLOTE       --------------------EIKAGKEILRALNLYSKGVEFISCPTCGRTEINLIKIAKE
ISPG_CLOPE       --------------------EIKVGKEILKNFGYVKEGIEFISCPTCGRTQIDLINIAKE
ISPG_CALS4       --------------------EVRVGRQILRALGLLKEGVEVISCPTCGRTKIDVIKLATE
ISPG_LISMO       --------------------EIKVAREVLKSFGLSSNAAMLISCPTCGRIEIDLIRIANE
ISPG_BACCR       --------------------EVKVARELLKSFGLASNAATLISCPTCGRIEIDLISIANE
ISPG_FUSNN       --------------------EIKVAKEILKVLDLSDEGVEIISCPTCGRTEIDLIGLAKQ
ISPG_DESVH       --------------------EMAVAWEILRSLGLRSRGPEIIACPTCGRCEIGLIALAEE
ISPG_GEOSL       --------------------EVRVGFEILKALNLRQKGINLVSCPTCGRCQINLIGVAEE
ISPG_MYCPE       --------------------EVKVCKKLLNSLGLYDNLVDIISCPTCGRLNFDLNPVVKE
ISPG_MYCGA       --------------------EIKVAKKMLNSLGLYENLVDVVACPTCGRLNFDLFKVTKE
ISPG_TREPA       --------------------EVLAAREILAECGKRAGGVRLVSCPRCGRIGFDVHAFVRR
ISPG_TREDE       --------------------EVIAGREILTECGKRQGGIRLISCPRCGRKGFDVQAFVKR
ISPG_THEMA       --------------------EVIVGKKILIALGLREG-VEVIACPTCGRAEIDVENMAKM
ISPG_DEIRA       ----------------PRKLEVEVAQQILQSLGLRQFLPQVTSCPGCGRTTSSFFQTLAQ
ISPG_THETH       ----------------PRTKEVEVAQEILQALGLRAFAPEVTSCPGCGRTTSTFFQELAE
ISPG_NEIMB       ----------------PRTQEVVVGQEILQTMGLRSFTPMVTACPGCGRTTSTVFQELAQ
ISPG_CHRVO       ----------------ARTKEVVVAQELLQTMGLRSFTPLVTACPGCGRTTSTFFQELAD
ISPG_RALSO       ----------------PREKEVIVAQEILQTMGLRNFTPMVIACPGCGRTTSTVFQELAA
ISPG_BORPE       ----------------DRTREVIVAQEILQTMGLRAFTPMVVACPGCGRTSSTFFQELAD
ISPG_NITEU       ----------------DRAREVIVAQEILQTMGLRAFVPLVAACPGCGRTTSTYFQELAE
ISPG_RHILO       ----------------DRTREVQVAQELLQTMGFRQFVPIVAACPGCGRTTSTVFQELAQ
ISPG_RHIME       ----------------DRTREVQVAQELLQVMGFRQFIPVVAACPGCGRTTSTVFQELAQ
ISPG_RHOPA       ----------------DRTREVQVGQELLQTMGFRTFVPLVAACPGCGRTTSTTFQELAR
ISPG_XANCP       ----------------SRTQEVIVAQELLQTTGQRAFTPLVTACPGCGRTTSEFFQELAG
ISPG_XYLFT       ----------------SRTQEVIVAQELLQTTGHRAFTPMVTACPGCGRTTSEFFQELAK
ISPG_EHRRG       ----------------SRTNEVKLCQEILQSIGLRNFSVQVTSCPGCNRTNPKYFHQLVS
ISPG_EHRRW       ----------------SRTNEVKLCQEILQSIGLRNFSVQVTSCPGCNRTNPKYFHQLVS
ISPG_ANAMM       ----------------DRAQEVRVCKEILQSLGLRFFSAQTTSCPGCGRTNFPYFQKLVS
ISPG_WOLTR       ----------------PRVNEVAVCQEILQSIGLRHFNPQVNSCPGCGRTNSDRFRILTE
ISPG_WOLPM       ----------------SRTNEVVVCQEILQSIGLRHFNPQVNSCPGCGRTSSDRFRILTE
                                                           :** * *           

ISPG_CHLCV       IREKTKHLVG------------LKIAVMGCIVNGPGEMADSDFGFVGSKTGMIDLYVKHT
ISPG_CHLPN       IRKRTQHLPG------------LKIAIMGCIVNGPGEMADADFGFVGSKTGMIDLYVKHT
ISPG_CHLMU       IKERTKHLPGG-----------LKIAVMGCIVNGPGEMADADFGYVGSKPGMIDLYVKHK
ISPG_CHLTR       IRERTQHLPGG-----------LKIAVMGCIVNGPGEMADADFGYVGSKPGMIDLYVKHK
ISPG_THEVB       VREATKHLTG------------LNIAVMGCIVNGPGEMADADYGYVGKQPGYISLYRGR-
ISPG_SYNY3       VREATKHLTG------------LDIAVMGCIVNGPGEMADADYGYVGKQAGYIALYRGR-
ISPG_GLOVI       VREATRHLTG------------LNIAVMGCIVNGPGEMADADYGYVGKTPGTISLYRGR-
ISPG_PROMM       VRDSTSHLVG------------LDIAVMGCIVNGPGEMADADYGYVGKGPGVISLYRGR-
ISPG_PARMW       VRDATSHLTG------------LDIAVMGCIVNGPGEMADADYGYVGKTPGVISLYRGR-
ISPG_PROMA       VRDATSHLTG------------LDIAVMGCIVNGPGEMADADYGYVGKGKGIIALYRGR-
ISPG_PROMP       VRKATSHLTG------------LDIAIMGCIVNGPGEMADADYGYVGKGKGTIALYRRK-
ISPG_LEPIN       IKSRTGHLKG------------VKIAVMGCIVNGPGEMADADFGYVGAGPGKVHLYRGKE
ISPG_BACTN       IKAATSHLKG------------LKIGIMGCIVNGPGEMADADYGYVGAGRGKISLYKGKV
ISPG_PORGI       IKAATAHLKE------------LKIGIMGCIVNGPGEMADADYGYVGAGPGRIDLYKQKI
ISPG_RHOBA       KVKEMTTFAQEYS---------ITIAVMGCRVNGPGETDDADLGLWCGPAKVNLKRGPE-
ISPG_HELHP       VESRIKHIKIP-----------LQVSVMGCAVNALGEAKHADIAIAFGNKDGLIIKEGKI
ISPG_HELPJ       VEKRLSHIKTP-----------LDISVMGCVVNALGEAKHADMAIAFGNRSGLIIKEGKV
ISPG_WOLSU       VEERVKHIRAP-----------LQISVMGCAVNALGEAKHADIAIAFGRGDGLIIKKGEI
ISPG_CAMJE       VEEKTKHIKEP-----------LNISVMGCVVNALGEAKGADVAIAFGKNQGLVIRHGEV
ISPG_CORDI       VTAALDGMSIP-----------LRVAVMGCVVNGPGEARDADLGVASGNGKGQIFVRGEV
ISPG_MYCPA       VSAGLDGLDVP-----------LRVAVMGCVVNGPGEAREADLGVASGNGKGQIFVRGEV
ISPG1_STRAW      VTAGLEGMEVP-----------LRVAVMGCVVNGPGEAREADLGVASGNGKGQIFVKGEI
ISPG_TROWT       VTKGLEKLTVP-----------LRVAVMGCIVNGPGEAREADLGVASGNGKGQIFVRGQV
ISPG_BIFLO       VTEGLKDVTAP-----------IRVAVMGCIVNGPGEAREADLGVASGNGKGQIFIKGKV
ISPG_AQUAE       VQEKLSGVKTP-----------LKVAVMGCVVNAIGEAREADIGLACGRGFAWLFKHGKP
ISPG_BUCAI       LEKNLEDISTP-----------IDVSIIGCVVNGIGESKIATLGLAGSHKKSAFYEDGVR
ISPG_BUCAP       LEKNLEDLSTP-----------MNVSIIGCIVNGIGEAKVSTLGIVGGSKTSALYKDGIR
ISPG_ECOLI       LEQRLEDIITP-----------MDVSIIGCVVNGPGEALVSTLGVTGGNKKSGLYEDGVR
ISPG_VIBVY       LEERLEDIITP-----------MDVSIIGCVVNGPGEAEVSHLGLAGSNKKSAFYEDGKR
ISPG_HAEDU       LEQRLEDILTP-----------MDVSIIGCVVNGPGEALVSDLGVTGSNKMSGFYLDGVR
ISPG_WIGBR       LEKRLEDVITP-----------MNVSVIGCMVNGLGEANRADIGISGSRNKSILFENGLR
ISPG_PSESM       LEGRLEDLLVP-----------LDVAVIGCVVNGPGEAKEAHIGLTGGTPNLIYID--GK
ISPG_CAUVC       LEERLAHISTP-----------MSLSIIGCVVNGPGEALMTDIGFTGGGAGAGMVYMAGK
ISPG_CLOAB       VEKRLEKTNKS-----------IKVAVMGCVVNGPGEAREADIGIAGGKGEGLIFKKGEI
ISPG_CLOTE       VEKRLDGFDKN-----------IKVAIMGCVVNGPGEARDADIGIAGGKGYGLIFKKGEV
ISPG_CLOPE       VEERLSSCKKN-----------IKVAVMGCVVNGPGEAREADIGIAGGKGEGLIFRKGEI
ISPG_CALS4       VERRTSHIKKP-----------LKVAVMGCVVNGPGEAKEADIGIAGGDREGVIFKKGKI
ISPG_LISMO       VENYIAKIEVP-----------IKVAVLGCAVNGPGEAREADIGIAGSNGEGLLFRHGKI
ISPG_BACCR       VEEYISTLQVP-----------IKVAVLGCAVNGPGEAREADIGIAGARGEGLLFRKGQV
ISPG_FUSNN       VEEEFRTKKNK-----------FKIAVMGCVVNGPGEAREADYGIAAGRGIGILFKKGEI
ISPG_DESVH       VERRLEGETES-----------FKVAVMGCVVNGPGEAREADLGIAGGRDKGIIFRKGEI
ISPG_GEOSL       VEKRLAGIDAH-----------LTVAVMGCVVNGPGEAREADVGIAGGRGEGLLFRNGEI
ISPG_MYCPE       IEKFTRKMNFP-----------LKVAILGCAVNGPGEAKEADIGIAGGNGTGIIFANGKA
ISPG_MYCGA       IEEFVKDLHFP-----------LKVSILGCSVNGPGEAKEADIGIAGGKQEGIIFKKGVV
ISPG_TREPA       WQKELFSLKKD-----------ITVAVMGCVVNGPGEGKHADLGISGAEDSVIFFKRGKI
ISPG_TREDE       WQTKLLSEKKD-----------ISIAVMGCVVNGPGEGKHADLGITGAEDSVIIFKHGAI
ISPG_THEMA       IEENFFHVQKR-----------LKIAVMGCVVNGIGEGKDADLGVAGLRDGAVIFVKGEI
ISPG_DEIRA       KIQDFIRESMPEWKAKYPGVEDMQVAVMGCVVNGPGESKHANIGISLPGTGEDPRAPVYQ
ISPG_THETH       EVSRRLKERLPEWRARYPGVEELKVAVMGCVVNGPGESKHAHIGISLPGAGEEPKAPVYA
ISPG_NEIMB       DVQNYLRQKMSIWRTLYPGVESLNVAVMGCVVNGPGESKLADIGISLPGTGETPVAPVYV
ISPG_CHRVO       HIQSYLRERMPVWRLQYPGVEDMKVAVMGCVVNGPGESKLADIGISLPGTGEVPVAPVYV
ISPG_RALSO       RIQSYLREQMPVWKTQYPGVEDMNVAVMGCIVNGPGESKHANIGISLPGTGESPAAPVFV
ISPG_BORPE       SIQSFLRRQMPLWRTRYPGVESMNVAVMGCVVNGPGESRHADIGISLPGTGEVPAAPVFI
ISPG_NITEU       SIQIYVREQMVIWREQYEGVENMSLAVMGCVVNGPGESKHADIGISLPGSGETPVAPVFV
ISPG_RHILO       NIQADLRKNMPVWREKYPGVENLKVAVMGCIVNGPGESKHADIGISLPGTGETPTAPVFV
ISPG_RHIME       KIQEDIRASMPVWREKYPGVEALKVAVMGCIVNGPGESKHADIGISLPGTGEMPAAPVFI
ISPG_RHOPA       SIQDFIRDEMPEWRSRYPGVENLNVAVMGCIVNGPGESKHANIGISLPGTGETPAAPVFV
ISPG_XANCP       VVQNHVRAKMPEWKISNPGAENMTLAVMGCVVNGPGESRHANIGISLPGTGEAPSAPVFV
ISPG_XYLFT       TVQQHVRDKMQVWKITHPGAETMTLAVMGCVVNGPGESRHANIGISLPGTGEMPVAPVFI
ISPG_EHRRG       DVNKYVADRMSVWKSANPGVENMTIAVMGCVVNGPGESKHANLGISMPGYGERSVAAVYQ
ISPG_EHRRW       DVNKYVADRMSVWKNANPGVENMTIAVMGCVVNGPGESKHANLGISMPGYGERSVAAVYQ
ISPG_ANAMM       GVNHYIDRRMQVWKVSNPGVVNMTVAVMGCVVNGPGESKHANLGISLPGNGEREVAAVYE
ISPG_WOLTR       EVNDYIKIRMPTWKKKNPGVEHMNIAVMGCIVNGPGESKHANLGISLPGYGEKPISAVYK
ISPG_WOLPM       EVNGYIKTHMPMWKKKNPGVEHMNIAVMGCIVNGPGESKHANLGISLPGYGEKPVSAVYK
                                       . :.::** **. **   :  .                

ISPG_CHLCV       CVKAHIPMEDAEEELVRLLQEHGVWKDPE----------------------
ISPG_CHLPN       CVKAHIPMEDAEEELIRLLQEHGVWKDPEETKLTV----------------
ISPG_CHLMU       CVKSYVPMENAEEELIQLLKEHGVWKEPE----------------------
ISPG_CHLTR       CVKSCIPIENAEEELVQLLKEHGVWKEPE----------------------
ISPG_THEVB       EEVKKVPEAEGVAALVELIKADGRWVDP-----------------------
ISPG_SYNY3       EEIKRVPETDGVQELINLIKADGRWVDP-----------------------
ISPG_GLOVI       EEIKKVPEARGVEALVDLIKSDGRWVDP-----------------------
ISPG_PROMM       DEIRKVSESEGVDALIQLIKDDGRWVDPP----------------------
ISPG_PARMW       DEIRKVPEEEGVNALIQLIKEDGRWVEPA----------------------
ISPG_PROMA       EEIRKVPEDEGVSALVELIKSDGKWIDP-----------------------
ISPG_PROMP       EEIKRVPEDEGVDALIRLIKDDGKWIDP-----------------------
ISPG_LEPIN       IVLKNVPSEIADEKLVQLIKDNGLWQDPSND--------------------
ISPG_BACTN       CVEKNIPEEEAVERLLEFIRNDRKELEL-----------------------
ISPG_PORGI       CVRRGIPQEQAVQQLIELIKENGDWKER-----------------------
ISPG_RHOBA       -ALGAFGYDEILPKLKQELDDLIAAKQ------------------------
ISPG_HELHP       LCKLKEDQLLERFITEVEELAKQREEV------------------------
ISPG_HELPJ       IHKLAEKDLFETFVIEVENLAKEREKSLKD---------------------
ISPG_WOLSU       LCKLPEEELVDRLVEEAEKLEREYLEDSFKN--------------------
ISPG_CAMJE       VAKLKESELVDRFLAEVEDEVKSRVVKE-----------------------
ISPG_CORDI       IKTVPESQIVETLIEEAVRLAEAE----GLEIEEGAGPQVKITR-------
ISPG_MYCPA       IKTVPESQIVETLIEEAMRIAAQMNSEGGPEATSSGSPVVTVS--------
ISPG1_STRAW      IKTVPESKIVETLIEEAMKIAEQM----EADGIASGEPSVSVAG-------
ISPG_TROWT       IKTVPESEIVPTLLEEANRLAGEM-------PFSSGSPTIAIV--------
ISPG_BIFLO       IKTVPEDQIVDTLLTIANDIAAQMEADGQVPVNSTGPVVVPIQHPGH----
ISPG_AQUAE       IKKVDESEMVDELLKEIQNMEKDG-----------GTN-------------
ISPG_BUCAI       QKEKIKNEEIIEKMEIKIRKKIDKLNNSKKNN-------------------
ISPG_BUCAP       QKNKLKNQEIIKELEIKIRKKAKSLDKLKKII-------------------
ISPG_ECOLI       -KDRLDNNDMIDQLEARIRAKASQLDEARRIDVQQVEK-------------
ISPG_VIBVY       QKERFDNEDLVNQLEAKIRAKAARMDESNRIDIKVQN--------------
ISPG_HAEDU       QKERFDNDKLIDQLEAKIRAKVAQQHHRIAIEQI-----------------
ISPG_WIGBR       NNNKINNEEIIDKLEKYIRKKVKILNLKNNC--------------------
ISPG_PSESM       PAQKLTNDNLVDELERLIREKAAEKTAADASVIVRG---------------
ISPG_CAUVC       PDHKQSNEGMIDHIVDLVEKKAAEIQAAKAQDEAAQTVAAE----------
ISPG_CLOAB       IKKVKE-ENLVDELMREIDNM------------------------------
ISPG_CLOTE       VRKLKE-EDLVEGLIEEIKNI------------------------------
ISPG_CLOPE       IKKVKE-EDLVEELIKIIETI------------------------------
ISPG_CALS4       YKIVKE-EHLLEELLKEIEKMVKEE--------------------------
ISPG_LISMO       IRKVPE-AIMIDELKKEIDILAEEFFVKKIDLESLR---------------
ISPG_BACCR       VRKVPE-ETMVEELKKEIDVIAAEMAAEREKEKETQEQ-------------
ISPG_FUSNN       IKKVSE-SNLLEELKKMISEDLENKKD------------------------
ISPG_DESVH       VRTVKGGSNLLAAFMEELDTFLAHRRAERKDD-------------------
ISPG_GEOSL       VRKVPE-ADMADALIAEVEKILAEKH-------------------------
ISPG_MYCPE       IKSVPEDQLVDELKKLISIKYKEYLDSKKDK--------------------
ISPG_MYCGA       VKSVKQEYLVDELKQMILEEYELFKKKNGK---------------------
ISPG_TREPA       VRRIQVRDLCADERTRIIDAAFKEELSSL----------------------
ISPG_TREDE       TKRLDLKKLTEEEKIKAVDKAFIEELQSL----------------------
ISPG_THEMA       KERVSKEFVL--ERLKYYLNELLEEVER-----------------------
ISPG_DEIRA       DGKLLTTLKGPRIAEEFQELLEKYVEERYGQGVAQG---------------
ISPG_THETH       DGKLLTILKGEGIAEEFLRLVEDYVKTRFAPKA------------------
ISPG_NEIMB       DGERKVTLKGDNIATEFLAIVEEYVKTNYGENGLKRH--QGKVIPIHSL--
ISPG_CHRVO       DGQKDVTLKGDNIPAEFTAIVDNYVKTRYGEGGAKRREVASRTIPIRPVKA
ISPG_RALSO       DGVKVKTLRGERIAEDFQVIVDEYVRTHYGAAQAKATAAE-----------
ISPG_BORPE       DGERTVTLKGDHIAEEFQAIVEDYVARRYGAGITH----------------
ISPG_NITEU       DGQKTVTLKGDNIAGEFRMIVDEYVRTKYRKKAANA---------------
ISPG_RHILO       DGKKAATLRGTSIAADFEKMVTDYIEQRFGRGGKAAAE-------------
ISPG_RHIME       DGQKALTLRGPKIAEDFQLLVADYIEKRFGHGQAAAE--------------
ISPG_RHOPA       DGEKFRTLRGENIAADFKALVIDYIEQRYGATPKPDAAQMVPAAE------
ISPG_XANCP       DGEKTVTLRGENIAYEFIDLIDQYVERTYVRRAG-----------------
ISPG_XYLFT       DGEKSVTLRGGNIAQDFITLVDDYVERRYARFPD-----------------
ISPG_EHRRG       NGEKLCTLEGNNIFEQFVSIIENYVSIYYH---------------------
ISPG_EHRRW       NGEKLCTLEGNNIFEQFVSIIENYVSIYYH---------------------
ISPG_ANAMM       DGRKLCTLHGENVLGEFLEIVESYVHRKYG---------------------
ISPG_WOLTR       DGKYFKTLQGDNIFEEFKAIIDDYVKEHYT---------------------
ISPG_WOLPM       NGKYFKTLQGDNVSEEFKAIIDNYVKKHYT---------------------